F465842
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 253 | 1158 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10024795|Ga0265338_100247955 |
| Length | 258 |
| Sequence | VDAPGDDPNDGQAPNEPRRYGRGLFLATVAGGLTSLVWGKAVWGHVSGALGSAESLVPLVPTGGWRIYTVSGSMPTFDAATWRLTVAGQVEEPTTFSYEQLRALPRVNQISTFHCVTGWTVKNVHWGGVRMADVLASARPLPEAGALQFVSAERPYIDYLTVEQASLHDVMLAYEMDGKPLPREHGAPVRLIIPEMYGYKNVKWLQEINLVQSPQAGYWEELGYDEDAWVGRSNGYGSSPAITPSAQPVPSHRGALTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 132 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 139 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 149 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 150 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 151 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 156 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 159 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 173 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 176 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 177 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 178 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 179 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 180 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.75 |
| Metatranscriptomes | 2.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.54 |
| Rhizosphere | 88.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265338_10024795 | 3300028800 | Bacteria | 6112 |
| 2 | Ga0070658_10410253 | 3300005327 | Bacteria | 1164 |
| 3 | Ga0070658_10453542 | 3300005327 | Unclassified | 1105 |
| 4 | Ga0070683_100005013 | 3300005329 | Bacteria | 10989 |
| 5 | Ga0070683_100016127 | 3300005329 | Bacteria | 6578 |
| 6 | Ga0070683_100266764 | 3300005329 | Bacteria | 1628 |
| 7 | Ga0070683_100317239 | 3300005329 | Unclassified | 1483 |
| 8 | Ga0070680_100016898 | 3300005336 | Bacteria | 5743 |
| 9 | Ga0070680_100018961 | 3300005336 | Bacteria | 5444 |
| 10 | Ga0070680_100057549 | 3300005336 | Bacteria | 3178 |
| 11 | Ga0070680_100093251 | 3300005336 | Bacteria | 2495 |
| 12 | Ga0070682_100213146 | 3300005337 | Unclassified | 1370 |
| 13 | Ga0070660_100000345 | 3300005339 | Bacteria | 30972 |
| 14 | Ga0070660_100035475 | 3300005339 | Bacteria | 3775 |
| 15 | Ga0070660_100541473 | 3300005339 | Unclassified | 971 |
| 16 | Ga0070691_10040950 | 3300005341 | Unclassified | 2190 |
| 17 | Ga0070661_100004985 | 3300005344 | Bacteria | 9146 |
| 18 | Ga0070661_100048152 | 3300005344 | Bacteria | 3120 |
| 19 | Ga0070661_100058676 | 3300005344 | Bacteria | 2821 |
| 20 | Ga0070661_100278940 | 3300005344 | Unclassified | 1296 |
| 21 | Ga0070668_100249968 | 3300005347 | Unclassified | 1471 |
| 22 | Ga0070675_100027408 | 3300005354 | Bacteria | 4576 |
| 23 | Ga0070671_100100327 | 3300005355 | Bacteria | 2429 |
| 24 | Ga0070671_100205552 | 3300005355 | Unclassified | 1670 |
| 25 | Ga0070671_100384117 | 3300005355 | Bacteria | 1200 |
| 26 | Ga0070674_100016297 | 3300005356 | Bacteria | 4657 |
| 27 | Ga0070673_100123445 | 3300005364 | Unclassified | 2164 |
| 28 | Ga0070688_100017482 | 3300005365 | Bacteria | 4116 |
| 29 | Ga0070659_100032398 | 3300005366 | Bacteria | 4053 |
| 30 | Ga0070703_10010301 | 3300005406 | Unclassified | 2635 |
| 31 | Ga0070713_100086677 | 3300005436 | Unclassified | 2685 |
| 32 | Ga0070710_10046035 | 3300005437 | Unclassified | 2428 |
| 33 | Ga0070710_10174232 | 3300005437 | Bacteria | 1342 |
| 34 | Ga0070701_10036720 | 3300005438 | Unclassified | 2470 |
| 35 | Ga0070701_10235016 | 3300005438 | Bacteria | 1100 |
| 36 | Ga0070711_100162847 | 3300005439 | Bacteria | 1692 |
| 37 | Ga0070711_100365812 | 3300005439 | Unclassified | 1163 |
| 38 | Ga0070711_100386148 | 3300005439 | Bacteria | 1133 |
| 39 | Ga0070705_100102521 | 3300005440 | Bacteria | 1810 |
| 40 | Ga0070700_100025322 | 3300005441 | Bacteria | 3493 |
| 41 | Ga0070694_100068519 | 3300005444 | Bacteria | 2439 |
| 42 | Ga0070663_100448938 | 3300005455 | Bacteria | 1062 |
| 43 | Ga0070678_100113656 | 3300005456 | Unclassified | 2123 |
| 44 | Ga0070681_10000245 | 3300005458 | Bacteria | 43091 |
| 45 | Ga0070681_10016674 | 3300005458 | Bacteria | 7334 |
| 46 | Ga0070681_10057836 | 3300005458 | Bacteria | 3857 |
| 47 | Ga0070681_10085030 | 3300005458 | Bacteria | 3116 |
| 48 | Ga0070681_10089327 | 3300005458 | Bacteria | 3033 |
| 49 | Ga0070681_10096659 | 3300005458 | Unclassified | 2901 |
| 50 | Ga0070681_10133462 | 3300005458 | Bacteria | 2414 |
| 51 | Ga0070681_10194665 | 3300005458 | Bacteria | 1946 |
| 52 | Ga0070681_10550449 | 3300005458 | Bacteria | 1068 |
| 53 | Ga0068867_100206063 | 3300005459 | Unclassified | 1576 |
| 54 | Ga0070685_10024996 | 3300005466 | Unclassified | 3286 |
| 55 | Ga0070706_100459634 | 3300005467 | Bacteria | 1184 |
| 56 | Ga0070707_100138217 | 3300005468 | Unclassified | 2370 |
| 57 | Ga0070707_100202365 | 3300005468 | Bacteria | 1936 |
| 58 | Ga0070707_100231215 | 3300005468 | Bacteria | 1800 |
| 59 | Ga0070707_100433444 | 3300005468 | Bacteria | 1275 |
| 60 | Ga0070698_100018095 | 3300005471 | Bacteria | 7420 |
| 61 | Ga0070698_100110276 | 3300005471 | Bacteria | 2717 |
| 62 | Ga0070698_100592612 | 3300005471 | Bacteria | 1049 |
| 63 | Ga0070698_100700574 | 3300005471 | Bacteria | 955 |
| 64 | Ga0070699_100149805 | 3300005518 | Unclassified | 2063 |
| 65 | Ga0070679_100001751 | 3300005530 | Bacteria | 19537 |
| 66 | Ga0070679_100002208 | 3300005530 | Bacteria | 17574 |
| 67 | Ga0070679_100029530 | 3300005530 | Bacteria | 5410 |
| 68 | Ga0070679_100042256 | 3300005530 | Bacteria | 4539 |
| 69 | Ga0070679_100288578 | 3300005530 | Bacteria | 1592 |
| 70 | Ga0070679_100406801 | 3300005530 | Bacteria | 1306 |
| 71 | Ga0070684_100059474 | 3300005535 | Bacteria | 3341 |
| 72 | Ga0070684_100093867 | 3300005535 | Bacteria | 2672 |
| 73 | Ga0070684_100098880 | 3300005535 | Unclassified | 2603 |
| 74 | Ga0070684_100191815 | 3300005535 | Bacteria | 1860 |
| 75 | Ga0070684_100293236 | 3300005535 | Bacteria | 1492 |
| 76 | Ga0070684_100372111 | 3300005535 | Bacteria | 1315 |
| 77 | Ga0070684_100444367 | 3300005535 | Unclassified | 1198 |
| 78 | Ga0070697_100349088 | 3300005536 | Bacteria | 1277 |
| 79 | Ga0068853_100045919 | 3300005539 | Bacteria | 3744 |
| 80 | Ga0070672_100075405 | 3300005543 | Unclassified | 2693 |
| 81 | Ga0070686_100013521 | 3300005544 | Bacteria | 4678 |
| 82 | Ga0070695_100113533 | 3300005545 | Bacteria | 1842 |
| 83 | Ga0070696_100058191 | 3300005546 | Bacteria | 2699 |
| 84 | Ga0070696_100130733 | 3300005546 | Unclassified | 1827 |
| 85 | Ga0070665_100032268 | 3300005548 | Bacteria | 5272 |
| 86 | Ga0070704_100075041 | 3300005549 | Bacteria | 2468 |
| 87 | Ga0068855_100022974 | 3300005563 | Bacteria | 7473 |
| 88 | Ga0068855_100032236 | 3300005563 | Bacteria | 6256 |
| 89 | Ga0068855_100032532 | 3300005563 | Bacteria | 6226 |
| 90 | Ga0068855_100059609 | 3300005563 | Bacteria | 4465 |
| 91 | Ga0068855_100115212 | 3300005563 | Bacteria | 3081 |
| 92 | Ga0068855_100118271 | 3300005563 | Bacteria | 3035 |
| 93 | Ga0068855_100155435 | 3300005563 | Unclassified | 2599 |
| 94 | Ga0068855_100267375 | 3300005563 | Bacteria | 1903 |
