F465842

General Info

Members Datasets Scaffolds Average Seq Length
579 253 1158 234

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10024795|Ga0265338_100247955
Length 258
Sequence VDAPGDDPNDGQAPNEPRRYGRGLFLATVAGGLTSLVWGKAVWGHVSGALGSAESLVPLVPTGGWRIYTVSGSMPTFDAATWRLTVAGQVEEPTTFSYEQLRALPRVNQISTFHCVTGWTVKNVHWGGVRMADVLASARPLPEAGALQFVSAERPYIDYLTVEQASLHDVMLAYEMDGKPLPREHGAPVRLIIPEMYGYKNVKWLQEINLVQSPQAGYWEELGYDEDAWVGRSNGYGSSPAITPSAQPVPSHRGALTE

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
176 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
177 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
178 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 2.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.54
Rhizosphere 88.77
Stem 0
Stem Tuber 0
Unclassified 21.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10024795 3300028800 Bacteria 6112
2 Ga0070658_10410253 3300005327 Bacteria 1164
3 Ga0070658_10453542 3300005327 Unclassified 1105
4 Ga0070683_100005013 3300005329 Bacteria 10989
5 Ga0070683_100016127 3300005329 Bacteria 6578
6 Ga0070683_100266764 3300005329 Bacteria 1628
7 Ga0070683_100317239 3300005329 Unclassified 1483
8 Ga0070680_100016898 3300005336 Bacteria 5743
9 Ga0070680_100018961 3300005336 Bacteria 5444
10 Ga0070680_100057549 3300005336 Bacteria 3178
11 Ga0070680_100093251 3300005336 Bacteria 2495
12 Ga0070682_100213146 3300005337 Unclassified 1370
13 Ga0070660_100000345 3300005339 Bacteria 30972
14 Ga0070660_100035475 3300005339 Bacteria 3775
15 Ga0070660_100541473 3300005339 Unclassified 971
16 Ga0070691_10040950 3300005341 Unclassified 2190
17 Ga0070661_100004985 3300005344 Bacteria 9146
18 Ga0070661_100048152 3300005344 Bacteria 3120
19 Ga0070661_100058676 3300005344 Bacteria 2821
20 Ga0070661_100278940 3300005344 Unclassified 1296
21 Ga0070668_100249968 3300005347 Unclassified 1471
22 Ga0070675_100027408 3300005354 Bacteria 4576
23 Ga0070671_100100327 3300005355 Bacteria 2429
24 Ga0070671_100205552 3300005355 Unclassified 1670
25 Ga0070671_100384117 3300005355 Bacteria 1200
26 Ga0070674_100016297 3300005356 Bacteria 4657
27 Ga0070673_100123445 3300005364 Unclassified 2164
28 Ga0070688_100017482 3300005365 Bacteria 4116
29 Ga0070659_100032398 3300005366 Bacteria 4053
30 Ga0070703_10010301 3300005406 Unclassified 2635
31 Ga0070713_100086677 3300005436 Unclassified 2685
32 Ga0070710_10046035 3300005437 Unclassified 2428
33 Ga0070710_10174232 3300005437 Bacteria 1342
34 Ga0070701_10036720 3300005438 Unclassified 2470
35 Ga0070701_10235016 3300005438 Bacteria 1100
36 Ga0070711_100162847 3300005439 Bacteria 1692
37 Ga0070711_100365812 3300005439 Unclassified 1163
38 Ga0070711_100386148 3300005439 Bacteria 1133
39 Ga0070705_100102521 3300005440 Bacteria 1810
40 Ga0070700_100025322 3300005441 Bacteria 3493
41 Ga0070694_100068519 3300005444 Bacteria 2439
42 Ga0070663_100448938 3300005455 Bacteria 1062
43 Ga0070678_100113656 3300005456 Unclassified 2123
44 Ga0070681_10000245 3300005458 Bacteria 43091
45 Ga0070681_10016674 3300005458 Bacteria 7334
46 Ga0070681_10057836 3300005458 Bacteria 3857
47 Ga0070681_10085030 3300005458 Bacteria 3116
48 Ga0070681_10089327 3300005458 Bacteria 3033
49 Ga0070681_10096659 3300005458 Unclassified 2901
50 Ga0070681_10133462 3300005458 Bacteria 2414
51 Ga0070681_10194665 3300005458 Bacteria 1946
52 Ga0070681_10550449 3300005458 Bacteria 1068
53 Ga0068867_100206063 3300005459 Unclassified 1576
54 Ga0070685_10024996 3300005466 Unclassified 3286
55 Ga0070706_100459634 3300005467 Bacteria 1184
56 Ga0070707_100138217 3300005468 Unclassified 2370
57 Ga0070707_100202365 3300005468 Bacteria 1936
58 Ga0070707_100231215 3300005468 Bacteria 1800
59 Ga0070707_100433444 3300005468 Bacteria 1275
60 Ga0070698_100018095 3300005471 Bacteria 7420
61 Ga0070698_100110276 3300005471 Bacteria 2717
62 Ga0070698_100592612 3300005471 Bacteria 1049
63 Ga0070698_100700574 3300005471 Bacteria 955
64 Ga0070699_100149805 3300005518 Unclassified 2063
65 Ga0070679_100001751 3300005530 Bacteria 19537
66 Ga0070679_100002208 3300005530 Bacteria 17574
67 Ga0070679_100029530 3300005530 Bacteria 5410
68 Ga0070679_100042256 3300005530 Bacteria 4539
69 Ga0070679_100288578 3300005530 Bacteria 1592
70 Ga0070679_100406801 3300005530 Bacteria 1306
71 Ga0070684_100059474 3300005535 Bacteria 3341
72 Ga0070684_100093867 3300005535 Bacteria 2672
73 Ga0070684_100098880 3300005535 Unclassified 2603
74 Ga0070684_100191815 3300005535 Bacteria 1860
75 Ga0070684_100293236 3300005535 Bacteria 1492
76 Ga0070684_100372111 3300005535 Bacteria 1315
77 Ga0070684_100444367 3300005535 Unclassified 1198
78 Ga0070697_100349088 3300005536 Bacteria 1277
79 Ga0068853_100045919 3300005539 Bacteria 3744
80 Ga0070672_100075405 3300005543 Unclassified 2693
81 Ga0070686_100013521 3300005544 Bacteria 4678
82 Ga0070695_100113533 3300005545 Bacteria 1842
83 Ga0070696_100058191 3300005546 Bacteria 2699
84 Ga0070696_100130733 3300005546 Unclassified 1827
85 Ga0070665_100032268 3300005548 Bacteria 5272
86 Ga0070704_100075041 3300005549 Bacteria 2468
87 Ga0068855_100022974 3300005563 Bacteria 7473
88 Ga0068855_100032236 3300005563 Bacteria 6256
89 Ga0068855_100032532 3300005563 Bacteria 6226
90 Ga0068855_100059609 3300005563 Bacteria 4465
91 Ga0068855_100115212 3300005563 Bacteria 3081
92 Ga0068855_100118271 3300005563 Bacteria 3035
93 Ga0068855_100155435 3300005563 Unclassified 2599
94 Ga0068855_100267375 3300005563 Bacteria 1903
