F465822

General Info

Members Datasets Scaffolds Average Seq Length
579 274 1158 195

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11393996|Ga0105240_113939961
Length 215
Sequence MGGTGQGKGPLNENLIVAPVTAVPTDEIHEKYLQKAISEINELGDDIARAAGGVSVPVLGSGHPLGDIFLLKHTPQSSEIQEGVAFFGRSGQAVLKSLQRLHVDPMAVYGTNCVKLAEGAADEEGRGWLTRELHIVGPKVVVPMGEDARTFLNDIEFPLSQPVEPTLGELQRFTPTIQALYVPDIDESLDEAPAKTKFWNAFKALGPWWAELPPY

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
134 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
158 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
162 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
165 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
166 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
167 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
168 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
169 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
170 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 14.34
Rhizosphere 84.97
Stem 0
Stem Tuber 0
Unclassified 23.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_11393996 3300009093 Unclassified 737
2 JGI25406J46586_10123306 3300003203 Bacteria 762
3 JGI25407J50210_10000558 3300003373 Bacteria 7479
4 JGI25407J50210_10002575 3300003373 Bacteria 4289
5 Ga0070683_100000847 3300005329 Bacteria 22661
6 Ga0070683_100350681 3300005329 Bacteria 1405
7 Ga0070690_100242727 3300005330 Bacteria 1271
8 Ga0070680_100168574 3300005336 Bacteria 1842
9 Ga0070680_100184275 3300005336 Bacteria 1758
10 Ga0070682_100011136 3300005337 Bacteria 5132
11 Ga0070682_100201612 3300005337 Bacteria 1404
12 Ga0068868_100191865 3300005338 Bacteria 1699
13 Ga0070668_100222363 3300005347 Bacteria 1558
14 Ga0070675_100383073 3300005354 Bacteria 1252
15 Ga0070675_100434057 3300005354 Bacteria 1176
16 Ga0070671_100166301 3300005355 Unclassified 1865
17 Ga0070674_100236222 3300005356 Bacteria 1429
18 Ga0070673_100186275 3300005364 Bacteria 1780
19 Ga0070673_100676018 3300005364 Bacteria 947
20 Ga0070709_10003775 3300005434 Bacteria 8141
21 Ga0070709_10157154 3300005434 Unclassified 1577
22 Ga0070709_10416561 3300005434 Bacteria 1006
23 Ga0070714_100154041 3300005435 Unclassified 2074
24 Ga0070714_100778346 3300005435 Bacteria 926
25 Ga0070713_100092226 3300005436 Unclassified 2607
26 Ga0070713_100308043 3300005436 Bacteria 1460
27 Ga0070713_100715640 3300005436 Bacteria 956
28 Ga0070710_10037789 3300005437 Unclassified 2649
29 Ga0070710_10049672 3300005437 Unclassified 2347
30 Ga0070710_10127747 3300005437 Bacteria 1546
31 Ga0070711_100004058 3300005439 Bacteria 8606
32 Ga0070711_100006624 3300005439 Bacteria 6997
33 Ga0070705_100014332 3300005440 Bacteria 4075
34 Ga0070705_100019118 3300005440 Bacteria 3601
35 Ga0070705_100239943 3300005440 Bacteria 1266
36 Ga0070708_100069324 3300005445 Unclassified 3171
37 Ga0070708_100215208 3300005445 Unclassified 1801
38 Ga0070708_100313567 3300005445 Bacteria 1477
39 Ga0070708_100715432 3300005445 Unclassified 942
40 Ga0070663_100045996 3300005455 Bacteria 3086
41 Ga0070678_100008832 3300005456 Bacteria 6061
42 Ga0070678_100781366 3300005456 Bacteria 866
43 Ga0070662_100612338 3300005457 Bacteria 917
44 Ga0070681_10006968 3300005458 Bacteria 10999
45 Ga0070681_10569463 3300005458 Bacteria 1046
46 Ga0070706_100270597 3300005467 Bacteria 1585
47 Ga0070706_100544380 3300005467 Unclassified 1080
48 Ga0070707_100043192 3300005468 Bacteria 4315
49 Ga0070707_101006173 3300005468 Bacteria 799
50 Ga0070698_100054760 3300005471 Bacteria 4049
51 Ga0070698_100068618 3300005471 Bacteria 3562
52 Ga0070698_100597735 3300005471 Unclassified 1044
53 Ga0070699_100048280 3300005518 Bacteria 3683
54 Ga0070699_100073037 3300005518 Bacteria 2984
55 Ga0070699_100169785 3300005518 Unclassified 1932
56 Ga0070679_100007549 3300005530 Bacteria 10170
57 Ga0070684_100292932 3300005535 Bacteria 1492
58 Ga0070697_100346320 3300005536 Unclassified 1283
59 Ga0070672_100246151 3300005543 Bacteria 1505
60 Ga0070686_100113958 3300005544 Bacteria 1847
61 Ga0070686_100285420 3300005544 Unclassified 1219
62 Ga0070695_100061638 3300005545 Bacteria 2434
63 Ga0070695_100105118 3300005545 Bacteria 1907
64 Ga0070695_100106932 3300005545 Unclassified 1892
65 Ga0070696_100005071 3300005546 Bacteria 8798
66 Ga0070696_100080784 3300005546 Unclassified 2302
67 Ga0070693_100001104 3300005547 Bacteria 12119
68 Ga0070693_100194354 3300005547 Unclassified 1314
69 Ga0070693_100231979 3300005547 Bacteria 1215
70 Ga0070665_100280194 3300005548 Bacteria 1669
71 Ga0070704_100035670 3300005549 Bacteria 3383
72 Ga0070704_100047407 3300005549 Bacteria 3003