| 95 | Ga0070664_100597556 | 3300005564 | Bacteria | 1023 |
| 96 | Ga0068857_100047964 | 3300005577 | Bacteria | 3793 |
| 97 | Ga0068857_100061492 | 3300005577 | Bacteria | 3336 |
| 98 | Ga0068857_100069392 | 3300005577 | Bacteria | 3139 |
| 99 | Ga0068856_100228205 | 3300005614 | Bacteria | 1877 |
| 100 | Ga0068856_100229479 | 3300005614 | Bacteria | 1872 |
| 101 | Ga0068856_100278467 | 3300005614 | Bacteria | 1689 |
| 102 | Ga0070702_100059634 | 3300005615 | Bacteria | 2215 |
| 103 | Ga0070702_100094582 | 3300005615 | Unclassified | 1820 |
| 104 | Ga0068852_100066172 | 3300005616 | Bacteria | 3155 |
| 105 | Ga0068852_100091159 | 3300005616 | Bacteria | 2727 |
| 106 | Ga0068866_10408942 | 3300005718 | Bacteria | 877 |
| 107 | Ga0068861_100343902 | 3300005719 | Bacteria | 1306 |
| 108 | Ga0068870_10023393 | 3300005840 | Unclassified | 3046 |
| 109 | Ga0070717_10051518 | 3300006028 | Bacteria | 3388 |
| 110 | Ga0070717_10122147 | 3300006028 | Bacteria | 2232 |
| 111 | Ga0070715_10000206 | 3300006163 | Bacteria | 13864 |
| 112 | Ga0070715_10035952 | 3300006163 | Bacteria | 2040 |
| 113 | Ga0070716_100003710 | 3300006173 | Bacteria | 7232 |
| 114 | Ga0070712_100045319 | 3300006175 | Bacteria | 3036 |
| 115 | Ga0070712_100045684 | 3300006175 | Bacteria | 3025 |
| 116 | Ga0070712_100158217 | 3300006175 | Unclassified | 1747 |
| 117 | Ga0070712_100182691 | 3300006175 | Bacteria | 1635 |
| 118 | Ga0097621_100279027 | 3300006237 | Unclassified | 1470 |
| 119 | Ga0068871_100306040 | 3300006358 | Unclassified | 1396 |
| 120 | Ga0075434_100055830 | 3300006871 | Bacteria | 3924 |
| 121 | Ga0075434_100737135 | 3300006871 | Bacteria | 1002 |
| 122 | Ga0075436_100104933 | 3300006914 | Bacteria | 1970 |
| 123 | Ga0075435_100072732 | 3300007076 | Unclassified | 2809 |
| 124 | Ga0075435_100351134 | 3300007076 | Bacteria | 1264 |
| 125 | Ga0105240_10019847 | 3300009093 | Bacteria | 8977 |
| 126 | Ga0105240_10020987 | 3300009093 | Bacteria | 8694 |
| 127 | Ga0105240_10096020 | 3300009093 | Bacteria | 3613 |
| 128 | Ga0105240_10104598 | 3300009093 | Bacteria | 3438 |
| 129 | Ga0105240_10108419 | 3300009093 | Bacteria | 3365 |
| 130 | Ga0105240_10141705 | 3300009093 | Bacteria | 2873 |
| 131 | Ga0105240_10224580 | 3300009093 | Bacteria | 2186 |
| 132 | Ga0105240_10281456 | 3300009093 | Bacteria | 1910 |
| 133 | Ga0105240_10297961 | 3300009093 | Bacteria | 1846 |
| 134 | Ga0105240_10487464 | 3300009093 | Unclassified | 1373 |
| 135 | Ga0105245_10021680 | 3300009098 | Bacteria | 5639 |
| 136 | Ga0105245_10538015 | 3300009098 | Unclassified | 1189 |
| 137 | Ga0105245_10711159 | 3300009098 | Unclassified | 1038 |
| 138 | Ga0105242_10008749 | 3300009176 | Bacteria | 7768 |
| 139 | Ga0105242_10087343 | 3300009176 | Unclassified | 2618 |
| 140 | Ga0105242_10657382 | 3300009176 | Unclassified | 1020 |
| 141 | Ga0105248_10197587 | 3300009177 | Unclassified | 2266 |
| 142 | Ga0105237_10004783 | 3300009545 | Bacteria | 15563 |
| 143 | Ga0105237_10196786 | 3300009545 | Bacteria | 2015 |
| 144 | Ga0105238_10027462 | 3300009551 | Bacteria | 5801 |
| 145 | Ga0105238_10121804 | 3300009551 | Bacteria | 2588 |
| 146 | Ga0105238_10562661 | 3300009551 | Bacteria | 1145 |
| 147 | Ga0105238_10935235 | 3300009551 | Unclassified | 886 |
| 148 | Ga0105239_10043656 | 3300010375 | Bacteria | 4915 |
| 149 | Ga0105239_10052370 | 3300010375 | Bacteria | 4476 |
| 150 | Ga0105239_10324210 | 3300010375 | Unclassified | 1737 |
| 151 | Ga0105239_10901349 | 3300010375 | Bacteria | 1015 |
| 152 | Ga0105246_10063863 | 3300011119 | Unclassified | 2570 |
| 153 | Ga0157373_10113436 | 3300013100 | Unclassified | 1905 |
| 154 | Ga0157370_10012792 | 3300013104 | Bacteria | 8676 |
| 155 | Ga0157370_10034824 | 3300013104 | Bacteria | 4900 |
| 156 | Ga0157370_10039804 | 3300013104 | Bacteria | 4540 |
| 157 | Ga0157370_10046425 | 3300013104 | Bacteria | 4164 |
| 158 | Ga0157370_10092727 | 3300013104 | Bacteria | 2835 |
| 159 | Ga0157370_10109457 | 3300013104 | Bacteria | 2583 |
| 160 | Ga0157370_10120132 | 3300013104 | Unclassified | 2453 |
| 161 | Ga0157370_10283290 | 3300013104 | Bacteria | 1531 |
| 162 | Ga0157369_10004549 | 3300013105 | Bacteria | 16311 |
| 163 | Ga0157369_10006864 | 3300013105 | Bacteria | 13135 |
| 164 | Ga0157369_10020044 | 3300013105 | Bacteria | 7480 |
| 165 | Ga0157369_10034681 | 3300013105 | Bacteria | 5535 |
| 166 | Ga0157369_10036352 | 3300013105 | Bacteria | 5397 |
| 167 | Ga0157369_10052939 | 3300013105 | Bacteria | 4389 |
| 168 | Ga0157369_10155642 | 3300013105 | Bacteria | 2414 |
| 169 | Ga0157369_10205250 | 3300013105 | Bacteria | 2067 |
| 170 | Ga0157369_10221333 | 3300013105 | Bacteria | 1981 |
| 171 | Ga0157369_10517082 | 3300013105 | Bacteria | 1235 |
| 172 | Ga0157374_10020377 | 3300013296 | Bacteria | 5882 |
| 173 | Ga0157374_10024729 | 3300013296 | Bacteria | 5385 |
| 174 | Ga0157378_10049015 | 3300013297 | Bacteria | 3757 |
| 175 | Ga0157378_11317455 | 3300013297 | Unclassified | 764 |
| 176 | Ga0157372_10567059 | 3300013307 | Bacteria | 1323 |
| 177 | Ga0157372_11283487 | 3300013307 | Unclassified | 845 |
| 178 | Ga0157375_10008178 | 3300013308 | Bacteria | 9157 |
| 179 | Ga0157377_10002216 | 3300014745 | Bacteria | 8542 |
| 180 | Ga0157377_10107197 | 3300014745 | Unclassified | 1674 |
| 181 | Ga0157379_10298105 | 3300014968 | Unclassified | 1469 |
| 182 | Ga0197907_10959858 | 3300020069 | Bacteria | 1086 |
| 183 | Ga0206356_10959344 | 3300020070 | Bacteria | 2163 |
| 184 | Ga0206356_11453031 | 3300020070 | Unclassified | 2520 |
| 185 | Ga0206350_10191131 | 3300020080 | Bacteria | 2012 |
| 186 | Ga0206354_11034401 | 3300020081 | Unclassified | 1867 |
| 187 | Ga0206354_11162633 | 3300020081 | Bacteria | 3258 |
| 188 | Ga0206353_10046952 | 3300020082 | Bacteria | 9286 |
| 189 | Ga0206353_10356125 | 3300020082 | Bacteria | 3863 |
| 190 | Ga0206353_10491957 | 3300020082 | Bacteria | 6059 |
| 191 | Ga0206353_10608505 | 3300020082 | Bacteria | 3949 |
| 192 | Ga0224712_10035111 | 3300022467 | Bacteria | 1849 |
| 193 | Ga0207692_10017741 | 3300025898 | Unclassified | 3180 |
| 194 | Ga0207692_10229393 | 3300025898 | Bacteria | 1104 |
| 195 | Ga0207685_10087220 | 3300025905 | Bacteria | 1306 |
| 196 | Ga0207699_10080343 | 3300025906 | Bacteria | 2020 |
| 197 | Ga0207645_10123598 | 3300025907 | Unclassified | 1681 |
| 198 | Ga0207643_10003414 | 3300025908 | Bacteria | 8564 |
| 199 | Ga0207705_10012175 | 3300025909 | Bacteria | 6217 |
| 200 | Ga0207705_10156172 | 3300025909 | Unclassified | 1712 |
| 201 | Ga0207705_10270834 | 3300025909 | Bacteria | 1298 |
| 202 | Ga0207705_10433342 | 3300025909 | Bacteria | 1018 |
| 203 | Ga0207707_10002971 | 3300025912 | Bacteria | 15096 |
| 204 | Ga0207707_10041740 | 3300025912 | Bacteria | 4006 |
| 205 | Ga0207707_10161024 | 3300025912 | Bacteria | 1962 |
| 206 | Ga0207707_10182231 | 3300025912 | Bacteria | 1833 |
| 207 | Ga0207707_10225324 | 3300025912 | Bacteria | 1632 |
| 208 | Ga0207707_10232407 | 3300025912 | Bacteria | 1604 |
| 209 | Ga0207707_10438610 | 3300025912 | Bacteria | 1118 |
| 210 | Ga0207695_10058342 | 3300025913 | Bacteria | 4007 |
| 211 | Ga0207695_10098602 | 3300025913 | Bacteria | 2921 |