95 Ga0070664_100597556 3300005564 Bacteria 1023
96 Ga0068857_100047964 3300005577 Bacteria 3793
97 Ga0068857_100061492 3300005577 Bacteria 3336
98 Ga0068857_100069392 3300005577 Bacteria 3139
99 Ga0068856_100228205 3300005614 Bacteria 1877
100 Ga0068856_100229479 3300005614 Bacteria 1872
101 Ga0068856_100278467 3300005614 Bacteria 1689
102 Ga0070702_100059634 3300005615 Bacteria 2215
103 Ga0070702_100094582 3300005615 Unclassified 1820
104 Ga0068852_100066172 3300005616 Bacteria 3155
105 Ga0068852_100091159 3300005616 Bacteria 2727
106 Ga0068866_10408942 3300005718 Bacteria 877
107 Ga0068861_100343902 3300005719 Bacteria 1306
108 Ga0068870_10023393 3300005840 Unclassified 3046
109 Ga0070717_10051518 3300006028 Bacteria 3388
110 Ga0070717_10122147 3300006028 Bacteria 2232
111 Ga0070715_10000206 3300006163 Bacteria 13864
112 Ga0070715_10035952 3300006163 Bacteria 2040
113 Ga0070716_100003710 3300006173 Bacteria 7232
114 Ga0070712_100045319 3300006175 Bacteria 3036
115 Ga0070712_100045684 3300006175 Bacteria 3025
116 Ga0070712_100158217 3300006175 Unclassified 1747
117 Ga0070712_100182691 3300006175 Bacteria 1635
118 Ga0097621_100279027 3300006237 Unclassified 1470
119 Ga0068871_100306040 3300006358 Unclassified 1396
120 Ga0075434_100055830 3300006871 Bacteria 3924
121 Ga0075434_100737135 3300006871 Bacteria 1002
122 Ga0075436_100104933 3300006914 Bacteria 1970
123 Ga0075435_100072732 3300007076 Unclassified 2809
124 Ga0075435_100351134 3300007076 Bacteria 1264
125 Ga0105240_10019847 3300009093 Bacteria 8977
126 Ga0105240_10020987 3300009093 Bacteria 8694
127 Ga0105240_10096020 3300009093 Bacteria 3613
128 Ga0105240_10104598 3300009093 Bacteria 3438
129 Ga0105240_10108419 3300009093 Bacteria 3365
130 Ga0105240_10141705 3300009093 Bacteria 2873
131 Ga0105240_10224580 3300009093 Bacteria 2186
132 Ga0105240_10281456 3300009093 Bacteria 1910
133 Ga0105240_10297961 3300009093 Bacteria 1846
134 Ga0105240_10487464 3300009093 Unclassified 1373
135 Ga0105245_10021680 3300009098 Bacteria 5639
136 Ga0105245_10538015 3300009098 Unclassified 1189
137 Ga0105245_10711159 3300009098 Unclassified 1038
138 Ga0105242_10008749 3300009176 Bacteria 7768
139 Ga0105242_10087343 3300009176 Unclassified 2618
140 Ga0105242_10657382 3300009176 Unclassified 1020
141 Ga0105248_10197587 3300009177 Unclassified 2266
142 Ga0105237_10004783 3300009545 Bacteria 15563
143 Ga0105237_10196786 3300009545 Bacteria 2015
144 Ga0105238_10027462 3300009551 Bacteria 5801
145 Ga0105238_10121804 3300009551 Bacteria 2588
146 Ga0105238_10562661 3300009551 Bacteria 1145
147 Ga0105238_10935235 3300009551 Unclassified 886
148 Ga0105239_10043656 3300010375 Bacteria 4915
149 Ga0105239_10052370 3300010375 Bacteria 4476
150 Ga0105239_10324210 3300010375 Unclassified 1737
151 Ga0105239_10901349 3300010375 Bacteria 1015
152 Ga0105246_10063863 3300011119 Unclassified 2570
153 Ga0157373_10113436 3300013100 Unclassified 1905
154 Ga0157370_10012792 3300013104 Bacteria 8676
155 Ga0157370_10034824 3300013104 Bacteria 4900
156 Ga0157370_10039804 3300013104 Bacteria 4540
157 Ga0157370_10046425 3300013104 Bacteria 4164
158 Ga0157370_10092727 3300013104 Bacteria 2835
159 Ga0157370_10109457 3300013104 Bacteria 2583
160 Ga0157370_10120132 3300013104 Unclassified 2453
161 Ga0157370_10283290 3300013104 Bacteria 1531
162 Ga0157369_10004549 3300013105 Bacteria 16311
163 Ga0157369_10006864 3300013105 Bacteria 13135
164 Ga0157369_10020044 3300013105 Bacteria 7480
165 Ga0157369_10034681 3300013105 Bacteria 5535
166 Ga0157369_10036352 3300013105 Bacteria 5397
167 Ga0157369_10052939 3300013105 Bacteria 4389
168 Ga0157369_10155642 3300013105 Bacteria 2414
169 Ga0157369_10205250 3300013105 Bacteria 2067
170 Ga0157369_10221333 3300013105 Bacteria 1981
171 Ga0157369_10517082 3300013105 Bacteria 1235
172 Ga0157374_10020377 3300013296 Bacteria 5882
173 Ga0157374_10024729 3300013296 Bacteria 5385
174 Ga0157378_10049015 3300013297 Bacteria 3757
175 Ga0157378_11317455 3300013297 Unclassified 764
176 Ga0157372_10567059 3300013307 Bacteria 1323
177 Ga0157372_11283487 3300013307 Unclassified 845
178 Ga0157375_10008178 3300013308 Bacteria 9157
179 Ga0157377_10002216 3300014745 Bacteria 8542
180 Ga0157377_10107197 3300014745 Unclassified 1674
181 Ga0157379_10298105 3300014968 Unclassified 1469
182 Ga0197907_10959858 3300020069 Bacteria 1086
183 Ga0206356_10959344 3300020070 Bacteria 2163
184 Ga0206356_11453031 3300020070 Unclassified 2520
185 Ga0206350_10191131 3300020080 Bacteria 2012
186 Ga0206354_11034401 3300020081 Unclassified 1867
187 Ga0206354_11162633 3300020081 Bacteria 3258
188 Ga0206353_10046952 3300020082 Bacteria 9286
189 Ga0206353_10356125 3300020082 Bacteria 3863
190 Ga0206353_10491957 3300020082 Bacteria 6059
191 Ga0206353_10608505 3300020082 Bacteria 3949
192 Ga0224712_10035111 3300022467 Bacteria 1849
193 Ga0207692_10017741 3300025898 Unclassified 3180
194 Ga0207692_10229393 3300025898 Bacteria 1104
195 Ga0207685_10087220 3300025905 Bacteria 1306
196 Ga0207699_10080343 3300025906 Bacteria 2020
197 Ga0207645_10123598 3300025907 Unclassified 1681
198 Ga0207643_10003414 3300025908 Bacteria 8564
199 Ga0207705_10012175 3300025909 Bacteria 6217
200 Ga0207705_10156172 3300025909 Unclassified 1712
201 Ga0207705_10270834 3300025909 Bacteria 1298
202 Ga0207705_10433342 3300025909 Bacteria 1018
203 Ga0207707_10002971 3300025912 Bacteria 15096
204 Ga0207707_10041740 3300025912 Bacteria 4006