73 Ga0070704_100144467 3300005549 Bacteria 1862
74 Ga0070704_100233245 3300005549 Bacteria 1502
75 Ga0070664_100202659 3300005564 Bacteria 1771
76 Ga0070664_100281070 3300005564 Bacteria 1501
77 Ga0068854_100183195 3300005578 Bacteria 1637
78 Ga0068854_100379130 3300005578 Bacteria 1165
79 Ga0068856_100052276 3300005614 Bacteria 4029
80 Ga0068856_100675154 3300005614 Bacteria 1054
81 Ga0070702_100025736 3300005615 Unclassified 3156
82 Ga0068861_100099992 3300005719 Bacteria 2304
83 Ga0068870_10152071 3300005840 Bacteria 1364
84 Ga0068858_100445246 3300005842 Bacteria 1248
85 Ga0068860_100347248 3300005843 Bacteria 1460
86 Ga0068862_100132412 3300005844 Bacteria 2206
87 Ga0081455_10194130 3300005937 Unclassified 1526
88 Ga0081538_10000795 3300005981 Bacteria 34267
89 Ga0081538_10002124 3300005981 Bacteria 19751
90 Ga0081538_10038054 3300005981 Bacteria 3110
91 Ga0070717_10355700 3300006028 Bacteria 1310
92 Ga0075365_10263632 3300006038 Unclassified 1211
93 Ga0075364_10056662 3300006051 Unclassified 2566
94 Ga0075432_10096770 3300006058 Unclassified 1086
95 Ga0070715_10014187 3300006163 Unclassified 2945
96 Ga0070715_10043057 3300006163 Unclassified 1901
97 Ga0070716_100029701 3300006173 Unclassified 2958
98 Ga0070716_100049090 3300006173 Unclassified 2389
99 Ga0070716_100193269 3300006173 Unclassified 1346
100 Ga0070712_100031111 3300006175 Bacteria 3593
101 Ga0070712_100148023 3300006175 Unclassified 1799
102 Ga0075362_10020822 3300006177 Unclassified 2744
103 Ga0097621_100046478 3300006237 Bacteria 3512
104 Ga0068871_100033893 3300006358 Bacteria 4046
105 Ga0068871_100178460 3300006358 Bacteria 1824
106 Ga0068871_100267557 3300006358 Bacteria 1493
107 Ga0075433_10247331 3300006852 Bacteria 1582
108 Ga0075434_100172501 3300006871 Unclassified 2183
109 Ga0075434_100627108 3300006871 Bacteria 1094
110 Ga0075435_100161170 3300007076 Unclassified 1889
111 Ga0075435_100689564 3300007076 Bacteria 887
112 Ga0105250_10034779 3300009092 Bacteria 2021
113 Ga0111539_10950713 3300009094 Bacteria 999
114 Ga0105245_10013369 3300009098 Bacteria 7155
115 Ga0105245_10029890 3300009098 Bacteria 4817
116 Ga0105245_10169437 3300009098 Bacteria 2078
117 Ga0114129_10172289 3300009147 Bacteria 2949
118 Ga0114129_10224454 3300009147 Bacteria 2533
119 Ga0114129_10567297 3300009147 Unclassified 1474
120 Ga0114129_11001394 3300009147 Bacteria 1052
121 Ga0114129_11203286 3300009147 Bacteria 944
122 Ga0105243_10074878 3300009148 Bacteria 2747
123 Ga0105243_10181009 3300009148 Bacteria 1833
124 Ga0105243_10275406 3300009148 Bacteria 1513
125 Ga0105243_11192513 3300009148 Bacteria 774
126 Ga0105241_10101988 3300009174 Archaea 2283
127 Ga0105242_10169826 3300009176 Bacteria 1916
128 Ga0105242_10567352 3300009176 Bacteria 1091
129 Ga0105248_11055246 3300009177 Bacteria 918
130 Ga0105248_11628587 3300009177 Unclassified 731
131 Ga0105249_10268335 3300009553 Bacteria 1699
132 Ga0105249_10338647 3300009553 Bacteria 1520
133 Ga0105239_10439909 3300010375 Unclassified 1478
134 Ga0105239_10441711 3300010375 Unclassified 1475
135 Ga0157369_11069408 3300013105 Unclassified 825
136 Ga0157374_10415199 3300013296 Bacteria 1344
137 Ga0157378_10434999 3300013297 Unclassified 1299
138 Ga0163162_10290832 3300013306 Bacteria 1766
139 Ga0157375_10248758 3300013308 Unclassified 1938
140 Ga0157375_10420132 3300013308 Bacteria 1503
141 Ga0157375_10624641 3300013308 Unclassified 1235
142 Ga0163163_10546991 3300014325 Unclassified 1220
143 Ga0163163_10628096 3300014325 Bacteria 1138
144 Ga0182008_10187055 3300014497 Unclassified 1050
145 Ga0157377_10436483 3300014745 Bacteria 901
146 Ga0157379_10443606 3300014968 Unclassified 1197
147 Ga0157376_10044679 3300014969 Bacteria 3643
148 Ga0163161_10100613 3300017792 Bacteria 2151
149 Ga0207653_10012387 3300025885 Unclassified 2663
150 Ga0207692_10243289 3300025898 Bacteria 1075
151 Ga0207642_10275000 3300025899 Bacteria 966
152 Ga0207688_10136879 3300025901 Bacteria 1439
153 Ga0207685_10061628 3300025905 Unclassified 1488
154 Ga0207685_10071081 3300025905 Unclassified 1411
155 Ga0207699_10043456 3300025906 Unclassified 2610
156 Ga0207699_10204668 3300025906 Bacteria 1339
157 Ga0207643_10308784 3300025908 Bacteria 986
158 Ga0207684_10115351 3300025910 Bacteria 2301
159 Ga0207684_10245661 3300025910 Bacteria 1544
160 Ga0207684_10460274 3300025910 Unclassified 1092
161 Ga0207684_10500462 3300025910 Unclassified 1042
162 Ga0207654_10055600 3300025911 Unclassified 2292
163 Ga0207654_10218917 3300025911 Bacteria 1262
164 Ga0207707_10002713 3300025912 Bacteria 15814
165 Ga0207707_10668541 3300025912 Bacteria 874