| 212 | Ga0207695_10132277 | 3300025913 | Bacteria | 2451 |
| 213 | Ga0207695_10230900 | 3300025913 | Bacteria | 1755 |
| 214 | Ga0207695_10519659 | 3300025913 | Unclassified | 1072 |
| 215 | Ga0207695_10692523 | 3300025913 | Bacteria | 900 |
| 216 | Ga0207693_10005847 | 3300025915 | Bacteria | 10206 |
| 217 | Ga0207693_10007123 | 3300025915 | Bacteria | 9224 |
| 218 | Ga0207693_10031227 | 3300025915 | Bacteria | 4208 |
| 219 | Ga0207663_10011072 | 3300025916 | Bacteria | 4827 |
| 220 | Ga0207663_10150130 | 3300025916 | Unclassified | 1634 |
| 221 | Ga0207663_10568315 | 3300025916 | Unclassified | 888 |
| 222 | Ga0207660_10001145 | 3300025917 | Bacteria | 17681 |
| 223 | Ga0207660_10023066 | 3300025917 | Bacteria | 4199 |
| 224 | Ga0207660_10132820 | 3300025917 | Bacteria | 1896 |
| 225 | Ga0207660_10568485 | 3300025917 | Bacteria | 922 |
| 226 | Ga0207662_10080980 | 3300025918 | Unclassified | 1982 |
| 227 | Ga0207657_10000073 | 3300025919 | Bacteria | 93299 |
| 228 | Ga0207657_10001254 | 3300025919 | Bacteria | 27140 |
| 229 | Ga0207657_10008811 | 3300025919 | Bacteria | 10206 |
| 230 | Ga0207657_10014007 | 3300025919 | Bacteria | 7846 |
| 231 | Ga0207657_10295515 | 3300025919 | Bacteria | 1284 |
| 232 | Ga0207649_10006819 | 3300025920 | Bacteria | 6205 |
| 233 | Ga0207649_10017081 | 3300025920 | Bacteria | 4108 |
| 234 | Ga0207649_10248969 | 3300025920 | Bacteria | 1279 |
| 235 | Ga0207652_10027851 | 3300025921 | Bacteria | 4712 |
| 236 | Ga0207652_10122203 | 3300025921 | Bacteria | 2317 |
| 237 | Ga0207652_10127516 | 3300025921 | Bacteria | 2267 |
| 238 | Ga0207652_10243380 | 3300025921 | Unclassified | 1622 |
| 239 | Ga0207652_10539011 | 3300025921 | Bacteria | 1049 |
| 240 | Ga0207646_10009612 | 3300025922 | Bacteria | 9538 |
| 241 | Ga0207646_10058225 | 3300025922 | Bacteria | 3451 |
| 242 | Ga0207646_10146543 | 3300025922 | Bacteria | 2128 |
| 243 | Ga0207694_10163644 | 3300025924 | Bacteria | 1798 |
| 244 | Ga0207700_10029436 | 3300025928 | Bacteria | 3876 |
| 245 | Ga0207700_10366163 | 3300025928 | Unclassified | 1258 |
| 246 | Ga0207700_10538054 | 3300025928 | Unclassified | 1036 |
| 247 | Ga0207700_10541883 | 3300025928 | Bacteria | 1032 |
| 248 | Ga0207664_10080902 | 3300025929 | Archaea | 2642 |
| 249 | Ga0207664_10181811 | 3300025929 | Unclassified | 1805 |
| 250 | Ga0207690_10294845 | 3300025932 | Bacteria | 1267 |
| 251 | Ga0207706_10136506 | 3300025933 | Unclassified | 2158 |
| 252 | Ga0207686_10137985 | 3300025934 | Bacteria | 1682 |
| 253 | Ga0207670_10075984 | 3300025936 | Unclassified | 2336 |
| 254 | Ga0207665_10001018 | 3300025939 | Bacteria | 18916 |
| 255 | Ga0207665_10013242 | 3300025939 | Bacteria | 5422 |
| 256 | Ga0207665_10072061 | 3300025939 | Unclassified | 2359 |
| 257 | Ga0207691_10045560 | 3300025940 | Bacteria | 4030 |
| 258 | Ga0207711_10167562 | 3300025941 | Unclassified | 1992 |
| 259 | Ga0207661_10166304 | 3300025944 | Bacteria | 1917 |
| 260 | Ga0207661_10251463 | 3300025944 | Bacteria | 1571 |
| 261 | Ga0207661_10292601 | 3300025944 | Bacteria | 1458 |
| 262 | Ga0207667_10030368 | 3300025949 | Bacteria | 5847 |
| 263 | Ga0207667_10091280 | 3300025949 | Bacteria | 3147 |
| 264 | Ga0207667_10218193 | 3300025949 | Bacteria | 1954 |
| 265 | Ga0207667_10286544 | 3300025949 | Bacteria | 1683 |
| 266 | Ga0207667_10343344 | 3300025949 | Bacteria | 1523 |
| 267 | Ga0207667_10456440 | 3300025949 | Unclassified | 1298 |
| 268 | Ga0207651_10252245 | 3300025960 | Bacteria | 1444 |
| 269 | Ga0207712_10274805 | 3300025961 | Bacteria | 1372 |
| 270 | Ga0207668_10145917 | 3300025972 | Unclassified | 1826 |
| 271 | Ga0207640_10225693 | 3300025981 | Bacteria | 1437 |
| 272 | Ga0207639_10262974 | 3300026041 | Unclassified | 1510 |
| 273 | Ga0207678_10075227 | 3300026067 | Bacteria | 2893 |
| 274 | Ga0207702_10239370 | 3300026078 | Unclassified | 1700 |
| 275 | Ga0207702_10262111 | 3300026078 | Bacteria | 1628 |
| 276 | Ga0207702_10606155 | 3300026078 | Bacteria | 1075 |
| 277 | Ga0207648_10101245 | 3300026089 | Unclassified | 2525 |
| 278 | Ga0207674_10056895 | 3300026116 | Bacteria | 3968 |
| 279 | Ga0207674_10288255 | 3300026116 | Bacteria | 1590 |
| 280 | Ga0207675_100101739 | 3300026118 | Unclassified | 2707 |
| 281 | Ga0207675_100126680 | 3300026118 | Unclassified | 2419 |
| 282 | Ga0207683_10246048 | 3300026121 | Bacteria | 1631 |
| 283 | Ga0207698_10900831 | 3300026142 | Unclassified | 892 |
| 284 | Ga0268266_10221580 | 3300028379 | Unclassified | 1739 |
| 285 | Ga0268266_10257764 | 3300028379 | Bacteria | 1615 |
| 286 | Ga0268264_10796958 | 3300028381 | Bacteria | 944 |
| 287 | Ga0265337_1012112 | 3300028556 | Bacteria | 2943 |
| 288 | Ga0265337_1055067 | 3300028556 | Bacteria | 1112 |
| 289 | Ga0265337_1067400 | 3300028556 | Bacteria | 986 |
| 290 | Ga0265326_10022268 | 3300028558 | Bacteria | 1816 |
| 291 | Ga0265319_1081278 | 3300028563 | Bacteria | 1029 |
| 292 | Ga0265334_10000803 | 3300028573 | Bacteria | 15713 |
| 293 | Ga0265318_10000900 | 3300028577 | Bacteria | 19390 |
| 294 | Ga0265318_10000969 | 3300028577 | Bacteria | 18421 |
| 295 | Ga0265318_10008580 | 3300028577 | Bacteria | 4540 |
| 296 | Ga0265318_10027360 | 3300028577 | Bacteria | 2242 |
| 297 | Ga0265323_10035804 | 3300028653 | Unclassified | 1829 |
| 298 | Ga0265322_10038096 | 3300028654 | Bacteria | 1369 |
| 299 | Ga0265336_10062491 | 3300028666 | Bacteria | 1116 |
| 300 | Ga0265338_10007606 | 3300028800 | Bacteria | 13378 |
| 301 | Ga0265338_10007947 | 3300028800 | Bacteria | 12996 |
| 302 | Ga0265338_10020089 | 3300028800 | Bacteria | 7045 |
| 303 | Ga0265338_10024572 | 3300028800 | Bacteria | 6151 |
| 304 | Ga0265338_10031811 | 3300028800 | Bacteria | 5164 |
| 305 | Ga0265338_10269031 | 3300028800 | Bacteria | 1249 |
| 306 | Ga0265330_10005292 | 3300031235 | Bacteria | 6429 |
| 307 | Ga0265330_10033797 | 3300031235 | Bacteria | 2285 |
| 308 | Ga0265332_10006662 | 3300031238 | Bacteria | 5230 |
| 309 | Ga0265328_10004163 | 3300031239 | Bacteria | 6308 |
| 310 | Ga0265328_10064290 | 3300031239 | Bacteria | 1348 |
| 311 | Ga0265328_10071499 | 3300031239 | Bacteria | 1275 |
| 312 | Ga0265320_10009143 | 3300031240 | Bacteria | 6000 |
| 313 | Ga0265320_10110061 | 3300031240 | Bacteria | 1262 |
| 314 | Ga0265325_10002518 | 3300031241 | Bacteria | 12329 |
| 315 | Ga0265325_10003049 | 3300031241 | Bacteria | 11076 |
| 316 | Ga0265325_10045883 | 3300031241 | Bacteria | 2269 |
| 317 | Ga0265325_10054895 | 3300031241 | Bacteria | 2038 |
| 318 | Ga0265329_10017768 | 3300031242 | Bacteria | 2441 |
| 319 | Ga0265340_10011521 | 3300031247 | Bacteria | 4698 |
| 320 | Ga0265339_10007748 | 3300031249 | Bacteria | 6905 |
| 321 | Ga0265339_10013370 | 3300031249 | Bacteria | 4976 |
| 322 | Ga0265339_10146646 | 3300031249 | Bacteria | 1196 |
| 323 | Ga0265331_10003820 | 3300031250 | Bacteria | 9552 |
| 324 | Ga0265331_10017628 | 3300031250 | Bacteria | 3719 |
| 325 | Ga0265331_10025012 | 3300031250 | Bacteria | 3015 |
| 326 | Ga0265327_10007063 | 3300031251 | Bacteria | 8787 |
| 327 | Ga0265327_10022037 | 3300031251 | Bacteria | 3824 |
| 328 | Ga0265327_10066579 | 3300031251 | Unclassified | 1817 |
| 329 | Ga0265316_10018595 | 3300031344 | Bacteria | 5967 |