205 Ga0207707_10161024 3300025912 Bacteria 1962
206 Ga0207707_10182231 3300025912 Bacteria 1833
207 Ga0207707_10225324 3300025912 Bacteria 1632
208 Ga0207707_10232407 3300025912 Bacteria 1604
209 Ga0207707_10438610 3300025912 Bacteria 1118
210 Ga0207695_10058342 3300025913 Bacteria 4007
211 Ga0207695_10098602 3300025913 Bacteria 2921
212 Ga0207695_10132277 3300025913 Bacteria 2451
213 Ga0207695_10230900 3300025913 Bacteria 1755
214 Ga0207695_10519659 3300025913 Unclassified 1072
215 Ga0207695_10692523 3300025913 Bacteria 900
216 Ga0207693_10005847 3300025915 Bacteria 10206
217 Ga0207693_10007123 3300025915 Bacteria 9224
218 Ga0207693_10031227 3300025915 Bacteria 4208
219 Ga0207663_10011072 3300025916 Bacteria 4827
220 Ga0207663_10150130 3300025916 Unclassified 1634
221 Ga0207663_10568315 3300025916 Unclassified 888
222 Ga0207660_10001145 3300025917 Bacteria 17681
223 Ga0207660_10023066 3300025917 Bacteria 4199
224 Ga0207660_10132820 3300025917 Bacteria 1896
225 Ga0207660_10568485 3300025917 Bacteria 922
226 Ga0207662_10080980 3300025918 Unclassified 1982
227 Ga0207657_10000073 3300025919 Bacteria 93299
228 Ga0207657_10001254 3300025919 Bacteria 27140
229 Ga0207657_10008811 3300025919 Bacteria 10206
230 Ga0207657_10014007 3300025919 Bacteria 7846
231 Ga0207657_10295515 3300025919 Bacteria 1284
232 Ga0207649_10006819 3300025920 Bacteria 6205
233 Ga0207649_10017081 3300025920 Bacteria 4108
234 Ga0207649_10248969 3300025920 Bacteria 1279
235 Ga0207652_10027851 3300025921 Bacteria 4712
236 Ga0207652_10122203 3300025921 Bacteria 2317
237 Ga0207652_10127516 3300025921 Bacteria 2267
238 Ga0207652_10243380 3300025921 Unclassified 1622
239 Ga0207652_10539011 3300025921 Bacteria 1049
240 Ga0207646_10009612 3300025922 Bacteria 9538
241 Ga0207646_10058225 3300025922 Bacteria 3451
242 Ga0207646_10146543 3300025922 Bacteria 2128
243 Ga0207694_10163644 3300025924 Bacteria 1798
244 Ga0207700_10029436 3300025928 Bacteria 3876
245 Ga0207700_10366163 3300025928 Unclassified 1258
246 Ga0207700_10538054 3300025928 Unclassified 1036
247 Ga0207700_10541883 3300025928 Bacteria 1032
248 Ga0207664_10080902 3300025929 Archaea 2642
249 Ga0207664_10181811 3300025929 Unclassified 1805
250 Ga0207690_10294845 3300025932 Bacteria 1267
251 Ga0207706_10136506 3300025933 Unclassified 2158
252 Ga0207686_10137985 3300025934 Bacteria 1682
253 Ga0207670_10075984 3300025936 Unclassified 2336
254 Ga0207665_10001018 3300025939 Bacteria 18916
255 Ga0207665_10013242 3300025939 Bacteria 5422
256 Ga0207665_10072061 3300025939 Unclassified 2359
257 Ga0207691_10045560 3300025940 Bacteria 4030
258 Ga0207711_10167562 3300025941 Unclassified 1992
259 Ga0207661_10166304 3300025944 Bacteria 1917
260 Ga0207661_10251463 3300025944 Bacteria 1571
261 Ga0207661_10292601 3300025944 Bacteria 1458
262 Ga0207667_10030368 3300025949 Bacteria 5847
263 Ga0207667_10091280 3300025949 Bacteria 3147
264 Ga0207667_10218193 3300025949 Bacteria 1954
265 Ga0207667_10286544 3300025949 Bacteria 1683
266 Ga0207667_10343344 3300025949 Bacteria 1523
267 Ga0207667_10456440 3300025949 Unclassified 1298
268 Ga0207651_10252245 3300025960 Bacteria 1444
269 Ga0207712_10274805 3300025961 Bacteria 1372
270 Ga0207668_10145917 3300025972 Unclassified 1826
271 Ga0207640_10225693 3300025981 Bacteria 1437
272 Ga0207639_10262974 3300026041 Unclassified 1510
273 Ga0207678_10075227 3300026067 Bacteria 2893
274 Ga0207702_10239370 3300026078 Unclassified 1700
275 Ga0207702_10262111 3300026078 Bacteria 1628
276 Ga0207702_10606155 3300026078 Bacteria 1075
277 Ga0207648_10101245 3300026089 Unclassified 2525
278 Ga0207674_10056895 3300026116 Bacteria 3968
279 Ga0207674_10288255 3300026116 Bacteria 1590
280 Ga0207675_100101739 3300026118 Unclassified 2707
281 Ga0207675_100126680 3300026118 Unclassified 2419
282 Ga0207683_10246048 3300026121 Bacteria 1631
283 Ga0207698_10900831 3300026142 Unclassified 892
284 Ga0268266_10221580 3300028379 Unclassified 1739
285 Ga0268266_10257764 3300028379 Bacteria 1615
286 Ga0268264_10796958 3300028381 Bacteria 944
287 Ga0265337_1012112 3300028556 Bacteria 2943
288 Ga0265337_1055067 3300028556 Bacteria 1112
289 Ga0265337_1067400 3300028556 Bacteria 986
290 Ga0265326_10022268 3300028558 Bacteria 1816
291 Ga0265319_1081278 3300028563 Bacteria 1029
292 Ga0265334_10000803 3300028573 Bacteria 15713
293 Ga0265318_10000900 3300028577 Bacteria 19390
294 Ga0265318_10000969 3300028577 Bacteria 18421
295 Ga0265318_10008580 3300028577 Bacteria 4540
296 Ga0265318_10027360 3300028577 Bacteria 2242
297 Ga0265323_10035804 3300028653 Unclassified 1829
298 Ga0265322_10038096 3300028654 Bacteria 1369
299 Ga0265336_10062491 3300028666 Bacteria 1116
300 Ga0265338_10007606 3300028800 Bacteria 13378
301 Ga0265338_10007947 3300028800 Bacteria 12996
302 Ga0265338_10020089 3300028800 Bacteria 7045
303 Ga0265338_10024572 3300028800 Bacteria 6151
304 Ga0265338_10031811 3300028800 Bacteria 5164
305 Ga0265338_10269031 3300028800 Bacteria 1249
306 Ga0265330_10005292 3300031235 Bacteria 6429
307 Ga0265330_10033797 3300031235 Bacteria 2285
308 Ga0265332_10006662 3300031238 Bacteria 5230
309 Ga0265328_10004163 3300031239 Bacteria 6308
310 Ga0265328_10064290 3300031239 Bacteria 1348
311 Ga0265328_10071499 3300031239 Bacteria 1275
312 Ga0265320_10009143 3300031240 Bacteria 6000
313 Ga0265320_10110061 3300031240 Bacteria 1262
314 Ga0265325_10002518 3300031241 Bacteria 12329
315 Ga0265325_10003049 3300031241 Bacteria 11076