166 Ga0207693_10009780 3300025915 Bacteria 7808
167 Ga0207693_10195778 3300025915 Unclassified 1590
168 Ga0207693_10343024 3300025915 Unclassified 1169
169 Ga0207663_10000759 3300025916 Bacteria 14425
170 Ga0207663_10006071 3300025916 Bacteria 6142
171 Ga0207663_10028497 3300025916 Unclassified 3269
172 Ga0207663_10139994 3300025916 Bacteria 1684
173 Ga0207660_10153174 3300025917 Bacteria 1773
174 Ga0207660_10538573 3300025917 Unclassified 949
175 Ga0207657_10086419 3300025919 Bacteria 2625
176 Ga0207652_10004552 3300025921 Bacteria 11253
177 Ga0207646_10071904 3300025922 Bacteria 3089
178 Ga0207646_10202468 3300025922 Bacteria 1793
179 Ga0207646_10244136 3300025922 Bacteria 1622
180 Ga0207646_10522100 3300025922 Unclassified 1069
181 Ga0207687_10007156 3300025927 Bacteria 7358
182 Ga0207700_10154190 3300025928 Unclassified 1901
183 Ga0207700_10265791 3300025928 Bacteria 1470
184 Ga0207700_10335410 3300025928 Bacteria 1313
185 Ga0207664_10058991 3300025929 Bacteria 3055
186 Ga0207664_10087047 3300025929 Unclassified 2553
187 Ga0207664_10091786 3300025929 Unclassified 2491
188 Ga0207664_11003684 3300025929 Unclassified 748
189 Ga0207644_10582518 3300025931 Bacteria 928
190 Ga0207706_10045395 3300025933 Bacteria 3893
191 Ga0207686_10089458 3300025934 Bacteria 2029
192 Ga0207709_10366877 3300025935 Bacteria 1092
193 Ga0207709_10703547 3300025935 Bacteria 809
194 Ga0207709_11161689 3300025935 Unclassified 635
195 Ga0207704_10358430 3300025938 Bacteria 1138
196 Ga0207704_10417499 3300025938 Bacteria 1063
197 Ga0207665_10020035 3300025939 Unclassified 4393
198 Ga0207711_10146225 3300025941 Unclassified 2130
199 Ga0207661_10000646 3300025944 Bacteria 22497
200 Ga0207679_10015107 3300025945 Bacteria 5093
201 Ga0207679_10438173 3300025945 Unclassified 1157
202 Ga0207667_10416845 3300025949 Bacteria 1366
203 Ga0207651_10332531 3300025960 Unclassified 1274
204 Ga0207651_10518331 3300025960 Unclassified 1033
205 Ga0207651_10557679 3300025960 Bacteria 997
206 Ga0207712_10712430 3300025961 Bacteria 877
207 Ga0207640_10189830 3300025981 Bacteria 1548
208 Ga0207677_10068319 3300026023 Bacteria 2493
209 Ga0207677_10279439 3300026023 Bacteria 1370
210 Ga0207703_10700798 3300026035 Bacteria 963
211 Ga0207678_10030538 3300026067 Bacteria 4703
212 Ga0207678_10832065 3300026067 Bacteria 815
213 Ga0207702_10003702 3300026078 Bacteria 13834
214 Ga0207702_10028451 3300026078 Bacteria 4646
215 Ga0207702_10227422 3300026078 Bacteria 1741
216 Ga0207702_10848479 3300026078 Bacteria 904
217 Ga0207648_10546175 3300026089 Bacteria 1064
218 Ga0207676_10295178 3300026095 Unclassified 1478
219 Ga0207675_100117980 3300026118 Bacteria 2509
220 Ga0207675_100579594 3300026118 Bacteria 1123
221 Ga0207683_10000973 3300026121 Bacteria 26237
222 Ga0207683_10006616 3300026121 Bacteria 9918
223 Ga0207683_10011336 3300026121 Bacteria 7606
224 Ga0207683_10399984 3300026121 Bacteria 1263
225 Ga0207428_10096496 3300027907 Unclassified 2289
226 Ga0207428_10718645 3300027907 Unclassified 714
227 Ga0268266_10204430 3300028379 Bacteria 1809
228 Ga0268264_10633951 3300028381 Bacteria 1056
229 Ga0265318_10025664 3300028577 Bacteria 2325
230 Ga0307408_100392134 3300031548 Bacteria 1190
231 Ga0307408_100408085 3300031548 Bacteria 1168
232 Ga0307416_100120663 3300032002 Bacteria 2335
233 Ga0307416_100576365 3300032002 Bacteria 1202
234 Ga0307415_100044855 3300032126 Bacteria 2959
235 Ga0373930_0003902 3300034816 Bacteria 2394
236 Ga0373930_0077803 3300034816 Bacteria 763
237 Ga0373948_0006074 3300034817 Unclassified 1982
238 Ga0373950_0029304 3300034818 Bacteria 1012
239 Ga0373959_0020113 3300034820 Unclassified 1271
240 Ga0373928_0004514 3300035084 Bacteria 2653
241 Ga0373928_0017321 3300035084 Bacteria 1482
242 Ga0373929_0001468 3300035085 Bacteria 4490
243 Ga0373929_0037870 3300035085 Bacteria 1059
244 Ga0373940_0001916 3300035088 Bacteria 3916
245 Ga0373949_0002441 3300035090 Bacteria 4778
246 Ga0373951_0005321 3300035091 Bacteria 2995
247 Ga0373952_0002355 3300035092 Bacteria 3403
248 Ga0373932_0001300 3300035112 Bacteria 7049
249 Ga0373932_0007554 3300035112 Bacteria 2590
250 Ga0373939_0002372 3300035114 Bacteria 4449
251 Ga0373941_0038151 3300035115 Unclassified 1469
252 Ga0373960_0000715 3300035121 Bacteria 6900
253 Ga0373960_0253418 3300035121 Bacteria 640
254 Ga0373942_0003602 3300035207 Bacteria 3633
255 Ga0373942_0006440 3300035207 Bacteria 2712
256 Ga0373961_0053754 3300035241 Unclassified 1202
257 Ga0373962_0002061 3300035242 Bacteria 4794
258 Ga0373962_0029589 3300035242 Bacteria 1493
259 Ga0373931_0005421 3300035691 Bacteria 5895