| 330 | Ga0265316_10029175 | 3300031344 | Bacteria | 4540 |
| 331 | Ga0265313_10002660 | 3300031595 | Bacteria | 15177 |
| 332 | Ga0265314_10009570 | 3300031711 | Bacteria | 8165 |
| 333 | Ga0265314_10029660 | 3300031711 | Bacteria | 4061 |
| 334 | Ga0265314_10152541 | 3300031711 | Bacteria | 1415 |
| 335 | Ga0265342_10004897 | 3300031712 | Bacteria | 10367 |
| 336 | Ga0265342_10040493 | 3300031712 | Bacteria | 2825 |
| 337 | Ga0265342_10062852 | 3300031712 | Bacteria | 2184 |
| 338 | Ga0265342_10084830 | 3300031712 | Unclassified | 1823 |
| 339 | Ga0373958_0012398 | 3300034819 | Bacteria | 1458 |
| 340 | Ga0373959_0007401 | 3300034820 | Bacteria | 1845 |
| 341 | Ga0373938_0022892 | 3300034957 | Bacteria | 1280 |
| 342 | Ga0373940_0035425 | 3300035088 | Bacteria | 1351 |
| 343 | Ga0373949_0009750 | 3300035090 | Unclassified | 2102 |
| 344 | Ga0373951_0019756 | 3300035091 | Bacteria | 1538 |
| 345 | Ga0373932_0009985 | 3300035112 | Bacteria | 2291 |
| 346 | Ga0373939_0021814 | 3300035114 | Bacteria | 1758 |
| 347 | Ga0373943_0015569 | 3300035170 | Bacteria | 3457 |
| 348 | Ga0373943_0272014 | 3300035170 | Unclassified | 956 |
| 349 | Ga0373946_0036155 | 3300035171 | Bacteria | 2001 |
| 350 | Ga0373962_0022413 | 3300035242 | Bacteria | 1674 |
| 351 | Ga0373924_0127450 | 3300035410 | Unclassified | 1107 |
| 352 | Ga0373931_0021929 | 3300035691 | Bacteria | 3209 |
| 353 | Ga0373931_0475544 | 3300035691 | Bacteria | 802 |
| 354 | Ga0373935_0076856 | 3300035692 | Unclassified | 2163 |
| 355 | Ga0373935_0250737 | 3300035692 | Bacteria | 1239 |
| 356 | Ga0373933_0065439 | 3300035724 | Bacteria | 2201 |
| 357 | Ga0373933_0152055 | 3300035724 | Unclassified | 1466 |
| 358 | Ga0373947_0048044 | 3300035725 | Unclassified | 2560 |
| 359 | Ga0373937_0055415 | 3300036401 | Bacteria | 3639 |
| 360 | Ga0373925_0017305 | 3300037068 | Bacteria | 5223 |
| 361 | Ga0373925_0130193 | 3300037068 | Bacteria | 1961 |
| 362 | Ga0395899_0055899 | 3300037312 | Unclassified | 2918 |
| 363 | Ga0395899_0121471 | 3300037312 | Archaea | 1871 |
| 364 | Ga0395900_0084760 | 3300037418 | Unclassified | 3256 |
| 365 | Ga0395900_0087681 | 3300037418 | Bacteria | 3198 |
| 366 | Ga0395900_0102316 | 3300037418 | Unclassified | 2943 |
| 367 | Ga0395900_0533972 | 3300037418 | Bacteria | 1119 |
| 368 | Ga0395898_0015943 | 3300037466 | Bacteria | 7700 |
| 369 | Ga0395898_0057972 | 3300037466 | Bacteria | 3771 |
| 370 | Ga0395898_0341111 | 3300037466 | Bacteria | 1429 |
| 371 | Ga0395898_0591302 | 3300037466 | Bacteria | 1052 |
| 372 | Ga0395905_0059246 | 3300037471 | Unclassified | 3579 |
| 373 | Ga0395905_0208093 | 3300037471 | Bacteria | 1833 |
| 374 | Ga0395901_0167603 | 3300038443 | Unclassified | 2305 |
| 375 | Ga0395901_0215301 | 3300038443 | Bacteria | 2009 |
| 376 | Ga0395901_0573248 | 3300038443 | Bacteria | 1141 |
| 377 | Ga0436360_0302860 | 3300039438 | Bacteria | 8167 |
| 378 | Ga0436362_0146775 | 3300039453 | Bacteria | 4928 |
| 379 | Ga0451789_0078257 | 3300041443 | Bacteria | 3320 |
| 380 | Ga0451793_0316351 | 3300041452 | Bacteria | 2242 |
| 381 | Ga0451835_0517062 | 3300041492 | Bacteria | 1649 |
| 382 | Ga0451839_0611328 | 3300041496 | Bacteria | 1539 |
| 383 | Ga0451841_1206048 | 3300041498 | Bacteria | 1299 |
| 384 | Ga0451847_0026636 | 3300041503 | Bacteria | 851 |
| 385 | Ga0466969_0016633 | 3300044656 | Bacteria | 3847 |
| 386 | Ga0466966_0004461 | 3300044684 | Bacteria | 9231 |
| 387 | Ga0466966_0094200 | 3300044684 | Bacteria | 1856 |
| 388 | Ga0466961_0034556 | 3300044693 | Bacteria | 3245 |
| 389 | Ga0466961_0082981 | 3300044693 | Unclassified | 2027 |
| 390 | Ga0466963_0007924 | 3300044694 | Bacteria | 6362 |
| 391 | Ga0466963_0016152 | 3300044694 | Bacteria | 4639 |
| 392 | Ga0466963_0061337 | 3300044694 | Unclassified | 2514 |
| 393 | Ga0466963_0218744 | 3300044694 | Bacteria | 1334 |
| 394 | Ga0466964_0030574 | 3300044706 | Bacteria | 2132 |
| 395 | Ga0466971_0027697 | 3300044719 | Bacteria | 2539 |
| 396 | Ga0466971_0086608 | 3300044719 | Bacteria | 1432 |
| 397 | Ga0466957_0061294 | 3300044842 | Bacteria | 2308 |
| 398 | Ga0466957_0085289 | 3300044842 | Unclassified | 1972 |
| 399 | Ga0466957_0268701 | 3300044842 | Bacteria | 1138 |
| 400 | Ga0466960_0031029 | 3300044901 | Bacteria | 2463 |
| 401 | Ga0466959_0022608 | 3300045049 | Bacteria | 4649 |
| 402 | Ga0466959_0166484 | 3300045049 | Unclassified | 1548 |
| 403 | Ga0466959_0271716 | 3300045049 | Bacteria | 1165 |
| 404 | Ga0466958_0005922 | 3300045836 | Bacteria | 6607 |
| 405 | Ga0466958_0099729 | 3300045836 | Bacteria | 1805 |
| 406 | Ga0466967_0005493 | 3300045976 | Bacteria | 8793 |
| 407 | Ga0466967_0018120 | 3300045976 | Bacteria | 5618 |
| 408 | Ga0466967_0044563 | 3300045976 | Bacteria | 3849 |
| 409 | Ga0466967_0098527 | 3300045976 | Bacteria | 2669 |
| 410 | Ga0466967_0149800 | 3300045976 | Bacteria | 2179 |
| 411 | Ga0466967_0231361 | 3300045976 | Bacteria | 1760 |
| 412 | Ga0466967_0352129 | 3300045976 | Unclassified | 1425 |
| 413 | Ga0466967_0356202 | 3300045976 | Unclassified | 1417 |
| 414 | Ga0466967_0701460 | 3300045976 | Bacteria | 1002 |
| 415 | Ga0495592_0042365 | 3300046454 | Bacteria | 3409 |
| 416 | Ga0495592_0230707 | 3300046454 | Unclassified | 1233 |
| 417 | Ga0495629_0023940 | 3300046459 | Bacteria | 4349 |
| 418 | Ga0495629_0081035 | 3300046459 | Bacteria | 2266 |
| 419 | Ga0495629_0117020 | 3300046459 | Bacteria | 1857 |
| 420 | Ga0495641_0036204 | 3300046461 | Bacteria | 2321 |
| 421 | Ga0495651_0007084 | 3300046462 | Bacteria | 8573 |
| 422 | Ga0495651_0065270 | 3300046462 | Bacteria | 2780 |
| 423 | Ga0495651_0084511 | 3300046462 | Bacteria | 2391 |
| 424 | Ga0495653_0004823 | 3300046463 | Bacteria | 10934 |
| 425 | Ga0495653_0008203 | 3300046463 | Bacteria | 8558 |
| 426 | Ga0495653_0114861 | 3300046463 | Bacteria | 1928 |
| 427 | Ga0495653_0273174 | 3300046463 | Bacteria | 1112 |
| 428 | Ga0495582_0228495 | 3300046473 | Unclassified | 1065 |
| 429 | Ga0495605_0107990 | 3300046474 | Bacteria | 1273 |
| 430 | Ga0495662_0068797 | 3300046476 | Unclassified | 1715 |
| 431 | Ga0495664_0137922 | 3300046477 | Bacteria | 1478 |
| 432 | Ga0495594_0098845 | 3300046499 | Unclassified | 1641 |
| 433 | Ga0495608_0002731 | 3300046511 | Bacteria | 12679 |
| 434 | Ga0495608_0057321 | 3300046511 | Bacteria | 2571 |
| 435 | Ga0495608_0267421 | 3300046511 | Unclassified | 1063 |
| 436 | Ga0495618_0029769 | 3300046514 | Bacteria | 3407 |
| 437 | Ga0495618_0050759 | 3300046514 | Bacteria | 2621 |
| 438 | Ga0495628_0067780 | 3300046516 | Unclassified | 2786 |
| 439 | Ga0495628_0134349 | 3300046516 | Bacteria | 1891 |
| 440 | Ga0495630_0028140 | 3300046517 | Bacteria | 4176 |
| 441 | Ga0495630_0084707 | 3300046517 | Bacteria | 2393 |
| 442 | Ga0495630_0108560 | 3300046517 | Bacteria | 2102 |
| 443 | Ga0495652_0014317 | 3300046529 | Bacteria | 7123 |
| 444 | Ga0495652_0126384 | 3300046529 | Unclassified | 2031 |
| 445 | Ga0495640_0006813 | 3300046533 | Bacteria | 9009 |
| 446 | Ga0495640_0023415 | 3300046533 | Bacteria | 4499 |
| 447 | Ga0495640_0107863 | 3300046533 | Bacteria | 1822 |
| 448 | Ga0495586_0006308 | 3300046535 | Bacteria | 6335 |