316 Ga0265325_10045883 3300031241 Bacteria 2269
317 Ga0265325_10054895 3300031241 Bacteria 2038
318 Ga0265329_10017768 3300031242 Bacteria 2441
319 Ga0265340_10011521 3300031247 Bacteria 4698
320 Ga0265339_10007748 3300031249 Bacteria 6905
321 Ga0265339_10013370 3300031249 Bacteria 4976
322 Ga0265339_10146646 3300031249 Bacteria 1196
323 Ga0265331_10003820 3300031250 Bacteria 9552
324 Ga0265331_10017628 3300031250 Bacteria 3719
325 Ga0265331_10025012 3300031250 Bacteria 3015
326 Ga0265327_10007063 3300031251 Bacteria 8787
327 Ga0265327_10022037 3300031251 Bacteria 3824
328 Ga0265327_10066579 3300031251 Unclassified 1817
329 Ga0265316_10018595 3300031344 Bacteria 5967
330 Ga0265316_10029175 3300031344 Bacteria 4540
331 Ga0265313_10002660 3300031595 Bacteria 15177
332 Ga0265314_10009570 3300031711 Bacteria 8165
333 Ga0265314_10029660 3300031711 Bacteria 4061
334 Ga0265314_10152541 3300031711 Bacteria 1415
335 Ga0265342_10004897 3300031712 Bacteria 10367
336 Ga0265342_10040493 3300031712 Bacteria 2825
337 Ga0265342_10062852 3300031712 Bacteria 2184
338 Ga0265342_10084830 3300031712 Unclassified 1823
339 Ga0373958_0012398 3300034819 Bacteria 1458
340 Ga0373959_0007401 3300034820 Bacteria 1845
341 Ga0373938_0022892 3300034957 Bacteria 1280
342 Ga0373940_0035425 3300035088 Bacteria 1351
343 Ga0373949_0009750 3300035090 Unclassified 2102
344 Ga0373951_0019756 3300035091 Bacteria 1538
345 Ga0373932_0009985 3300035112 Bacteria 2291
346 Ga0373939_0021814 3300035114 Bacteria 1758
347 Ga0373943_0015569 3300035170 Bacteria 3457
348 Ga0373943_0272014 3300035170 Unclassified 956
349 Ga0373946_0036155 3300035171 Bacteria 2001
350 Ga0373962_0022413 3300035242 Bacteria 1674
351 Ga0373924_0127450 3300035410 Unclassified 1107
352 Ga0373931_0021929 3300035691 Bacteria 3209
353 Ga0373931_0475544 3300035691 Bacteria 802
354 Ga0373935_0076856 3300035692 Unclassified 2163
355 Ga0373935_0250737 3300035692 Bacteria 1239
356 Ga0373933_0065439 3300035724 Bacteria 2201
357 Ga0373933_0152055 3300035724 Unclassified 1466
358 Ga0373947_0048044 3300035725 Unclassified 2560
359 Ga0373937_0055415 3300036401 Bacteria 3639
360 Ga0373925_0017305 3300037068 Bacteria 5223
361 Ga0373925_0130193 3300037068 Bacteria 1961
362 Ga0395899_0055899 3300037312 Unclassified 2918
363 Ga0395899_0121471 3300037312 Archaea 1871
364 Ga0395900_0084760 3300037418 Unclassified 3256
365 Ga0395900_0087681 3300037418 Bacteria 3198
366 Ga0395900_0102316 3300037418 Unclassified 2943
367 Ga0395900_0533972 3300037418 Bacteria 1119
368 Ga0395898_0015943 3300037466 Bacteria 7700
369 Ga0395898_0057972 3300037466 Bacteria 3771
370 Ga0395898_0341111 3300037466 Bacteria 1429
371 Ga0395898_0591302 3300037466 Bacteria 1052
372 Ga0395905_0059246 3300037471 Unclassified 3579
373 Ga0395905_0208093 3300037471 Bacteria 1833
374 Ga0395901_0167603 3300038443 Unclassified 2305
375 Ga0395901_0215301 3300038443 Bacteria 2009
376 Ga0395901_0573248 3300038443 Bacteria 1141
377 Ga0436360_0302860 3300039438 Bacteria 8167
378 Ga0436362_0146775 3300039453 Bacteria 4928
379 Ga0451789_0078257 3300041443 Bacteria 3320
380 Ga0451793_0316351 3300041452 Bacteria 2242
381 Ga0451835_0517062 3300041492 Bacteria 1649
382 Ga0451839_0611328 3300041496 Bacteria 1539
383 Ga0451841_1206048 3300041498 Bacteria 1299
384 Ga0451847_0026636 3300041503 Bacteria 851
385 Ga0466969_0016633 3300044656 Bacteria 3847
386 Ga0466966_0004461 3300044684 Bacteria 9231
387 Ga0466966_0094200 3300044684 Bacteria 1856
388 Ga0466961_0034556 3300044693 Bacteria 3245
389 Ga0466961_0082981 3300044693 Unclassified 2027
390 Ga0466963_0007924 3300044694 Bacteria 6362
391 Ga0466963_0016152 3300044694 Bacteria 4639
392 Ga0466963_0061337 3300044694 Unclassified 2514
393 Ga0466963_0218744 3300044694 Bacteria 1334
394 Ga0466964_0030574 3300044706 Bacteria 2132
395 Ga0466971_0027697 3300044719 Bacteria 2539
396 Ga0466971_0086608 3300044719 Bacteria 1432
397 Ga0466957_0061294 3300044842 Bacteria 2308
398 Ga0466957_0085289 3300044842 Unclassified 1972
399 Ga0466957_0268701 3300044842 Bacteria 1138
400 Ga0466960_0031029 3300044901 Bacteria 2463
401 Ga0466959_0022608 3300045049 Bacteria 4649
402 Ga0466959_0166484 3300045049 Unclassified 1548
403 Ga0466959_0271716 3300045049 Bacteria 1165
404 Ga0466958_0005922 3300045836 Bacteria 6607
405 Ga0466958_0099729 3300045836 Bacteria 1805
406 Ga0466967_0005493 3300045976 Bacteria 8793
407 Ga0466967_0018120 3300045976 Bacteria 5618
408 Ga0466967_0044563 3300045976 Bacteria 3849
409 Ga0466967_0098527 3300045976 Bacteria 2669
410 Ga0466967_0149800 3300045976 Bacteria 2179
411 Ga0466967_0231361 3300045976 Bacteria 1760
412 Ga0466967_0352129 3300045976 Unclassified 1425
413 Ga0466967_0356202 3300045976 Unclassified 1417
414 Ga0466967_0701460 3300045976 Bacteria 1002
415 Ga0495592_0042365 3300046454 Bacteria 3409
416 Ga0495592_0230707 3300046454 Unclassified 1233
417 Ga0495629_0023940 3300046459 Bacteria 4349
418 Ga0495629_0081035 3300046459 Bacteria 2266
419 Ga0495629_0117020 3300046459 Bacteria 1857
420 Ga0495641_0036204 3300046461 Bacteria 2321
421 Ga0495651_0007084 3300046462 Bacteria 8573
422 Ga0495651_0065270 3300046462 Bacteria 2780
423 Ga0495651_0084511 3300046462 Bacteria 2391
424 Ga0495653_0004823 3300046463 Bacteria 10934
425 Ga0495653_0008203 3300046463 Bacteria 8558
426 Ga0495653_0114861 3300046463 Bacteria 1928
427 Ga0495653_0273174 3300046463 Bacteria 1112
428 Ga0495582_0228495 3300046473 Unclassified 1065
429 Ga0495605_0107990 3300046474 Bacteria 1273