260 Ga0373931_0067938 3300035691 Bacteria 1939
261 Ga0373935_0248134 3300035692 Bacteria 1245
262 Ga0373947_0078060 3300035725 Bacteria 2043
263 Ga0373947_0578427 3300035725 Bacteria 765
264 Ga0373937_0100142 3300036401 Unclassified 2689
265 Ga0395899_0001360 3300037312 Bacteria 20970
266 Ga0395899_0003797 3300037312 Bacteria 11928
267 Ga0395899_0079183 3300037312 Unclassified 2393
268 Ga0395900_0005085 3300037418 Bacteria 13803
269 Ga0395900_0023734 3300037418 Bacteria 6274
270 Ga0395900_0258504 3300037418 Unclassified 1740
271 Ga0395900_0766618 3300037418 Unclassified 894
272 Ga0395900_0789907 3300037418 Bacteria 878
273 Ga0395898_0001821 3300037466 Bacteria 27497
274 Ga0395898_0018646 3300037466 Bacteria 7074
275 Ga0395898_0142037 3300037466 Unclassified 2298
276 Ga0395898_0398249 3300037466 Bacteria 1313
277 Ga0395905_0010094 3300037471 Bacteria 9204
278 Ga0395905_0119176 3300037471 Bacteria 2480
279 Ga0395901_0017741 3300038443 Bacteria 7265
280 Ga0395901_0156973 3300038443 Bacteria 2389
281 Ga0395901_0537324 3300038443 Bacteria 1186
282 Ga0395901_0717977 3300038443 Bacteria 995
283 Ga0439438_020982 3300041405 Bacteria 1827
284 Ga0439453_0002538 3300041408 Bacteria 2530
285 Ga0439453_0021252 3300041408 Unclassified 1169
286 Ga0439466_0048203 3300041411 Bacteria 1402
287 Ga0451804_0596926 3300041463 Bacteria 824
288 Ga0439437_005060 3300042000 Unclassified 1446
289 Ga0439441_031994 3300042001 Unclassified 1024
290 Ga0439432_083569 3300042006 Bacteria 966
291 Ga0439451_003682 3300042009 Bacteria 3106
292 Ga0439454_003464 3300042011 Unclassified 1756
293 Ga0439463_097486 3300042016 Bacteria 758
294 Ga0450911_021476 3300042115 Bacteria 842
295 Ga0450920_008032 3300042122 Bacteria 1923
296 Ga0450920_055153 3300042122 Bacteria 799
297 Ga0450888_017132 3300042126 Bacteria 898
298 Ga0450907_003474 3300042146 Bacteria 2809
299 Ga0439446_0005137 3300042156 Bacteria 3354
300 Ga0439446_0008264 3300042156 Bacteria 2758
301 Ga0450908_017564 3300042184 Bacteria 1269
302 Ga0439434_0014300 3300042435 Bacteria 2361
303 Ga0439434_0021814 3300042435 Bacteria 1925
304 Ga0439435_0173269 3300042436 Bacteria 702
305 Ga0439460_0039285 3300042461 Bacteria 1383
306 Ga0450918_020780 3300042531 Bacteria 1147
307 Ga0466963_0273219 3300044694 Bacteria 1187
308 Ga0466963_0413209 3300044694 Bacteria 952
309 Ga0466960_0195015 3300044901 Bacteria 1104
310 Ga0466960_0215701 3300044901 Bacteria 1054
311 Ga0466960_0431063 3300044901 Unclassified 764
312 Ga0466960_0435677 3300044901 Unclassified 760
313 Ga0451576_0393312 3300045051 Bacteria 1453
314 Ga0466967_0209510 3300045976 Bacteria 1848
315 Ga0466967_0488386 3300045976 Unclassified 1207
316 Ga0466967_0539426 3300045976 Bacteria 1147
317 Ga0495592_0086913 3300046454 Bacteria 2251
318 Ga0495592_0145073 3300046454 Unclassified 1647
319 Ga0495592_0147156 3300046454 Bacteria 1632
320 Ga0495603_0016440 3300046455 Bacteria 4476
321 Ga0495629_0067627 3300046459 Bacteria 2493
322 Ga0495641_0023734 3300046461 Bacteria 3040
323 Ga0495641_0114757 3300046461 Unclassified 1201
324 Ga0495651_0505525 3300046462 Bacteria 773
325 Ga0495582_0030606 3300046473 Bacteria 2956
326 Ga0495582_0048492 3300046473 Bacteria 2339
327 Ga0495639_0192498 3300046475 Bacteria 996
328 Ga0495584_0138615 3300046491 Bacteria 1235
329 Ga0495585_0154049 3300046492 Bacteria 1197
330 Ga0495618_0049395 3300046514 Bacteria 2657
331 Ga0495628_0181063 3300046516 Bacteria 1594
332 Ga0495630_0132966 3300046517 Bacteria 1890
333 Ga0495630_0784849 3300046517 Bacteria 727
334 Ga0495644_0231141 3300046523 Bacteria 716
335 Ga0495642_0265416 3300046528 Bacteria 751
336 Ga0495640_0151660 3300046533 Unclassified 1489
337 Ga0495656_0035911 3300046615 Unclassified 2039
338 Ga0495656_0086831 3300046615 Bacteria 1424
339 Ga0495634_0028584 3300046642 Bacteria 3869
340 Ga0495634_0146854 3300046642 Bacteria 1494
341 Ga0495634_0199571 3300046642 Bacteria 1243
342 Ga0495635_0022595 3300046663 Bacteria 4383
343 Ga0495635_0439854 3300046663 Bacteria 863
344 Ga0495646_0278609 3300046680 Bacteria 889
345 Ga0495647_0064785 3300046681 Bacteria 1450
346 Ga0495658_0046842 3300046683 Bacteria 2432
347 Ga0495658_0184882 3300046683 Bacteria 1294
348 Ga0495613_0012667 3300046689 Bacteria 6270
349 Ga0495613_0034717 3300046689 Bacteria 3745
350 Ga0495613_0054777 3300046689 Bacteria 2931
351 Ga0495624_0399836 3300046690 Bacteria 825
352 Ga0495670_0111368 3300046691 Unclassified 1417
353 Ga0495589_0123844 3300046794 Bacteria 1244
354 Ga0495636_0158815 3300047318 Unclassified 1018
355 Ga0495674_0009669 3300047319 Bacteria 9153
356 Ga0495676_0039647 3300047321 Bacteria 3898