| 449 | Ga0495587_0298230 | 3300046536 | Unclassified | 902 |
| 450 | Ga0495645_0201320 | 3300046543 | Unclassified | 1351 |
| 451 | Ga0495667_0005419 | 3300046559 | Bacteria | 8625 |
| 452 | Ga0495667_0006310 | 3300046559 | Bacteria | 8044 |
| 453 | Ga0495667_0017263 | 3300046559 | Bacteria | 4876 |
| 454 | Ga0495667_0037301 | 3300046559 | Bacteria | 3240 |
| 455 | Ga0495667_0077353 | 3300046559 | Bacteria | 2164 |
| 456 | Ga0495634_0007192 | 3300046642 | Bacteria | 8392 |
| 457 | Ga0495634_0055191 | 3300046642 | Bacteria | 2657 |
| 458 | Ga0495634_0139634 | 3300046642 | Bacteria | 1539 |
| 459 | Ga0495634_0160361 | 3300046642 | Unclassified | 1418 |
| 460 | Ga0495635_0010289 | 3300046663 | Bacteria | 6542 |
| 461 | Ga0495635_0063926 | 3300046663 | Bacteria | 2527 |
| 462 | Ga0495635_0144422 | 3300046663 | Unclassified | 1620 |
| 463 | Ga0495657_0025584 | 3300046675 | Bacteria | 4190 |
| 464 | Ga0495657_0037756 | 3300046675 | Unclassified | 3327 |
| 465 | Ga0495599_0124713 | 3300046678 | Bacteria | 1601 |
| 466 | Ga0495599_0296635 | 3300046678 | Bacteria | 976 |
| 467 | Ga0495646_0237639 | 3300046680 | Bacteria | 980 |
| 468 | Ga0495658_0052080 | 3300046683 | Bacteria | 2320 |
| 469 | Ga0495658_0122340 | 3300046683 | Unclassified | 1575 |
| 470 | Ga0495658_0202173 | 3300046683 | Unclassified | 1238 |
| 471 | Ga0495658_0463790 | 3300046683 | Bacteria | 810 |
| 472 | Ga0495613_0013086 | 3300046689 | Bacteria | 6165 |
| 473 | Ga0495613_0016927 | 3300046689 | Bacteria | 5429 |
| 474 | Ga0495613_0074598 | 3300046689 | Bacteria | 2470 |
| 475 | Ga0495613_0327892 | 3300046689 | Bacteria | 1055 |
| 476 | Ga0495600_0012994 | 3300046809 | Bacteria | 5221 |
| 477 | Ga0495600_0026587 | 3300046809 | Unclassified | 3736 |
| 478 | Ga0495581_0182287 | 3300047315 | Bacteria | 1228 |
| 479 | Ga0495604_0042405 | 3300047317 | Bacteria | 3566 |
| 480 | Ga0495674_0009681 | 3300047319 | Bacteria | 9147 |
| 481 | Ga0495674_0087356 | 3300047319 | Bacteria | 2668 |
| 482 | Ga0495676_0126434 | 3300047321 | Bacteria | 1852 |
| 483 | Ga0495680_0001425 | 3300047322 | Bacteria | 25755 |
| 484 | Ga0495680_0005122 | 3300047322 | Bacteria | 12377 |
| 485 | Ga0495680_0006803 | 3300047322 | Bacteria | 10562 |
| 486 | Ga0495680_0021461 | 3300047322 | Bacteria | 5406 |
| 487 | Ga0495680_0025475 | 3300047322 | Bacteria | 4894 |
| 488 | Ga0495675_0130652 | 3300047444 | Unclassified | 1561 |
| 489 | Ga0495675_0194545 | 3300047444 | Unclassified | 1237 |
| 490 | Ga0495684_0005276 | 3300047471 | Bacteria | 10064 |
| 491 | Ga0495684_0005993 | 3300047471 | Bacteria | 9443 |
| 492 | Ga0495684_0011204 | 3300047471 | Bacteria | 6931 |
| 493 | Ga0495684_0035027 | 3300047471 | Bacteria | 3851 |
| 494 | Ga0495684_0037791 | 3300047471 | Bacteria | 3703 |
| 495 | Ga0495602_0132539 | 3300048088 | Bacteria | 1985 |
| 496 | Ga0495602_0197154 | 3300048088 | Bacteria | 1539 |
| 497 | Ga0495602_0224271 | 3300048088 | Unclassified | 1416 |
| 498 | Ga0496100_0003481 | 3300048903 | Bacteria | 8214 |
| 499 | Ga0496100_0009677 | 3300048903 | Bacteria | 5422 |
| 500 | Ga0496100_0105444 | 3300048903 | Bacteria | 1949 |
| 501 | Ga0496100_0159223 | 3300048903 | Unclassified | 1617 |
| 502 | Ga0496100_0735344 | 3300048903 | Bacteria | 771 |
| 503 | Ga0496101_0005132 | 3300048904 | Bacteria | 8327 |
| 504 | Ga0496101_0008095 | 3300048904 | Bacteria | 6856 |
| 505 | Ga0496101_0014491 | 3300048904 | Bacteria | 5300 |
| 506 | Ga0496101_0034573 | 3300048904 | Bacteria | 3570 |
| 507 | Ga0496101_0044169 | 3300048904 | Bacteria | 3188 |
| 508 | Ga0496101_0315086 | 3300048904 | Bacteria | 1227 |
| 509 | Ga0496102_0023381 | 3300048905 | Bacteria | 5488 |
| 510 | Ga0496102_0085366 | 3300048905 | Bacteria | 2914 |
| 511 | Ga0496102_0116844 | 3300048905 | Unclassified | 2489 |
| 512 | Ga0496102_0125137 | 3300048905 | Unclassified | 2402 |
| 513 | Ga0496103_0013564 | 3300048906 | Bacteria | 4833 |
| 514 | Ga0496103_0456346 | 3300048906 | Bacteria | 819 |
| 515 | Ga0496104_0035038 | 3300048907 | Bacteria | 4684 |
| 516 | Ga0496104_0094310 | 3300048907 | Bacteria | 2863 |
| 517 | Ga0496104_0182149 | 3300048907 | Bacteria | 2011 |
| 518 | Ga0496104_0304309 | 3300048907 | Bacteria | 1506 |
| 519 | Ga0496105_0020644 | 3300048908 | Bacteria | 5323 |
| 520 | Ga0496106_0005421 | 3300048909 | Bacteria | 9436 |
| 521 | Ga0496106_0058376 | 3300048909 | Bacteria | 2921 |
| 522 | Ga0496106_0089617 | 3300048909 | Bacteria | 2372 |
| 523 | Ga0496106_0440892 | 3300048909 | Bacteria | 1046 |
| 524 | Ga0496107_0014770 | 3300048910 | Bacteria | 5467 |
| 525 | Ga0496107_0021228 | 3300048910 | Bacteria | 4589 |
| 526 | Ga0496107_0096057 | 3300048910 | Bacteria | 2168 |
| 527 | Ga0496107_0116241 | 3300048910 | Bacteria | 1969 |
| 528 | Ga0496107_0278820 | 3300048910 | Bacteria | 1244 |
| 529 | Ga0496107_0552529 | 3300048910 | Bacteria | 853 |
| 530 | Ga0496108_0116601 | 3300048911 | Bacteria | 2288 |
| 531 | Ga0496109_0066566 | 3300048912 | Bacteria | 3299 |
| 532 | Ga0496109_0069885 | 3300048912 | Unclassified | 3221 |
| 533 | Ga0496109_0096008 | 3300048912 | Bacteria | 2745 |
| 534 | Ga0496109_0181390 | 3300048912 | Unclassified | 1977 |
| 535 | Ga0496109_0280613 | 3300048912 | Bacteria | 1570 |
| 536 | Ga0496109_0317191 | 3300048912 | Unclassified | 1471 |
| 537 | Ga0496110_0057952 | 3300048913 | Bacteria | 3411 |
| 538 | Ga0496110_0065979 | 3300048913 | Bacteria | 3200 |
| 539 | Ga0496110_0241998 | 3300048913 | Bacteria | 1642 |
| 540 | Ga0496111_0011893 | 3300048914 | Bacteria | 5880 |
| 541 | Ga0496111_0055550 | 3300048914 | Bacteria | 2864 |
| 542 | Ga0496111_0058895 | 3300048914 | Bacteria | 2782 |
| 543 | Ga0496112_0001277 | 3300048915 | Bacteria | 19080 |
| 544 | Ga0496112_0047109 | 3300048915 | Bacteria | 4229 |
| 545 | Ga0496112_0101924 | 3300048915 | Bacteria | 2840 |
| 546 | Ga0496112_0404084 | 3300048915 | Bacteria | 1305 |
| 547 | Ga0496112_0802449 | 3300048915 | Unclassified | 866 |
| 548 | Ga0496113_0018460 | 3300048916 | Bacteria | 4858 |
| 549 | Ga0496113_0072949 | 3300048916 | Bacteria | 2614 |
| 550 | Ga0496113_0097638 | 3300048916 | Bacteria | 2273 |
| 551 | Ga0496114_0019973 | 3300048917 | Bacteria | 5434 |
| 552 | Ga0496114_0023900 | 3300048917 | Bacteria | 4987 |
| 553 | Ga0496114_0124146 | 3300048917 | Bacteria | 2223 |
| 554 | Ga0496115_0000470 | 3300048918 | Bacteria | 32145 |
| 555 | Ga0496115_0049796 | 3300048918 | Unclassified | 3354 |
| 556 | Ga0496115_0118583 | 3300048918 | Unclassified | 2176 |
| 557 | Ga0501067_0201639 | 3300049583 | Bacteria | 1108 |
| 558 | Ga0501070_0091004 | 3300049586 | Bacteria | 2525 |
| 559 | nmdc:mga05p37_238460_c1 | 3300050507 | Bacteria | 2188 |
| 560 | nmdc:mga0n895_249022_c1 | 3300050512 | Bacteria | 1803 |
| 561 | nmdc:mga0n895_349896_c1 | 3300050512 | Bacteria | 1497 |
| 562 | nmdc:mga0n895_63861_c1 | 3300050512 | Bacteria | 3641 |
| 563 | nmdc:mga0rr50_27367_c1 | 3300050513 | Bacteria | 3991 |
| 564 | nmdc:mga0a205_22977_c1 | 3300050515 | Bacteria | 5913 |
| 565 | nmdc:mga0a205_321996_c1 | 3300050515 | Archaea | 1417 |
| 566 | Ga0495601_0039594 | 3300053077 | Bacteria | 2952 |
| 567 | Ga0495601_0298717 | 3300053077 | Bacteria | 1049 |