430 Ga0495662_0068797 3300046476 Unclassified 1715
431 Ga0495664_0137922 3300046477 Bacteria 1478
432 Ga0495594_0098845 3300046499 Unclassified 1641
433 Ga0495608_0002731 3300046511 Bacteria 12679
434 Ga0495608_0057321 3300046511 Bacteria 2571
435 Ga0495608_0267421 3300046511 Unclassified 1063
436 Ga0495618_0029769 3300046514 Bacteria 3407
437 Ga0495618_0050759 3300046514 Bacteria 2621
438 Ga0495628_0067780 3300046516 Unclassified 2786
439 Ga0495628_0134349 3300046516 Bacteria 1891
440 Ga0495630_0028140 3300046517 Bacteria 4176
441 Ga0495630_0084707 3300046517 Bacteria 2393
442 Ga0495630_0108560 3300046517 Bacteria 2102
443 Ga0495652_0014317 3300046529 Bacteria 7123
444 Ga0495652_0126384 3300046529 Unclassified 2031
445 Ga0495640_0006813 3300046533 Bacteria 9009
446 Ga0495640_0023415 3300046533 Bacteria 4499
447 Ga0495640_0107863 3300046533 Bacteria 1822
448 Ga0495586_0006308 3300046535 Bacteria 6335
449 Ga0495587_0298230 3300046536 Unclassified 902
450 Ga0495645_0201320 3300046543 Unclassified 1351
451 Ga0495667_0005419 3300046559 Bacteria 8625
452 Ga0495667_0006310 3300046559 Bacteria 8044
453 Ga0495667_0017263 3300046559 Bacteria 4876
454 Ga0495667_0037301 3300046559 Bacteria 3240
455 Ga0495667_0077353 3300046559 Bacteria 2164
456 Ga0495634_0007192 3300046642 Bacteria 8392
457 Ga0495634_0055191 3300046642 Bacteria 2657
458 Ga0495634_0139634 3300046642 Bacteria 1539
459 Ga0495634_0160361 3300046642 Unclassified 1418
460 Ga0495635_0010289 3300046663 Bacteria 6542
461 Ga0495635_0063926 3300046663 Bacteria 2527
462 Ga0495635_0144422 3300046663 Unclassified 1620
463 Ga0495657_0025584 3300046675 Bacteria 4190
464 Ga0495657_0037756 3300046675 Unclassified 3327
465 Ga0495599_0124713 3300046678 Bacteria 1601
466 Ga0495599_0296635 3300046678 Bacteria 976
467 Ga0495646_0237639 3300046680 Bacteria 980
468 Ga0495658_0052080 3300046683 Bacteria 2320
469 Ga0495658_0122340 3300046683 Unclassified 1575
470 Ga0495658_0202173 3300046683 Unclassified 1238
471 Ga0495658_0463790 3300046683 Bacteria 810
472 Ga0495613_0013086 3300046689 Bacteria 6165
473 Ga0495613_0016927 3300046689 Bacteria 5429
474 Ga0495613_0074598 3300046689 Bacteria 2470
475 Ga0495613_0327892 3300046689 Bacteria 1055
476 Ga0495600_0012994 3300046809 Bacteria 5221
477 Ga0495600_0026587 3300046809 Unclassified 3736
478 Ga0495581_0182287 3300047315 Bacteria 1228
479 Ga0495604_0042405 3300047317 Bacteria 3566
480 Ga0495674_0009681 3300047319 Bacteria 9147
481 Ga0495674_0087356 3300047319 Bacteria 2668
482 Ga0495676_0126434 3300047321 Bacteria 1852
483 Ga0495680_0001425 3300047322 Bacteria 25755
484 Ga0495680_0005122 3300047322 Bacteria 12377
485 Ga0495680_0006803 3300047322 Bacteria 10562
486 Ga0495680_0021461 3300047322 Bacteria 5406
487 Ga0495680_0025475 3300047322 Bacteria 4894
488 Ga0495675_0130652 3300047444 Unclassified 1561
489 Ga0495675_0194545 3300047444 Unclassified 1237
490 Ga0495684_0005276 3300047471 Bacteria 10064
491 Ga0495684_0005993 3300047471 Bacteria 9443
492 Ga0495684_0011204 3300047471 Bacteria 6931
493 Ga0495684_0035027 3300047471 Bacteria 3851
494 Ga0495684_0037791 3300047471 Bacteria 3703
495 Ga0495602_0132539 3300048088 Bacteria 1985
496 Ga0495602_0197154 3300048088 Bacteria 1539
497 Ga0495602_0224271 3300048088 Unclassified 1416
498 Ga0496100_0003481 3300048903 Bacteria 8214
499 Ga0496100_0009677 3300048903 Bacteria 5422
500 Ga0496100_0105444 3300048903 Bacteria 1949
501 Ga0496100_0159223 3300048903 Unclassified 1617
502 Ga0496100_0735344 3300048903 Bacteria 771
503 Ga0496101_0005132 3300048904 Bacteria 8327
504 Ga0496101_0008095 3300048904 Bacteria 6856
505 Ga0496101_0014491 3300048904 Bacteria 5300
506 Ga0496101_0034573 3300048904 Bacteria 3570
507 Ga0496101_0044169 3300048904 Bacteria 3188
508 Ga0496101_0315086 3300048904 Bacteria 1227
509 Ga0496102_0023381 3300048905 Bacteria 5488
510 Ga0496102_0085366 3300048905 Bacteria 2914
511 Ga0496102_0116844 3300048905 Unclassified 2489
512 Ga0496102_0125137 3300048905 Unclassified 2402
513 Ga0496103_0013564 3300048906 Bacteria 4833
514 Ga0496103_0456346 3300048906 Bacteria 819
515 Ga0496104_0035038 3300048907 Bacteria 4684
516 Ga0496104_0094310 3300048907 Bacteria 2863
517 Ga0496104_0182149 3300048907 Bacteria 2011
518 Ga0496104_0304309 3300048907 Bacteria 1506
519 Ga0496105_0020644 3300048908 Bacteria 5323
520 Ga0496106_0005421 3300048909 Bacteria 9436
521 Ga0496106_0058376 3300048909 Bacteria 2921
522 Ga0496106_0089617 3300048909 Bacteria 2372
523 Ga0496106_0440892 3300048909 Bacteria 1046
524 Ga0496107_0014770 3300048910 Bacteria 5467
525 Ga0496107_0021228 3300048910 Bacteria 4589
526 Ga0496107_0096057 3300048910 Bacteria 2168
527 Ga0496107_0116241 3300048910 Bacteria 1969
528 Ga0496107_0278820 3300048910 Bacteria 1244
529 Ga0496107_0552529 3300048910 Bacteria 853
530 Ga0496108_0116601 3300048911 Bacteria 2288
531 Ga0496109_0066566 3300048912 Bacteria 3299
532 Ga0496109_0069885 3300048912 Unclassified 3221
533 Ga0496109_0096008 3300048912 Bacteria 2745
534 Ga0496109_0181390 3300048912 Unclassified 1977
535 Ga0496109_0280613 3300048912 Bacteria 1570
536 Ga0496109_0317191 3300048912 Unclassified 1471
537 Ga0496110_0057952 3300048913 Bacteria 3411
538 Ga0496110_0065979 3300048913 Bacteria 3200
539 Ga0496110_0241998 3300048913 Bacteria 1642
540 Ga0496111_0011893 3300048914 Bacteria 5880
541 Ga0496111_0055550 3300048914 Bacteria 2864
542 Ga0496111_0058895 3300048914 Bacteria 2782