357 Ga0495680_0006974 3300047322 Bacteria 10420
358 Ga0495680_0250559 3300047322 Bacteria 1255
359 Ga0495593_0073026 3300047673 Unclassified 1780
360 Ga0495614_0336565 3300048089 Bacteria 702
361 Ga0496100_0004055 3300048903 Bacteria 7721
362 Ga0496100_0004272 3300048903 Bacteria 7559
363 Ga0496100_0105917 3300048903 Bacteria 1945
364 Ga0496100_0112827 3300048903 Bacteria 1891
365 Ga0496100_0258933 3300048903 Bacteria 1290
366 Ga0496100_0283393 3300048903 Bacteria 1236
367 Ga0496101_0005189 3300048904 Bacteria 8287
368 Ga0496101_0011585 3300048904 Bacteria 5855
369 Ga0496101_0161987 3300048904 Bacteria 1716
370 Ga0496101_0319375 3300048904 Unclassified 1218
371 Ga0496101_0464275 3300048904 Unclassified 999
372 Ga0496102_0013185 3300048905 Bacteria 7151
373 Ga0496102_0026180 3300048905 Bacteria 5199
374 Ga0496102_0030900 3300048905 Bacteria 4797
375 Ga0496102_0032076 3300048905 Bacteria 4718
376 Ga0496102_0345814 3300048905 Bacteria 1400
377 Ga0496103_0009699 3300048906 Bacteria 5698
378 Ga0496103_0017597 3300048906 Bacteria 4278
379 Ga0496104_0004621 3300048907 Bacteria 11998
380 Ga0496104_0008731 3300048907 Bacteria 9009
381 Ga0496104_0062358 3300048907 Bacteria 3535
382 Ga0496104_0152907 3300048907 Bacteria 2214
383 Ga0496104_0261828 3300048907 Unclassified 1642
384 Ga0496104_0437471 3300048907 Bacteria 1220
385 Ga0496105_0000147 3300048908 Bacteria 46556
386 Ga0496105_0004406 3300048908 Bacteria 10598
387 Ga0496105_0005089 3300048908 Bacteria 9964
388 Ga0496105_0087608 3300048908 Bacteria 2572
389 Ga0496105_0198082 3300048908 Bacteria 1640
390 Ga0496105_0613133 3300048908 Bacteria 843
391 Ga0496106_0017396 3300048909 Bacteria 5319
392 Ga0496106_0122820 3300048909 Bacteria 2031
393 Ga0496106_0148568 3300048909 Bacteria 1847
394 Ga0496106_0216321 3300048909 Bacteria 1527
395 Ga0496107_0008894 3300048910 Bacteria 6958
396 Ga0496107_0017744 3300048910 Bacteria 5007
397 Ga0496108_0005536 3300048911 Bacteria 10219
398 Ga0496108_0009368 3300048911 Bacteria 7925
399 Ga0496108_0128071 3300048911 Bacteria 2181
400 Ga0496108_0150193 3300048911 Unclassified 2010
401 Ga0496108_0308697 3300048911 Bacteria 1378
402 Ga0496108_0638209 3300048911 Bacteria 926
403 Ga0496108_0832524 3300048911 Bacteria 795
404 Ga0496109_0011770 3300048912 Bacteria 7529
405 Ga0496109_0014652 3300048912 Bacteria 6821
406 Ga0496109_0046116 3300048912 Bacteria 3958
407 Ga0496109_0047300 3300048912 Unclassified 3911
408 Ga0496109_0219172 3300048912 Bacteria 1789
409 Ga0496109_0223615 3300048912 Bacteria 1770
410 Ga0496109_0264327 3300048912 Unclassified 1621
411 Ga0496109_0521503 3300048912 Bacteria 1121
412 Ga0496109_0539969 3300048912 Unclassified 1100
413 Ga0496109_1336833 3300048912 Bacteria 652
414 Ga0496110_0003225 3300048913 Bacteria 12422
415 Ga0496110_0004408 3300048913 Bacteria 10902
416 Ga0496110_0110959 3300048913 Bacteria 2465
417 Ga0496110_0117309 3300048913 Bacteria 2397
418 Ga0496110_0118439 3300048913 Unclassified 2385
419 Ga0496110_0220301 3300048913 Bacteria 1725
420 Ga0496110_0250292 3300048913 Bacteria 1613
421 Ga0496110_0277206 3300048913 Unclassified 1527
422 Ga0496110_0319114 3300048913 Bacteria 1415
423 Ga0496110_0323382 3300048913 Unclassified 1405
424 Ga0496110_0396538 3300048913 Unclassified 1258
425 Ga0496110_0414540 3300048913 Bacteria 1228
426 Ga0496111_0022064 3300048914 Bacteria 4453
427 Ga0496111_0314571 3300048914 Bacteria 1160
428 Ga0496111_0606783 3300048914 Bacteria 801
429 Ga0496112_0000273 3300048915 Bacteria 33471
430 Ga0496112_0026858 3300048915 Bacteria 5547
431 Ga0496112_0046366 3300048915 Bacteria 4263
432 Ga0496112_0091236 3300048915 Bacteria 3016
433 Ga0496112_0334395 3300048915 Bacteria 1458
434 Ga0496112_0491808 3300048915 Bacteria 1163
435 Ga0496113_0012649 3300048916 Bacteria 5679
436 Ga0496113_0197329 3300048916 Unclassified 1599
437 Ga0496113_0410685 3300048916 Bacteria 1087
438 Ga0496114_0011069 3300048917 Bacteria 7198
439 Ga0496114_0029854 3300048917 Bacteria 4482
440 Ga0496114_0053753 3300048917 Bacteria 3357
441 Ga0496114_0455429 3300048917 Unclassified 1133
442 Ga0496115_0008795 3300048918 Bacteria 7481
443 Ga0501031_0002709 3300049568 Bacteria 11275
444 Ga0501031_0005329 3300049568 Bacteria 8375
445 Ga0501031_0056099 3300049568 Bacteria 2566
446 Ga0501031_0336062 3300049568 Unclassified 978
447 Ga0501032_0024296 3300049569 Unclassified 4186
448 Ga0501032_0100615 3300049569 Unclassified 1915
449 Ga0501033_0004060 3300049570 Bacteria 11820
450 Ga0501033_0059105 3300049570 Bacteria 2831
451 Ga0501034_0337678 3300049571 Unclassified 1437
452 Ga0501034_0598129 3300049571 Bacteria 1009