| 568 | Ga0495595_0004766 | 3300053084 | Bacteria | 5460 |
| 569 | Ga0495595_0009694 | 3300053084 | Bacteria | 3988 |
| 570 | Ga0495595_0012655 | 3300053084 | Bacteria | 3552 |
| 571 | Ga0495595_0017399 | 3300053084 | Bacteria | 3093 |
| 572 | Ga0495619_0002547 | 3300053085 | Bacteria | 11932 |
| 573 | Ga0495619_0056742 | 3300053085 | Bacteria | 2597 |
| 574 | Ga0495619_0356245 | 3300053085 | Bacteria | 1012 |
| 575 | Ga0587106_039265 | 3300059605 | Unclassified | 797 |
| 576 | Ga0587115_021522 | 3300059626 | Unclassified | 902 |
| 577 | Ga0466962_0000627 | 3300061719 | Bacteria | 15671 |
| 578 | Ga0466962_0031716 | 3300061719 | Bacteria | 2530 |
| 579 | Ga0466962_0071367 | 3300061719 | Unclassified | 1659 |
| 580 | Ga0265338_10024795 | |||
| 581 | Ga0070658_10410253 | |||
| 582 | Ga0070658_10453542 | |||
| 583 | Ga0070683_100005013 | |||
| 584 | Ga0070683_100016127 | |||
| 585 | Ga0070683_100266764 | |||
| 586 | Ga0070683_100317239 | |||
| 587 | Ga0070680_100016898 | |||
| 588 | Ga0070680_100018961 | |||
| 589 | Ga0070680_100057549 | |||
| 590 | Ga0070680_100093251 | |||
| 591 | Ga0070682_100213146 | |||
| 592 | Ga0070660_100000345 | |||
| 593 | Ga0070660_100035475 | |||
| 594 | Ga0070660_100541473 | |||
| 595 | Ga0070691_10040950 | |||
| 596 | Ga0070661_100004985 | |||
| 597 | Ga0070661_100048152 | |||
| 598 | Ga0070661_100058676 | |||
| 599 | Ga0070661_100278940 | |||
| 600 | Ga0070668_100249968 | |||
| 601 | Ga0070675_100027408 | |||
| 602 | Ga0070671_100100327 | |||
| 603 | Ga0070671_100205552 | |||
| 604 | Ga0070671_100384117 | |||
| 605 | Ga0070674_100016297 | |||
| 606 | Ga0070673_100123445 | |||
| 607 | Ga0070688_100017482 | |||
| 608 | Ga0070659_100032398 | |||
| 609 | Ga0070703_10010301 | |||
| 610 | Ga0070713_100086677 | |||
| 611 | Ga0070710_10046035 | |||
| 612 | Ga0070710_10174232 | |||
| 613 | Ga0070701_10036720 | |||
| 614 | Ga0070701_10235016 | |||
| 615 | Ga0070711_100162847 | |||
| 616 | Ga0070711_100365812 | |||
| 617 | Ga0070711_100386148 | |||
| 618 | Ga0070705_100102521 | |||
| 619 | Ga0070700_100025322 | |||
| 620 | Ga0070694_100068519 | |||
| 621 | Ga0070663_100448938 | |||
| 622 | Ga0070678_100113656 | |||
| 623 | Ga0070681_10000245 | |||
| 624 | Ga0070681_10016674 | |||
| 625 | Ga0070681_10057836 | |||
| 626 | Ga0070681_10085030 | |||
| 627 | Ga0070681_10089327 | |||
| 628 | Ga0070681_10096659 | |||
| 629 | Ga0070681_10133462 | |||
| 630 | Ga0070681_10194665 | |||
| 631 | Ga0070681_10550449 | |||
| 632 | Ga0068867_100206063 | |||
| 633 | Ga0070685_10024996 | |||
| 634 | Ga0070706_100459634 | |||
| 635 | Ga0070707_100138217 | |||
| 636 | Ga0070707_100202365 | |||
| 637 | Ga0070707_100231215 | |||
| 638 | Ga0070707_100433444 | |||
| 639 | Ga0070698_100018095 | |||
| 640 | Ga0070698_100110276 | |||
| 641 | Ga0070698_100592612 | |||
| 642 | Ga0070698_100700574 | |||
| 643 | Ga0070699_100149805 | |||
| 644 | Ga0070679_100001751 | |||
| 645 | Ga0070679_100002208 | |||
| 646 | Ga0070679_100029530 | |||
| 647 | Ga0070679_100042256 | |||
| 648 | Ga0070679_100288578 | |||
| 649 | Ga0070679_100406801 | |||
| 650 | Ga0070684_100059474 | |||
| 651 | Ga0070684_100093867 | |||
| 652 | Ga0070684_100098880 | |||
| 653 | Ga0070684_100191815 | |||
| 654 | Ga0070684_100293236 | |||
| 655 | Ga0070684_100372111 | |||
| 656 | Ga0070684_100444367 | |||
| 657 | Ga0070697_100349088 | |||
| 658 | Ga0068853_100045919 | |||
| 659 | Ga0070672_100075405 | |||
| 660 | Ga0070686_100013521 | |||
| 661 | Ga0070695_100113533 | |||
| 662 | Ga0070696_100058191 | |||
| 663 | Ga0070696_100130733 | |||
| 664 | Ga0070665_100032268 | |||
| 665 | Ga0070704_100075041 | |||
| 666 | Ga0068855_100022974 | |||
| 667 | Ga0068855_100032236 | |||
| 668 | Ga0068855_100032532 | |||
| 669 | Ga0068855_100059609 | |||
| 670 | Ga0068855_100115212 | |||
| 671 | Ga0068855_100118271 | |||
| 672 | Ga0068855_100155435 | |||
| 673 | Ga0068855_100267375 | |||
| 674 | Ga0070664_100597556 | |||
| 675 | Ga0068857_100047964 | |||
| 676 | Ga0068857_100061492 | |||
| 677 | Ga0068857_100069392 | |||
| 678 | Ga0068856_100228205 | |||
| 679 | Ga0068856_100229479 | |||
| 680 | Ga0068856_100278467 | |||
| 681 | Ga0070702_100059634 | |||
| 682 | Ga0070702_100094582 | |||
| 683 | Ga0068852_100066172 | |||
| 684 | Ga0068852_100091159 | |||
| 685 | Ga0068866_10408942 | |||
| 686 | Ga0068861_100343902 | |||
| 687 | Ga0068870_10023393 | |||
| 688 | Ga0070717_10051518 | |||
| 689 | Ga0070717_10122147 | |||
| 690 | Ga0070715_10000206 | |||
| 691 | Ga0070715_10035952 | |||
| 692 | Ga0070716_100003710 | |||
| 693 | Ga0070712_100045319 | |||
| 694 | Ga0070712_100045684 | |||
| 695 | Ga0070712_100158217 | |||
| 696 | Ga0070712_100182691 | |||
| 697 | Ga0097621_100279027 | |||
| 698 | Ga0068871_100306040 | |||
| 699 | Ga0075434_100055830 | |||
| 700 | Ga0075434_100737135 | |||
| 701 | Ga0075436_100104933 | |||
| 702 | Ga0075435_100072732 | |||
| 703 | Ga0075435_100351134 | |||
| 704 | Ga0105240_10019847 | |||
| 705 | Ga0105240_10020987 | |||
| 706 | Ga0105240_10096020 | |||
| 707 | Ga0105240_10104598 | |||
| 708 | Ga0105240_10108419 | |||
| 709 | Ga0105240_10141705 | |||
| 710 | Ga0105240_10224580 | |||
| 711 | Ga0105240_10281456 | |||
| 712 | Ga0105240_10297961 | |||
| 713 | Ga0105240_10487464 | |||
| 714 | Ga0105245_10021680 | |||
| 715 | Ga0105245_10538015 | |||
| 716 | Ga0105245_10711159 | |||
| 717 | Ga0105242_10008749 | |||
| 718 | Ga0105242_10087343 | |||
| 719 | Ga0105242_10657382 | |||
| 720 | Ga0105248_10197587 | |||
| 721 | Ga0105237_10004783 | |||
| 722 | Ga0105237_10196786 | |||
| 723 | Ga0105238_10027462 | |||
| 724 | Ga0105238_10121804 | |||
| 725 | Ga0105238_10562661 | |||
| 726 | Ga0105238_10935235 | |||
| 727 | Ga0105239_10043656 | |||
| 728 | Ga0105239_10052370 | |||
| 729 | Ga0105239_10324210 | |||
| 730 | Ga0105239_10901349 | |||
| 731 | Ga0105246_10063863 | |||
| 732 | Ga0157373_10113436 | |||
| 733 | Ga0157370_10012792 | |||
| 734 | Ga0157370_10034824 | |||
| 735 | Ga0157370_10039804 | |||
| 736 | Ga0157370_10046425 | |||
| 737 | Ga0157370_10092727 | |||
| 738 | Ga0157370_10109457 | |||
| 739 | Ga0157370_10120132 | |||
| 740 | Ga0157370_10283290 | |||
| 741 | Ga0157369_10004549 | |||
| 742 | Ga0157369_10006864 | |||
| 743 | Ga0157369_10020044 | |||
| 744 | Ga0157369_10034681 | |||
| 745 | Ga0157369_10036352 | |||
| 746 | Ga0157369_10052939 | |||
| 747 | Ga0157369_10155642 | |||
| 748 | Ga0157369_10205250 | |||
| 749 | Ga0157369_10221333 | |||
| 750 | Ga0157369_10517082 | |||
| 751 | Ga0157374_10020377 | |||
| 752 | Ga0157374_10024729 | |||
| 753 | Ga0157378_10049015 | |||
| 754 | Ga0157378_11317455 | |||
| 755 | Ga0157372_10567059 | |||
| 756 | Ga0157372_11283487 | |||
| 757 | Ga0157375_10008178 | |||
| 758 | Ga0157377_10002216 | |||
| 759 | Ga0157377_10107197 | |||
| 760 | Ga0157379_10298105 | |||
| 761 | Ga0197907_10959858 | |||
| 762 | Ga0206356_10959344 | |||
| 763 | Ga0206356_11453031 | |||
| 764 | Ga0206350_10191131 | |||
| 765 | Ga0206354_11034401 | |||
| 766 | Ga0206354_11162633 | |||
| 767 | Ga0206353_10046952 | |||
| 768 | Ga0206353_10356125 | |||
| 769 | Ga0206353_10491957 | |||
| 770 | Ga0206353_10608505 | |||
| 771 | Ga0224712_10035111 | |||