543 Ga0496112_0001277 3300048915 Bacteria 19080
544 Ga0496112_0047109 3300048915 Bacteria 4229
545 Ga0496112_0101924 3300048915 Bacteria 2840
546 Ga0496112_0404084 3300048915 Bacteria 1305
547 Ga0496112_0802449 3300048915 Unclassified 866
548 Ga0496113_0018460 3300048916 Bacteria 4858
549 Ga0496113_0072949 3300048916 Bacteria 2614
550 Ga0496113_0097638 3300048916 Bacteria 2273
551 Ga0496114_0019973 3300048917 Bacteria 5434
552 Ga0496114_0023900 3300048917 Bacteria 4987
553 Ga0496114_0124146 3300048917 Bacteria 2223
554 Ga0496115_0000470 3300048918 Bacteria 32145
555 Ga0496115_0049796 3300048918 Unclassified 3354
556 Ga0496115_0118583 3300048918 Unclassified 2176
557 Ga0501067_0201639 3300049583 Bacteria 1108
558 Ga0501070_0091004 3300049586 Bacteria 2525
559 nmdc:mga05p37_238460_c1 3300050507 Bacteria 2188
560 nmdc:mga0n895_249022_c1 3300050512 Bacteria 1803
561 nmdc:mga0n895_349896_c1 3300050512 Bacteria 1497
562 nmdc:mga0n895_63861_c1 3300050512 Bacteria 3641
563 nmdc:mga0rr50_27367_c1 3300050513 Bacteria 3991
564 nmdc:mga0a205_22977_c1 3300050515 Bacteria 5913
565 nmdc:mga0a205_321996_c1 3300050515 Archaea 1417
566 Ga0495601_0039594 3300053077 Bacteria 2952
567 Ga0495601_0298717 3300053077 Bacteria 1049
568 Ga0495595_0004766 3300053084 Bacteria 5460
569 Ga0495595_0009694 3300053084 Bacteria 3988
570 Ga0495595_0012655 3300053084 Bacteria 3552
571 Ga0495595_0017399 3300053084 Bacteria 3093
572 Ga0495619_0002547 3300053085 Bacteria 11932
573 Ga0495619_0056742 3300053085 Bacteria 2597
574 Ga0495619_0356245 3300053085 Bacteria 1012
575 Ga0587106_039265 3300059605 Unclassified 797
576 Ga0587115_021522 3300059626 Unclassified 902
577 Ga0466962_0000627 3300061719 Bacteria 15671
578 Ga0466962_0031716 3300061719 Bacteria 2530
579 Ga0466962_0071367 3300061719 Unclassified 1659
580 Ga0265338_10024795
581 Ga0070658_10410253
582 Ga0070658_10453542
583 Ga0070683_100005013
584 Ga0070683_100016127
585 Ga0070683_100266764
586 Ga0070683_100317239
587 Ga0070680_100016898
588 Ga0070680_100018961
589 Ga0070680_100057549
590 Ga0070680_100093251
591 Ga0070682_100213146
592 Ga0070660_100000345
593 Ga0070660_100035475
594 Ga0070660_100541473
595 Ga0070691_10040950
596 Ga0070661_100004985
597 Ga0070661_100048152
598 Ga0070661_100058676
599 Ga0070661_100278940
600 Ga0070668_100249968
601 Ga0070675_100027408
602 Ga0070671_100100327
603 Ga0070671_100205552
604 Ga0070671_100384117
605 Ga0070674_100016297
606 Ga0070673_100123445
607 Ga0070688_100017482
608 Ga0070659_100032398
609 Ga0070703_10010301
610 Ga0070713_100086677
611 Ga0070710_10046035
612 Ga0070710_10174232
613 Ga0070701_10036720
614 Ga0070701_10235016
615 Ga0070711_100162847
616 Ga0070711_100365812
617 Ga0070711_100386148
618 Ga0070705_100102521
619 Ga0070700_100025322
620 Ga0070694_100068519
621 Ga0070663_100448938
622 Ga0070678_100113656
623 Ga0070681_10000245
624 Ga0070681_10016674
625 Ga0070681_10057836
626 Ga0070681_10085030
627 Ga0070681_10089327
628 Ga0070681_10096659
629 Ga0070681_10133462
630 Ga0070681_10194665
631 Ga0070681_10550449
632 Ga0068867_100206063
633 Ga0070685_10024996
634 Ga0070706_100459634
635 Ga0070707_100138217
636 Ga0070707_100202365
637 Ga0070707_100231215
638 Ga0070707_100433444
639 Ga0070698_100018095
640 Ga0070698_100110276
641 Ga0070698_100592612
642 Ga0070698_100700574
643 Ga0070699_100149805
644 Ga0070679_100001751
645 Ga0070679_100002208
646 Ga0070679_100029530
647 Ga0070679_100042256
648 Ga0070679_100288578
649 Ga0070679_100406801
650 Ga0070684_100059474
651 Ga0070684_100093867
652 Ga0070684_100098880
653 Ga0070684_100191815
654 Ga0070684_100293236
655 Ga0070684_100372111
656 Ga0070684_100444367
657 Ga0070697_100349088
658 Ga0068853_100045919
659 Ga0070672_100075405
660 Ga0070686_100013521
661 Ga0070695_100113533
662 Ga0070696_100058191
663 Ga0070696_100130733
664 Ga0070665_100032268
665 Ga0070704_100075041
666 Ga0068855_100022974
667 Ga0068855_100032236
668 Ga0068855_100032532
669 Ga0068855_100059609
670 Ga0068855_100115212
671 Ga0068855_100118271
672 Ga0068855_100155435
673 Ga0068855_100267375
674 Ga0070664_100597556
675 Ga0068857_100047964
676 Ga0068857_100061492
677 Ga0068857_100069392
678 Ga0068856_100228205
679 Ga0068856_100229479
680 Ga0068856_100278467
681 Ga0070702_100059634
682 Ga0070702_100094582
683 Ga0068852_100066172
684 Ga0068852_100091159
685 Ga0068866_10408942
686 Ga0068861_100343902
687 Ga0068870_10023393
688 Ga0070717_10051518
689 Ga0070717_10122147
690 Ga0070715_10000206
691 Ga0070715_10035952
692 Ga0070716_100003710
693 Ga0070712_100045319
694 Ga0070712_100045684
695 Ga0070712_100158217
696 Ga0070712_100182691
697 Ga0097621_100279027
698 Ga0068871_100306040
699 Ga0075434_100055830
700 Ga0075434_100737135
701 Ga0075436_100104933
702 Ga0075435_100072732
703 Ga0075435_100351134
704 Ga0105240_10019847
705 Ga0105240_10020987
706 Ga0105240_10096020
707 Ga0105240_10104598
708 Ga0105240_10108419
709 Ga0105240_10141705
710 Ga0105240_10224580
711 Ga0105240_10281456
712 Ga0105240_10297961
713 Ga0105240_10487464
714 Ga0105245_10021680
715 Ga0105245_10538015
716 Ga0105245_10711159
717 Ga0105242_10008749
718 Ga0105242_10087343
719 Ga0105242_10657382
720 Ga0105248_10197587
721 Ga0105237_10004783
722 Ga0105237_10196786
723 Ga0105238_10027462
724 Ga0105238_10121804
725 Ga0105238_10562661
726 Ga0105238_10935235
727 Ga0105239_10043656
728 Ga0105239_10052370
729 Ga0105239_10324210
730 Ga0105239_10901349
731 Ga0105246_10063863
732 Ga0157373_10113436