453 Ga0501036_0014212 3300049572 Bacteria 6623
454 Ga0501036_0102222 3300049572 Bacteria 2425
455 Ga0501036_0111605 3300049572 Bacteria 2310
456 Ga0501037_0012038 3300049573 Bacteria 6370
457 Ga0501037_0238868 3300049573 Unclassified 1274
458 Ga0501037_0494763 3300049573 Unclassified 830
459 Ga0501037_0599202 3300049573 Bacteria 740
460 Ga0501038_0001571 3300049574 Bacteria 21153
461 Ga0501038_0021382 3300049574 Bacteria 5808
462 Ga0501039_0002091 3300049575 Bacteria 14799
463 Ga0501039_0009797 3300049575 Bacteria 7300
464 Ga0501040_0002120 3300049576 Bacteria 12789
465 Ga0501040_0054979 3300049576 Bacteria 2729
466 Ga0501040_0056672 3300049576 Bacteria 2689
467 Ga0501040_0292948 3300049576 Bacteria 1163
468 Ga0501040_0305759 3300049576 Unclassified 1137
469 Ga0501041_0003887 3300049577 Bacteria 8604
470 Ga0501041_0007898 3300049577 Bacteria 6253
471 Ga0501041_0011813 3300049577 Bacteria 5169
472 Ga0501041_0191368 3300049577 Unclassified 1282
473 Ga0501042_0028745 3300049578 Bacteria 3921
474 Ga0501042_0030365 3300049578 Bacteria 3815
475 Ga0501042_0032557 3300049578 Bacteria 3692
476 Ga0501042_0060756 3300049578 Bacteria 2699
477 Ga0501042_0253710 3300049578 Unclassified 1269
478 Ga0501042_0364346 3300049578 Bacteria 1046
479 Ga0501043_0005959 3300049579 Bacteria 9801
480 Ga0501043_0025507 3300049579 Bacteria 4639
481 Ga0501043_0167036 3300049579 Bacteria 1718
482 Ga0501046_0002584 3300049580 Bacteria 16929
483 Ga0501046_0015641 3300049580 Bacteria 6370
484 Ga0501046_0154290 3300049580 Bacteria 1731
485 Ga0501048_0006745 3300049582 Bacteria 8721
486 Ga0501048_0026491 3300049582 Bacteria 4221
487 Ga0501048_0064459 3300049582 Unclassified 2591
488 Ga0501067_0088445 3300049583 Unclassified 1719
489 Ga0501068_0005960 3300049584 Bacteria 6688
490 Ga0501068_0408555 3300049584 Archaea 876
491 Ga0501069_0029156 3300049585 Bacteria 3029
492 Ga0501069_0094687 3300049585 Bacteria 1690
493 Ga0501069_0130410 3300049585 Bacteria 1439
494 Ga0501070_0000120 3300049586 Bacteria 70354
495 Ga0501070_0002915 3300049586 Bacteria 14886
496 Ga0501070_0051603 3300049586 Bacteria 3414
497 Ga0501071_0000414 3300049587 Bacteria 21222
498 Ga0501071_0003032 3300049587 Bacteria 10397
499 Ga0501071_0130348 3300049587 Bacteria 1867
500 Ga0501072_0001365 3300049588 Bacteria 18321
501 Ga0501072_0009765 3300049588 Bacteria 7296
502 Ga0501072_0107570 3300049588 Unclassified 2218
503 Ga0501072_0223035 3300049588 Bacteria 1502
504 Ga0501073_0018572 3300049589 Bacteria 5027
505 Ga0501073_0204903 3300049589 Unclassified 1363
506 Ga0501074_0002927 3300049590 Bacteria 11991
507 Ga0501074_0038589 3300049590 Bacteria 3460
508 Ga0501074_0330103 3300049590 Bacteria 1083
509 Ga0501075_0002893 3300049591 Bacteria 11524
510 Ga0501075_0020421 3300049591 Bacteria 4819
511 Ga0501075_0039101 3300049591 Bacteria 3549
512 Ga0501075_0256987 3300049591 Unclassified 1331
513 Ga0501076_0006761 3300049592 Bacteria 8324
514 Ga0501076_0012750 3300049592 Bacteria 6292
515 Ga0501076_0098170 3300049592 Unclassified 2359
516 Ga0501076_0231164 3300049592 Unclassified 1512
517 Ga0501076_0748482 3300049592 Bacteria 806
518 Ga0501077_0011600 3300049593 Bacteria 5507
519 Ga0501077_0029318 3300049593 Bacteria 3499
520 Ga0501077_0143327 3300049593 Bacteria 1516
521 Ga0501079_0002478 3300049741 Bacteria 13412
522 Ga0501079_0011437 3300049741 Bacteria 6773
523 Ga0501079_0025257 3300049741 Bacteria 4557
524 Ga0501079_0069678 3300049741 Bacteria 2715
525 Ga0501080_0007444 3300049742 Bacteria 9882
526 Ga0501080_0034154 3300049742 Bacteria 4747
527 Ga0501080_0073395 3300049742 Bacteria 3183
528 Ga0501080_0248820 3300049742 Bacteria 1621
529 Ga0501080_0912662 3300049742 Bacteria 765
530 Ga0501081_0050953 3300049743 Bacteria 2853
531 Ga0501081_0061715 3300049743 Bacteria 2599
532 Ga0501081_0129018 3300049743 Unclassified 1805
533 Ga0501081_0210703 3300049743 Unclassified 1411
534 Ga0501081_0220198 3300049743 Bacteria 1380
535 Ga0501081_0449192 3300049743 Unclassified 958
536 Ga0501083_0010096 3300049744 Bacteria 6654
537 Ga0501083_0291409 3300049744 Bacteria 1062
538 Ga0501035_0012324 3300049822 Bacteria 7905
539 Ga0501035_0022011 3300049822 Bacteria 5856
540 Ga0501035_0140958 3300049822 Bacteria 2096
541 Ga0501035_0948239 3300049822 Bacteria 679
542 Ga0501044_0166602 3300049823 Unclassified 2177
543 Ga0501044_0321805 3300049823 Bacteria 1471
544 Ga0501045_0009547 3300049824 Bacteria 6788
545 Ga0501045_0018097 3300049824 Bacteria 5006
546 Ga0501045_0018428 3300049824 Bacteria 4965
547 Ga0501045_0265140 3300049824 Unclassified 1279
548 nmdc:mga00v17_256896_c1 3300050491 Unclassified 1133