| 772 | Ga0207692_10017741 | |||
| 773 | Ga0207692_10229393 | |||
| 774 | Ga0207685_10087220 | |||
| 775 | Ga0207699_10080343 | |||
| 776 | Ga0207645_10123598 | |||
| 777 | Ga0207643_10003414 | |||
| 778 | Ga0207705_10012175 | |||
| 779 | Ga0207705_10156172 | |||
| 780 | Ga0207705_10270834 | |||
| 781 | Ga0207705_10433342 | |||
| 782 | Ga0207707_10002971 | |||
| 783 | Ga0207707_10041740 | |||
| 784 | Ga0207707_10161024 | |||
| 785 | Ga0207707_10182231 | |||
| 786 | Ga0207707_10225324 | |||
| 787 | Ga0207707_10232407 | |||
| 788 | Ga0207707_10438610 | |||
| 789 | Ga0207695_10058342 | |||
| 790 | Ga0207695_10098602 | |||
| 791 | Ga0207695_10132277 | |||
| 792 | Ga0207695_10230900 | |||
| 793 | Ga0207695_10519659 | |||
| 794 | Ga0207695_10692523 | |||
| 795 | Ga0207693_10005847 | |||
| 796 | Ga0207693_10007123 | |||
| 797 | Ga0207693_10031227 | |||
| 798 | Ga0207663_10011072 | |||
| 799 | Ga0207663_10150130 | |||
| 800 | Ga0207663_10568315 | |||
| 801 | Ga0207660_10001145 | |||
| 802 | Ga0207660_10023066 | |||
| 803 | Ga0207660_10132820 | |||
| 804 | Ga0207660_10568485 | |||
| 805 | Ga0207662_10080980 | |||
| 806 | Ga0207657_10000073 | |||
| 807 | Ga0207657_10001254 | |||
| 808 | Ga0207657_10008811 | |||
| 809 | Ga0207657_10014007 | |||
| 810 | Ga0207657_10295515 | |||
| 811 | Ga0207649_10006819 | |||
| 812 | Ga0207649_10017081 | |||
| 813 | Ga0207649_10248969 | |||
| 814 | Ga0207652_10027851 | |||
| 815 | Ga0207652_10122203 | |||
| 816 | Ga0207652_10127516 | |||
| 817 | Ga0207652_10243380 | |||
| 818 | Ga0207652_10539011 | |||
| 819 | Ga0207646_10009612 | |||
| 820 | Ga0207646_10058225 | |||
| 821 | Ga0207646_10146543 | |||
| 822 | Ga0207694_10163644 | |||
| 823 | Ga0207700_10029436 | |||
| 824 | Ga0207700_10366163 | |||
| 825 | Ga0207700_10538054 | |||
| 826 | Ga0207700_10541883 | |||
| 827 | Ga0207664_10080902 | |||
| 828 | Ga0207664_10181811 | |||
| 829 | Ga0207690_10294845 | |||
| 830 | Ga0207706_10136506 | |||
| 831 | Ga0207686_10137985 | |||
| 832 | Ga0207670_10075984 | |||
| 833 | Ga0207665_10001018 | |||
| 834 | Ga0207665_10013242 | |||
| 835 | Ga0207665_10072061 | |||
| 836 | Ga0207691_10045560 | |||
| 837 | Ga0207711_10167562 | |||
| 838 | Ga0207661_10166304 | |||
| 839 | Ga0207661_10251463 | |||
| 840 | Ga0207661_10292601 | |||
| 841 | Ga0207667_10030368 | |||
| 842 | Ga0207667_10091280 | |||
| 843 | Ga0207667_10218193 | |||
| 844 | Ga0207667_10286544 | |||
| 845 | Ga0207667_10343344 | |||
| 846 | Ga0207667_10456440 | |||
| 847 | Ga0207651_10252245 | |||
| 848 | Ga0207712_10274805 | |||
| 849 | Ga0207668_10145917 | |||
| 850 | Ga0207640_10225693 | |||
| 851 | Ga0207639_10262974 | |||
| 852 | Ga0207678_10075227 | |||
| 853 | Ga0207702_10239370 | |||
| 854 | Ga0207702_10262111 | |||
| 855 | Ga0207702_10606155 | |||
| 856 | Ga0207648_10101245 | |||
| 857 | Ga0207674_10056895 | |||
| 858 | Ga0207674_10288255 | |||
| 859 | Ga0207675_100101739 | |||
| 860 | Ga0207675_100126680 | |||
| 861 | Ga0207683_10246048 | |||
| 862 | Ga0207698_10900831 | |||
| 863 | Ga0268266_10221580 | |||
| 864 | Ga0268266_10257764 | |||
| 865 | Ga0268264_10796958 | |||
| 866 | Ga0265337_1012112 | |||
| 867 | Ga0265337_1055067 | |||
| 868 | Ga0265337_1067400 | |||
| 869 | Ga0265326_10022268 | |||
| 870 | Ga0265319_1081278 | |||
| 871 | Ga0265334_10000803 | |||
| 872 | Ga0265318_10000900 | |||
| 873 | Ga0265318_10000969 | |||
| 874 | Ga0265318_10008580 | |||
| 875 | Ga0265318_10027360 | |||
| 876 | Ga0265323_10035804 | |||
| 877 | Ga0265322_10038096 | |||
| 878 | Ga0265336_10062491 | |||
| 879 | Ga0265338_10007606 | |||
| 880 | Ga0265338_10007947 | |||
| 881 | Ga0265338_10020089 | |||
| 882 | Ga0265338_10024572 | |||
| 883 | Ga0265338_10031811 | |||
| 884 | Ga0265338_10269031 | |||
| 885 | Ga0265330_10005292 | |||
| 886 | Ga0265330_10033797 | |||
| 887 | Ga0265332_10006662 | |||
| 888 | Ga0265328_10004163 | |||
| 889 | Ga0265328_10064290 | |||
| 890 | Ga0265328_10071499 | |||
| 891 | Ga0265320_10009143 | |||
| 892 | Ga0265320_10110061 | |||
| 893 | Ga0265325_10002518 | |||
| 894 | Ga0265325_10003049 | |||
| 895 | Ga0265325_10045883 | |||
| 896 | Ga0265325_10054895 | |||
| 897 | Ga0265329_10017768 | |||
| 898 | Ga0265340_10011521 | |||
| 899 | Ga0265339_10007748 | |||
| 900 | Ga0265339_10013370 | |||
| 901 | Ga0265339_10146646 | |||
| 902 | Ga0265331_10003820 | |||
| 903 | Ga0265331_10017628 | |||
| 904 | Ga0265331_10025012 | |||
| 905 | Ga0265327_10007063 | |||
| 906 | Ga0265327_10022037 | |||
| 907 | Ga0265327_10066579 | |||
| 908 | Ga0265316_10018595 | |||
| 909 | Ga0265316_10029175 | |||
| 910 | Ga0265313_10002660 | |||
| 911 | Ga0265314_10009570 | |||
| 912 | Ga0265314_10029660 | |||
| 913 | Ga0265314_10152541 | |||
| 914 | Ga0265342_10004897 | |||
| 915 | Ga0265342_10040493 | |||
| 916 | Ga0265342_10062852 | |||
| 917 | Ga0265342_10084830 | |||
| 918 | Ga0373958_0012398 | |||
| 919 | Ga0373959_0007401 | |||
| 920 | Ga0373938_0022892 | |||
| 921 | Ga0373940_0035425 | |||
| 922 | Ga0373949_0009750 | |||
| 923 | Ga0373951_0019756 | |||
| 924 | Ga0373932_0009985 | |||
| 925 | Ga0373939_0021814 | |||
| 926 | Ga0373943_0015569 | |||
| 927 | Ga0373943_0272014 | |||
| 928 | Ga0373946_0036155 | |||
| 929 | Ga0373962_0022413 | |||
| 930 | Ga0373924_0127450 | |||
| 931 | Ga0373931_0021929 | |||
| 932 | Ga0373931_0475544 | |||
| 933 | Ga0373935_0076856 | |||
| 934 | Ga0373935_0250737 | |||
| 935 | Ga0373933_0065439 | |||
| 936 | Ga0373933_0152055 | |||
| 937 | Ga0373947_0048044 | |||
| 938 | Ga0373937_0055415 | |||
| 939 | Ga0373925_0017305 | |||
| 940 | Ga0373925_0130193 | |||
| 941 | Ga0395899_0055899 | |||
| 942 | Ga0395899_0121471 | |||
| 943 | Ga0395900_0084760 | |||
| 944 | Ga0395900_0087681 | |||
| 945 | Ga0395900_0102316 | |||
| 946 | Ga0395900_0533972 | |||
| 947 | Ga0395898_0015943 | |||
| 948 | Ga0395898_0057972 | |||
| 949 | Ga0395898_0341111 | |||
| 950 | Ga0395898_0591302 | |||
| 951 | Ga0395905_0059246 | |||
| 952 | Ga0395905_0208093 | |||
| 953 | Ga0395901_0167603 | |||
| 954 | Ga0395901_0215301 | |||
| 955 | Ga0395901_0573248 | |||
| 956 | Ga0436360_0302860 | |||
| 957 | Ga0436362_0146775 | |||
| 958 | Ga0451789_0078257 | |||
| 959 | Ga0451793_0316351 | |||
| 960 | Ga0451835_0517062 | |||
| 961 | Ga0451839_0611328 | |||
| 962 | Ga0451841_1206048 | |||
| 963 | Ga0451847_0026636 | |||
| 964 | Ga0466969_0016633 | |||
| 965 | Ga0466966_0004461 | |||
| 966 | Ga0466966_0094200 | |||
| 967 | Ga0466961_0034556 | |||
| 968 | Ga0466961_0082981 | |||
| 969 | Ga0466963_0007924 | |||
| 970 | Ga0466963_0016152 | |||
| 971 | Ga0466963_0061337 | |||
| 972 | Ga0466963_0218744 | |||
| 973 | Ga0466964_0030574 | |||
| 974 | Ga0466971_0027697 | |||
| 975 | Ga0466971_0086608 | |||
| 976 | Ga0466957_0061294 | |||
| 977 | Ga0466957_0085289 | |||
| 978 | Ga0466957_0268701 | |||
| 979 | Ga0466960_0031029 | |||
| 980 | Ga0466959_0022608 | |||
| 981 | Ga0466959_0166484 | |||
| 982 | Ga0466959_0271716 | |||
| 983 | Ga0466958_0005922 | |||
| 984 | Ga0466958_0099729 | |||
| 985 | Ga0466967_0005493 | |||
| 986 | Ga0466967_0018120 | |||
| 987 | Ga0466967_0044563 | |||
| 988 | Ga0466967_0098527 | |||
| 989 | Ga0466967_0149800 | |||