733 Ga0157370_10012792
734 Ga0157370_10034824
735 Ga0157370_10039804
736 Ga0157370_10046425
737 Ga0157370_10092727
738 Ga0157370_10109457
739 Ga0157370_10120132
740 Ga0157370_10283290
741 Ga0157369_10004549
742 Ga0157369_10006864
743 Ga0157369_10020044
744 Ga0157369_10034681
745 Ga0157369_10036352
746 Ga0157369_10052939
747 Ga0157369_10155642
748 Ga0157369_10205250
749 Ga0157369_10221333
750 Ga0157369_10517082
751 Ga0157374_10020377
752 Ga0157374_10024729
753 Ga0157378_10049015
754 Ga0157378_11317455
755 Ga0157372_10567059
756 Ga0157372_11283487
757 Ga0157375_10008178
758 Ga0157377_10002216
759 Ga0157377_10107197
760 Ga0157379_10298105
761 Ga0197907_10959858
762 Ga0206356_10959344
763 Ga0206356_11453031
764 Ga0206350_10191131
765 Ga0206354_11034401
766 Ga0206354_11162633
767 Ga0206353_10046952
768 Ga0206353_10356125
769 Ga0206353_10491957
770 Ga0206353_10608505
771 Ga0224712_10035111
772 Ga0207692_10017741
773 Ga0207692_10229393
774 Ga0207685_10087220
775 Ga0207699_10080343
776 Ga0207645_10123598
777 Ga0207643_10003414
778 Ga0207705_10012175
779 Ga0207705_10156172
780 Ga0207705_10270834
781 Ga0207705_10433342
782 Ga0207707_10002971
783 Ga0207707_10041740
784 Ga0207707_10161024
785 Ga0207707_10182231
786 Ga0207707_10225324
787 Ga0207707_10232407
788 Ga0207707_10438610
789 Ga0207695_10058342
790 Ga0207695_10098602
791 Ga0207695_10132277
792 Ga0207695_10230900
793 Ga0207695_10519659
794 Ga0207695_10692523
795 Ga0207693_10005847
796 Ga0207693_10007123
797 Ga0207693_10031227
798 Ga0207663_10011072
799 Ga0207663_10150130
800 Ga0207663_10568315
801 Ga0207660_10001145
802 Ga0207660_10023066
803 Ga0207660_10132820
804 Ga0207660_10568485
805 Ga0207662_10080980
806 Ga0207657_10000073
807 Ga0207657_10001254
808 Ga0207657_10008811
809 Ga0207657_10014007
810 Ga0207657_10295515
811 Ga0207649_10006819
812 Ga0207649_10017081
813 Ga0207649_10248969
814 Ga0207652_10027851
815 Ga0207652_10122203
816 Ga0207652_10127516
817 Ga0207652_10243380
818 Ga0207652_10539011
819 Ga0207646_10009612
820 Ga0207646_10058225
821 Ga0207646_10146543
822 Ga0207694_10163644
823 Ga0207700_10029436
824 Ga0207700_10366163
825 Ga0207700_10538054
826 Ga0207700_10541883
827 Ga0207664_10080902
828 Ga0207664_10181811
829 Ga0207690_10294845
830 Ga0207706_10136506
831 Ga0207686_10137985
832 Ga0207670_10075984
833 Ga0207665_10001018
834 Ga0207665_10013242
835 Ga0207665_10072061
836 Ga0207691_10045560
837 Ga0207711_10167562
838 Ga0207661_10166304
839 Ga0207661_10251463
840 Ga0207661_10292601
841 Ga0207667_10030368
842 Ga0207667_10091280
843 Ga0207667_10218193
844 Ga0207667_10286544
845 Ga0207667_10343344
846 Ga0207667_10456440
847 Ga0207651_10252245
848 Ga0207712_10274805
849 Ga0207668_10145917
850 Ga0207640_10225693
851 Ga0207639_10262974
852 Ga0207678_10075227
853 Ga0207702_10239370
854 Ga0207702_10262111
855 Ga0207702_10606155
856 Ga0207648_10101245
857 Ga0207674_10056895
858 Ga0207674_10288255
859 Ga0207675_100101739
860 Ga0207675_100126680
861 Ga0207683_10246048
862 Ga0207698_10900831
863 Ga0268266_10221580
864 Ga0268266_10257764
865 Ga0268264_10796958
866 Ga0265337_1012112
867 Ga0265337_1055067
868 Ga0265337_1067400
869 Ga0265326_10022268
870 Ga0265319_1081278
871 Ga0265334_10000803
872 Ga0265318_10000900
873 Ga0265318_10000969
874 Ga0265318_10008580
875 Ga0265318_10027360
876 Ga0265323_10035804
877 Ga0265322_10038096
878 Ga0265336_10062491
879 Ga0265338_10007606
880 Ga0265338_10007947
881 Ga0265338_10020089
882 Ga0265338_10024572
883 Ga0265338_10031811
884 Ga0265338_10269031
885 Ga0265330_10005292
886 Ga0265330_10033797
887 Ga0265332_10006662
888 Ga0265328_10004163
889 Ga0265328_10064290
890 Ga0265328_10071499
891 Ga0265320_10009143
892 Ga0265320_10110061
893 Ga0265325_10002518
894 Ga0265325_10003049
895 Ga0265325_10045883
896 Ga0265325_10054895
897 Ga0265329_10017768
898 Ga0265340_10011521
899 Ga0265339_10007748
900 Ga0265339_10013370
901 Ga0265339_10146646
902 Ga0265331_10003820
903 Ga0265331_10017628
904 Ga0265331_10025012
905 Ga0265327_10007063
906 Ga0265327_10022037
907 Ga0265327_10066579
908 Ga0265316_10018595
909 Ga0265316_10029175
910 Ga0265313_10002660
911 Ga0265314_10009570
912 Ga0265314_10029660
913 Ga0265314_10152541
914 Ga0265342_10004897
915 Ga0265342_10040493
916 Ga0265342_10062852
917 Ga0265342_10084830
918 Ga0373958_0012398
919 Ga0373959_0007401
920 Ga0373938_0022892
921 Ga0373940_0035425
922 Ga0373949_0009750
923 Ga0373951_0019756
924 Ga0373932_0009985
925 Ga0373939_0021814
926 Ga0373943_0015569
927 Ga0373943_0272014
928 Ga0373946_0036155
929 Ga0373962_0022413
930 Ga0373924_0127450
931 Ga0373931_0021929
932 Ga0373931_0475544
933 Ga0373935_0076856
934 Ga0373935_0250737
935 Ga0373933_0065439
936 Ga0373933_0152055
937 Ga0373947_0048044
938 Ga0373937_0055415
939 Ga0373925_0017305
940 Ga0373925_0130193
941 Ga0395899_0055899
942 Ga0395899_0121471
943 Ga0395900_0084760
944 Ga0395900_0087681
945 Ga0395900_0102316
946 Ga0395900_0533972
947 Ga0395898_0015943
948 Ga0395898_0057972
949 Ga0395898_0341111
950 Ga0395898_0591302
951 Ga0395905_0059246
952 Ga0395905_0208093
953 Ga0395901_0167603
954 Ga0395901_0215301
955 Ga0395901_0573248
956 Ga0436360_0302860
957 Ga0436362_0146775
958 Ga0451789_0078257
959 Ga0451793_0316351
960 Ga0451835_0517062
961 Ga0451839_0611328
962 Ga0451841_1206048
963 Ga0451847_0026636
964 Ga0466969_0016633
965 Ga0466966_0004461
966 Ga0466966_0094200
967 Ga0466961_0034556
968 Ga0466961_0082981
969 Ga0466963_0007924
970 Ga0466963_0016152