549 nmdc:mga05p37_1501496_c1 3300050507 Bacteria 671
550 nmdc:mga05p37_25240_c1 3300050507 Bacteria 7227
551 nmdc:mga05p37_401825_c1 3300050507 Unclassified 1599
552 nmdc:mga05p37_826005_c1 3300050507 Unclassified 1010
553 nmdc:mga0qj67_400477_c1 3300050509 Unclassified 1108
554 nmdc:mga08y16_1024140_c1 3300050511 Bacteria 804
555 nmdc:mga08y16_1400394_c1 3300050511 Unclassified 662
556 nmdc:mga0n895_138690_c1 3300050512 Bacteria 2459
557 nmdc:mga0n895_330352_c1 3300050512 Bacteria 1545
558 nmdc:mga0n895_63477_c1 3300050512 Bacteria 3652
559 nmdc:mga0n895_72879_c1 3300050512 Bacteria 3408
560 nmdc:mga0rr50_323423_c1 3300050513 Bacteria 1293
561 nmdc:mga0rr50_9029_c1 3300050513 Bacteria 6238
562 nmdc:mga08x19_37067_c1 3300050514 Bacteria 3093
563 nmdc:mga0a205_698001_c1 3300050515 Bacteria 865
564 Ga0495601_0020622 3300053077 Bacteria 4027
565 Ga0495595_0037523 3300053084 Bacteria 2204
566 Ga0495595_0069357 3300053084 Unclassified 1664
567 Ga0495595_0108582 3300053084 Unclassified 1344
568 Ga0501084_0010243 3300054114 Bacteria 7756
569 Ga0501084_0012731 3300054114 Bacteria 6968
570 Ga0501084_0097492 3300054114 Bacteria 2468
571 Ga0501084_0137964 3300054114 Bacteria 2053
572 Ga0501084_0896898 3300054114 Unclassified 746
573 Ga0590075_014794 3300059424 Bacteria 1909
574 Ga0590077_024222 3300059426 Bacteria 1303
575 Ga0501082_0020059 3300060353 Bacteria 5760
576 Ga0501082_1090957 3300060353 Bacteria 698
577 Ga0530510_0011496 3300061734 Bacteria 6209
578 Ga0530510_0041729 3300061734 Bacteria 3313
579 Ga0530510_0223890 3300061734 Unclassified 1398
580 Ga0105240_11393996
581 JGI25406J46586_10123306
582 JGI25407J50210_10000558
583 JGI25407J50210_10002575
584 Ga0070683_100000847
585 Ga0070683_100350681
586 Ga0070690_100242727
587 Ga0070680_100168574
588 Ga0070680_100184275
589 Ga0070682_100011136
590 Ga0070682_100201612
591 Ga0068868_100191865
592 Ga0070668_100222363
593 Ga0070675_100383073
594 Ga0070675_100434057
595 Ga0070671_100166301
596 Ga0070674_100236222
597 Ga0070673_100186275
598 Ga0070673_100676018
599 Ga0070709_10003775
600 Ga0070709_10157154
601 Ga0070709_10416561
602 Ga0070714_100154041
603 Ga0070714_100778346
604 Ga0070713_100092226
605 Ga0070713_100308043
606 Ga0070713_100715640
607 Ga0070710_10037789
608 Ga0070710_10049672
609 Ga0070710_10127747
610 Ga0070711_100004058
611 Ga0070711_100006624
612 Ga0070705_100014332
613 Ga0070705_100019118
614 Ga0070705_100239943
615 Ga0070708_100069324
616 Ga0070708_100215208
617 Ga0070708_100313567
618 Ga0070708_100715432
619 Ga0070663_100045996
620 Ga0070678_100008832
621 Ga0070678_100781366
622 Ga0070662_100612338
623 Ga0070681_10006968
624 Ga0070681_10569463
625 Ga0070706_100270597
626 Ga0070706_100544380
627 Ga0070707_100043192
628 Ga0070707_101006173
629 Ga0070698_100054760
630 Ga0070698_100068618
631 Ga0070698_100597735
632 Ga0070699_100048280
633 Ga0070699_100073037
634 Ga0070699_100169785
635 Ga0070679_100007549
636 Ga0070684_100292932
637 Ga0070697_100346320
638 Ga0070672_100246151
639 Ga0070686_100113958
640 Ga0070686_100285420
641 Ga0070695_100061638
642 Ga0070695_100105118
643 Ga0070695_100106932
644 Ga0070696_100005071
645 Ga0070696_100080784
646 Ga0070693_100001104
647 Ga0070693_100194354
648 Ga0070693_100231979
649 Ga0070665_100280194
650 Ga0070704_100035670
651 Ga0070704_100047407
652 Ga0070704_100144467
653 Ga0070704_100233245
654 Ga0070664_100202659
655 Ga0070664_100281070
656 Ga0068854_100183195
657 Ga0068854_100379130
658 Ga0068856_100052276
659 Ga0068856_100675154
660 Ga0070702_100025736
661 Ga0068861_100099992
662 Ga0068870_10152071
663 Ga0068858_100445246
664 Ga0068860_100347248
665 Ga0068862_100132412
666 Ga0081455_10194130
667 Ga0081538_10000795
668 Ga0081538_10002124
669 Ga0081538_10038054
670 Ga0070717_10355700
671 Ga0075365_10263632
672 Ga0075364_10056662
673 Ga0075432_10096770
674 Ga0070715_10014187
675 Ga0070715_10043057
676 Ga0070716_100029701
677 Ga0070716_100049090
678 Ga0070716_100193269
679 Ga0070712_100031111
680 Ga0070712_100148023
681 Ga0075362_10020822
682 Ga0097621_100046478
683 Ga0068871_100033893
684 Ga0068871_100178460
685 Ga0068871_100267557
686 Ga0075433_10247331
687 Ga0075434_100172501
688 Ga0075434_100627108
689 Ga0075435_100161170
690 Ga0075435_100689564
691 Ga0105250_10034779
692 Ga0111539_10950713
693 Ga0105245_10013369
694 Ga0105245_10029890
695 Ga0105245_10169437
696 Ga0114129_10172289
697 Ga0114129_10224454
698 Ga0114129_10567297
699 Ga0114129_11001394
700 Ga0114129_11203286
701 Ga0105243_10074878
702 Ga0105243_10181009
703 Ga0105243_10275406
704 Ga0105243_11192513
705 Ga0105241_10101988