| 990 | Ga0466967_0231361 | |||
| 991 | Ga0466967_0352129 | |||
| 992 | Ga0466967_0356202 | |||
| 993 | Ga0466967_0701460 | |||
| 994 | Ga0495592_0042365 | |||
| 995 | Ga0495592_0230707 | |||
| 996 | Ga0495629_0023940 | |||
| 997 | Ga0495629_0081035 | |||
| 998 | Ga0495629_0117020 | |||
| 999 | Ga0495641_0036204 | |||
| 1000 | Ga0495651_0007084 | |||
| 1001 | Ga0495651_0065270 | |||
| 1002 | Ga0495651_0084511 | |||
| 1003 | Ga0495653_0004823 | |||
| 1004 | Ga0495653_0008203 | |||
| 1005 | Ga0495653_0114861 | |||
| 1006 | Ga0495653_0273174 | |||
| 1007 | Ga0495582_0228495 | |||
| 1008 | Ga0495605_0107990 | |||
| 1009 | Ga0495662_0068797 | |||
| 1010 | Ga0495664_0137922 | |||
| 1011 | Ga0495594_0098845 | |||
| 1012 | Ga0495608_0002731 | |||
| 1013 | Ga0495608_0057321 | |||
| 1014 | Ga0495608_0267421 | |||
| 1015 | Ga0495618_0029769 | |||
| 1016 | Ga0495618_0050759 | |||
| 1017 | Ga0495628_0067780 | |||
| 1018 | Ga0495628_0134349 | |||
| 1019 | Ga0495630_0028140 | |||
| 1020 | Ga0495630_0084707 | |||
| 1021 | Ga0495630_0108560 | |||
| 1022 | Ga0495652_0014317 | |||
| 1023 | Ga0495652_0126384 | |||
| 1024 | Ga0495640_0006813 | |||
| 1025 | Ga0495640_0023415 | |||
| 1026 | Ga0495640_0107863 | |||
| 1027 | Ga0495586_0006308 | |||
| 1028 | Ga0495587_0298230 | |||
| 1029 | Ga0495645_0201320 | |||
| 1030 | Ga0495667_0005419 | |||
| 1031 | Ga0495667_0006310 | |||
| 1032 | Ga0495667_0017263 | |||
| 1033 | Ga0495667_0037301 | |||
| 1034 | Ga0495667_0077353 | |||
| 1035 | Ga0495634_0007192 | |||
| 1036 | Ga0495634_0055191 | |||
| 1037 | Ga0495634_0139634 | |||
| 1038 | Ga0495634_0160361 | |||
| 1039 | Ga0495635_0010289 | |||
| 1040 | Ga0495635_0063926 | |||
| 1041 | Ga0495635_0144422 | |||
| 1042 | Ga0495657_0025584 | |||
| 1043 | Ga0495657_0037756 | |||
| 1044 | Ga0495599_0124713 | |||
| 1045 | Ga0495599_0296635 | |||
| 1046 | Ga0495646_0237639 | |||
| 1047 | Ga0495658_0052080 | |||
| 1048 | Ga0495658_0122340 | |||
| 1049 | Ga0495658_0202173 | |||
| 1050 | Ga0495658_0463790 | |||
| 1051 | Ga0495613_0013086 | |||
| 1052 | Ga0495613_0016927 | |||
| 1053 | Ga0495613_0074598 | |||
| 1054 | Ga0495613_0327892 | |||
| 1055 | Ga0495600_0012994 | |||
| 1056 | Ga0495600_0026587 | |||
| 1057 | Ga0495581_0182287 | |||
| 1058 | Ga0495604_0042405 | |||
| 1059 | Ga0495674_0009681 | |||
| 1060 | Ga0495674_0087356 | |||
| 1061 | Ga0495676_0126434 | |||
| 1062 | Ga0495680_0001425 | |||
| 1063 | Ga0495680_0005122 | |||
| 1064 | Ga0495680_0006803 | |||
| 1065 | Ga0495680_0021461 | |||
| 1066 | Ga0495680_0025475 | |||
| 1067 | Ga0495675_0130652 | |||
| 1068 | Ga0495675_0194545 | |||
| 1069 | Ga0495684_0005276 | |||
| 1070 | Ga0495684_0005993 | |||
| 1071 | Ga0495684_0011204 | |||
| 1072 | Ga0495684_0035027 | |||
| 1073 | Ga0495684_0037791 | |||
| 1074 | Ga0495602_0132539 | |||
| 1075 | Ga0495602_0197154 | |||
| 1076 | Ga0495602_0224271 | |||
| 1077 | Ga0496100_0003481 | |||
| 1078 | Ga0496100_0009677 | |||
| 1079 | Ga0496100_0105444 | |||
| 1080 | Ga0496100_0159223 | |||
| 1081 | Ga0496100_0735344 | |||
| 1082 | Ga0496101_0005132 | |||
| 1083 | Ga0496101_0008095 | |||
| 1084 | Ga0496101_0014491 | |||
| 1085 | Ga0496101_0034573 | |||
| 1086 | Ga0496101_0044169 | |||
| 1087 | Ga0496101_0315086 | |||
| 1088 | Ga0496102_0023381 | |||
| 1089 | Ga0496102_0085366 | |||
| 1090 | Ga0496102_0116844 | |||
| 1091 | Ga0496102_0125137 | |||
| 1092 | Ga0496103_0013564 | |||
| 1093 | Ga0496103_0456346 | |||
| 1094 | Ga0496104_0035038 | |||
| 1095 | Ga0496104_0094310 | |||
| 1096 | Ga0496104_0182149 | |||
| 1097 | Ga0496104_0304309 | |||
| 1098 | Ga0496105_0020644 | |||
| 1099 | Ga0496106_0005421 | |||
| 1100 | Ga0496106_0058376 | |||
| 1101 | Ga0496106_0089617 | |||
| 1102 | Ga0496106_0440892 | |||
| 1103 | Ga0496107_0014770 | |||
| 1104 | Ga0496107_0021228 | |||
| 1105 | Ga0496107_0096057 | |||
| 1106 | Ga0496107_0116241 | |||
| 1107 | Ga0496107_0278820 | |||
| 1108 | Ga0496107_0552529 | |||
| 1109 | Ga0496108_0116601 | |||
| 1110 | Ga0496109_0066566 | |||
| 1111 | Ga0496109_0069885 | |||
| 1112 | Ga0496109_0096008 | |||
| 1113 | Ga0496109_0181390 | |||
| 1114 | Ga0496109_0280613 | |||
| 1115 | Ga0496109_0317191 | |||
| 1116 | Ga0496110_0057952 | |||
| 1117 | Ga0496110_0065979 | |||
| 1118 | Ga0496110_0241998 | |||
| 1119 | Ga0496111_0011893 | |||
| 1120 | Ga0496111_0055550 | |||
| 1121 | Ga0496111_0058895 | |||
| 1122 | Ga0496112_0001277 | |||
| 1123 | Ga0496112_0047109 | |||
| 1124 | Ga0496112_0101924 | |||
| 1125 | Ga0496112_0404084 | |||
| 1126 | Ga0496112_0802449 | |||
| 1127 | Ga0496113_0018460 | |||
| 1128 | Ga0496113_0072949 | |||
| 1129 | Ga0496113_0097638 | |||
| 1130 | Ga0496114_0019973 | |||
| 1131 | Ga0496114_0023900 | |||
| 1132 | Ga0496114_0124146 | |||
| 1133 | Ga0496115_0000470 | |||
| 1134 | Ga0496115_0049796 | |||
| 1135 | Ga0496115_0118583 | |||
| 1136 | Ga0501067_0201639 | |||
| 1137 | Ga0501070_0091004 | |||
| 1138 | nmdc:mga05p37_238460_c1 | |||
| 1139 | nmdc:mga0n895_249022_c1 | |||
| 1140 | nmdc:mga0n895_349896_c1 | |||
| 1141 | nmdc:mga0n895_63861_c1 | |||
| 1142 | nmdc:mga0rr50_27367_c1 | |||
| 1143 | nmdc:mga0a205_22977_c1 | |||
| 1144 | nmdc:mga0a205_321996_c1 | |||
| 1145 | Ga0495601_0039594 | |||
| 1146 | Ga0495601_0298717 | |||
| 1147 | Ga0495595_0004766 | |||
| 1148 | Ga0495595_0009694 | |||
| 1149 | Ga0495595_0012655 | |||
| 1150 | Ga0495595_0017399 | |||
| 1151 | Ga0495619_0002547 | |||
| 1152 | Ga0495619_0056742 | |||
| 1153 | Ga0495619_0356245 | |||
| 1154 | Ga0587106_039265 | |||
| 1155 | Ga0587115_021522 | |||
| 1156 | Ga0466962_0000627 | |||
| 1157 | Ga0466962_0031716 | |||
| 1158 | Ga0466962_0071367 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xdy-assembly7.cif.gz_G | structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor | 0.9458 | 66 | 213 |
| 1xdq-assembly3.cif.gz_C | structural and biochemical identification of a novel bacterial oxidoreductase | 0.9339 | 61 | 213 |
| 2xts-assembly1.cif.gz_C | crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus | 0.932 | 58 | 198 |
| 1sox-assembly1.cif.gz_A | sulfite oxidase from chicken liver | 0.9093 | 58 | 208 |
| 1sox-assembly1.cif.gz_B | sulfite oxidase from chicken liver | 0.9067 | 58 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xdyH00 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9362 | 61 | 213 | 3.90.420.10 |
| 2xtsA01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9297 | 58 | 198 | 3.90.420.10 |
| af_P11035_116_359_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9261 | 58 | 203 | 3.90.420.10 |
| af_Q54XJ8_10_262_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.921 | 58 | 203 | 3.90.420.10 |
| af_I1N786_1_262_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9094 | 67 | 208 | 3.90.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538HTN8-F1-model_v4 | Oxidoreductase | 0.9797 | 122 | 213 |
|
| AF-A0A538K9G2-F1-model_v4 | Oxidoreductase | 0.9796 | 57 | 213 |
|
| AF-A0A538HGG2-F1-model_v4 | Oxidoreductase | 0.9791 | 73 | 213 |
|
| AF-A0A499USH5-F1-model_v4 | Oxidoreductase molybdopterin-binding domain-containing protein | 0.9748 | 113 | 214 |
|
| AF-A0A535MFV3-F1-model_v4 | Oxidoreductase | 0.9725 | 85 | 213 |
GO:0016491
|