971 Ga0466963_0061337
972 Ga0466963_0218744
973 Ga0466964_0030574
974 Ga0466971_0027697
975 Ga0466971_0086608
976 Ga0466957_0061294
977 Ga0466957_0085289
978 Ga0466957_0268701
979 Ga0466960_0031029
980 Ga0466959_0022608
981 Ga0466959_0166484
982 Ga0466959_0271716
983 Ga0466958_0005922
984 Ga0466958_0099729
985 Ga0466967_0005493
986 Ga0466967_0018120
987 Ga0466967_0044563
988 Ga0466967_0098527
989 Ga0466967_0149800
990 Ga0466967_0231361
991 Ga0466967_0352129
992 Ga0466967_0356202
993 Ga0466967_0701460
994 Ga0495592_0042365
995 Ga0495592_0230707
996 Ga0495629_0023940
997 Ga0495629_0081035
998 Ga0495629_0117020
999 Ga0495641_0036204
1000 Ga0495651_0007084
1001 Ga0495651_0065270
1002 Ga0495651_0084511
1003 Ga0495653_0004823
1004 Ga0495653_0008203
1005 Ga0495653_0114861
1006 Ga0495653_0273174
1007 Ga0495582_0228495
1008 Ga0495605_0107990
1009 Ga0495662_0068797
1010 Ga0495664_0137922
1011 Ga0495594_0098845
1012 Ga0495608_0002731
1013 Ga0495608_0057321
1014 Ga0495608_0267421
1015 Ga0495618_0029769
1016 Ga0495618_0050759
1017 Ga0495628_0067780
1018 Ga0495628_0134349
1019 Ga0495630_0028140
1020 Ga0495630_0084707
1021 Ga0495630_0108560
1022 Ga0495652_0014317
1023 Ga0495652_0126384
1024 Ga0495640_0006813
1025 Ga0495640_0023415
1026 Ga0495640_0107863
1027 Ga0495586_0006308
1028 Ga0495587_0298230
1029 Ga0495645_0201320
1030 Ga0495667_0005419
1031 Ga0495667_0006310
1032 Ga0495667_0017263
1033 Ga0495667_0037301
1034 Ga0495667_0077353
1035 Ga0495634_0007192
1036 Ga0495634_0055191
1037 Ga0495634_0139634
1038 Ga0495634_0160361
1039 Ga0495635_0010289
1040 Ga0495635_0063926
1041 Ga0495635_0144422
1042 Ga0495657_0025584
1043 Ga0495657_0037756
1044 Ga0495599_0124713
1045 Ga0495599_0296635
1046 Ga0495646_0237639
1047 Ga0495658_0052080
1048 Ga0495658_0122340
1049 Ga0495658_0202173
1050 Ga0495658_0463790
1051 Ga0495613_0013086
1052 Ga0495613_0016927
1053 Ga0495613_0074598
1054 Ga0495613_0327892
1055 Ga0495600_0012994
1056 Ga0495600_0026587
1057 Ga0495581_0182287
1058 Ga0495604_0042405
1059 Ga0495674_0009681
1060 Ga0495674_0087356
1061 Ga0495676_0126434
1062 Ga0495680_0001425
1063 Ga0495680_0005122
1064 Ga0495680_0006803
1065 Ga0495680_0021461
1066 Ga0495680_0025475
1067 Ga0495675_0130652
1068 Ga0495675_0194545
1069 Ga0495684_0005276
1070 Ga0495684_0005993
1071 Ga0495684_0011204
1072 Ga0495684_0035027
1073 Ga0495684_0037791
1074 Ga0495602_0132539
1075 Ga0495602_0197154
1076 Ga0495602_0224271
1077 Ga0496100_0003481
1078 Ga0496100_0009677
1079 Ga0496100_0105444
1080 Ga0496100_0159223
1081 Ga0496100_0735344
1082 Ga0496101_0005132
1083 Ga0496101_0008095
1084 Ga0496101_0014491
1085 Ga0496101_0034573
1086 Ga0496101_0044169
1087 Ga0496101_0315086
1088 Ga0496102_0023381
1089 Ga0496102_0085366
1090 Ga0496102_0116844
1091 Ga0496102_0125137
1092 Ga0496103_0013564
1093 Ga0496103_0456346
1094 Ga0496104_0035038
1095 Ga0496104_0094310
1096 Ga0496104_0182149
1097 Ga0496104_0304309
1098 Ga0496105_0020644
1099 Ga0496106_0005421
1100 Ga0496106_0058376
1101 Ga0496106_0089617
1102 Ga0496106_0440892
1103 Ga0496107_0014770
1104 Ga0496107_0021228
1105 Ga0496107_0096057
1106 Ga0496107_0116241
1107 Ga0496107_0278820
1108 Ga0496107_0552529
1109 Ga0496108_0116601
1110 Ga0496109_0066566
1111 Ga0496109_0069885
1112 Ga0496109_0096008
1113 Ga0496109_0181390
1114 Ga0496109_0280613
1115 Ga0496109_0317191
1116 Ga0496110_0057952
1117 Ga0496110_0065979
1118 Ga0496110_0241998
1119 Ga0496111_0011893
1120 Ga0496111_0055550
1121 Ga0496111_0058895
1122 Ga0496112_0001277
1123 Ga0496112_0047109
1124 Ga0496112_0101924
1125 Ga0496112_0404084
1126 Ga0496112_0802449
1127 Ga0496113_0018460
1128 Ga0496113_0072949
1129 Ga0496113_0097638
1130 Ga0496114_0019973
1131 Ga0496114_0023900
1132 Ga0496114_0124146
1133 Ga0496115_0000470
1134 Ga0496115_0049796
1135 Ga0496115_0118583
1136 Ga0501067_0201639
1137 Ga0501070_0091004
1138 nmdc:mga05p37_238460_c1
1139 nmdc:mga0n895_249022_c1
1140 nmdc:mga0n895_349896_c1
1141 nmdc:mga0n895_63861_c1
1142 nmdc:mga0rr50_27367_c1
1143 nmdc:mga0a205_22977_c1
1144 nmdc:mga0a205_321996_c1
1145 Ga0495601_0039594
1146 Ga0495601_0298717
1147 Ga0495595_0004766
1148 Ga0495595_0009694
1149 Ga0495595_0012655
1150 Ga0495595_0017399
1151 Ga0495619_0002547
1152 Ga0495619_0056742
1153 Ga0495619_0356245
1154 Ga0587106_039265
1155 Ga0587115_021522
1156 Ga0466962_0000627
1157 Ga0466962_0031716
1158 Ga0466962_0071367

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

71

219

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9458 66 213
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9339 61 213
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.932 58 198
1sox-assembly1.cif.gz_A sulfite oxidase from chicken liver 0.9093 58 208
1sox-assembly1.cif.gz_B sulfite oxidase from chicken liver 0.9067 58 208
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9362 61 213 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9297 58 198 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9261 58 203 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.921 58 203 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9094 67 208 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A538HTN8-F1-model_v4 Oxidoreductase 0.9797 122 213
AF-A0A538K9G2-F1-model_v4 Oxidoreductase 0.9796 57 213
AF-A0A538HGG2-F1-model_v4 Oxidoreductase 0.9791 73 213
AF-A0A499USH5-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9748 113 214
AF-A0A535MFV3-F1-model_v4 Oxidoreductase 0.9725 85 213 GO:0016491

Map