706 Ga0105242_10169826
707 Ga0105242_10567352
708 Ga0105248_11055246
709 Ga0105248_11628587
710 Ga0105249_10268335
711 Ga0105249_10338647
712 Ga0105239_10439909
713 Ga0105239_10441711
714 Ga0157369_11069408
715 Ga0157374_10415199
716 Ga0157378_10434999
717 Ga0163162_10290832
718 Ga0157375_10248758
719 Ga0157375_10420132
720 Ga0157375_10624641
721 Ga0163163_10546991
722 Ga0163163_10628096
723 Ga0182008_10187055
724 Ga0157377_10436483
725 Ga0157379_10443606
726 Ga0157376_10044679
727 Ga0163161_10100613
728 Ga0207653_10012387
729 Ga0207692_10243289
730 Ga0207642_10275000
731 Ga0207688_10136879
732 Ga0207685_10061628
733 Ga0207685_10071081
734 Ga0207699_10043456
735 Ga0207699_10204668
736 Ga0207643_10308784
737 Ga0207684_10115351
738 Ga0207684_10245661
739 Ga0207684_10460274
740 Ga0207684_10500462
741 Ga0207654_10055600
742 Ga0207654_10218917
743 Ga0207707_10002713
744 Ga0207707_10668541
745 Ga0207693_10009780
746 Ga0207693_10195778
747 Ga0207693_10343024
748 Ga0207663_10000759
749 Ga0207663_10006071
750 Ga0207663_10028497
751 Ga0207663_10139994
752 Ga0207660_10153174
753 Ga0207660_10538573
754 Ga0207657_10086419
755 Ga0207652_10004552
756 Ga0207646_10071904
757 Ga0207646_10202468
758 Ga0207646_10244136
759 Ga0207646_10522100
760 Ga0207687_10007156
761 Ga0207700_10154190
762 Ga0207700_10265791
763 Ga0207700_10335410
764 Ga0207664_10058991
765 Ga0207664_10087047
766 Ga0207664_10091786
767 Ga0207664_11003684
768 Ga0207644_10582518
769 Ga0207706_10045395
770 Ga0207686_10089458
771 Ga0207709_10366877
772 Ga0207709_10703547
773 Ga0207709_11161689
774 Ga0207704_10358430
775 Ga0207704_10417499
776 Ga0207665_10020035
777 Ga0207711_10146225
778 Ga0207661_10000646
779 Ga0207679_10015107
780 Ga0207679_10438173
781 Ga0207667_10416845
782 Ga0207651_10332531
783 Ga0207651_10518331
784 Ga0207651_10557679
785 Ga0207712_10712430
786 Ga0207640_10189830
787 Ga0207677_10068319
788 Ga0207677_10279439
789 Ga0207703_10700798
790 Ga0207678_10030538
791 Ga0207678_10832065
792 Ga0207702_10003702
793 Ga0207702_10028451
794 Ga0207702_10227422
795 Ga0207702_10848479
796 Ga0207648_10546175
797 Ga0207676_10295178
798 Ga0207675_100117980
799 Ga0207675_100579594
800 Ga0207683_10000973
801 Ga0207683_10006616
802 Ga0207683_10011336
803 Ga0207683_10399984
804 Ga0207428_10096496
805 Ga0207428_10718645
806 Ga0268266_10204430
807 Ga0268264_10633951
808 Ga0265318_10025664
809 Ga0307408_100392134
810 Ga0307408_100408085
811 Ga0307416_100120663
812 Ga0307416_100576365
813 Ga0307415_100044855
814 Ga0373930_0003902
815 Ga0373930_0077803
816 Ga0373948_0006074
817 Ga0373950_0029304
818 Ga0373959_0020113
819 Ga0373928_0004514
820 Ga0373928_0017321
821 Ga0373929_0001468
822 Ga0373929_0037870
823 Ga0373940_0001916
824 Ga0373949_0002441
825 Ga0373951_0005321
826 Ga0373952_0002355
827 Ga0373932_0001300
828 Ga0373932_0007554
829 Ga0373939_0002372
830 Ga0373941_0038151
831 Ga0373960_0000715
832 Ga0373960_0253418
833 Ga0373942_0003602
834 Ga0373942_0006440
835 Ga0373961_0053754
836 Ga0373962_0002061
837 Ga0373962_0029589
838 Ga0373931_0005421
839 Ga0373931_0067938
840 Ga0373935_0248134
841 Ga0373947_0078060
842 Ga0373947_0578427
843 Ga0373937_0100142
844 Ga0395899_0001360
845 Ga0395899_0003797
846 Ga0395899_0079183
847 Ga0395900_0005085
848 Ga0395900_0023734
849 Ga0395900_0258504
850 Ga0395900_0766618
851 Ga0395900_0789907
852 Ga0395898_0001821
853 Ga0395898_0018646
854 Ga0395898_0142037
855 Ga0395898_0398249
856 Ga0395905_0010094
857 Ga0395905_0119176
858 Ga0395901_0017741
859 Ga0395901_0156973
860 Ga0395901_0537324
861 Ga0395901_0717977
862 Ga0439438_020982
863 Ga0439453_0002538
864 Ga0439453_0021252
865 Ga0439466_0048203
866 Ga0451804_0596926
867 Ga0439437_005060
868 Ga0439441_031994
869 Ga0439432_083569
870 Ga0439451_003682
871 Ga0439454_003464
872 Ga0439463_097486
873 Ga0450911_021476
874 Ga0450920_008032
875 Ga0450920_055153
876 Ga0450888_017132
877 Ga0450907_003474
878 Ga0439446_0005137
879 Ga0439446_0008264
880 Ga0450908_017564
881 Ga0439434_0014300
882 Ga0439434_0021814
883 Ga0439435_0173269
884 Ga0439460_0039285
885 Ga0450918_020780
886 Ga0466963_0273219
887 Ga0466963_0413209
888 Ga0466960_0195015
889 Ga0466960_0215701
890 Ga0466960_0431063
891 Ga0466960_0435677
892 Ga0451576_0393312
893 Ga0466967_0209510
894 Ga0466967_0488386
895 Ga0466967_0539426
896 Ga0495592_0086913
897 Ga0495592_0145073
898 Ga0495592_0147156
899 Ga0495603_0016440
900 Ga0495629_0067627
901 Ga0495641_0023734
902 Ga0495641_0114757
903 Ga0495651_0505525
904 Ga0495582_0030606
905 Ga0495582_0048492
906 Ga0495639_0192498
907 Ga0495584_0138615
908 Ga0495585_0154049
909 Ga0495618_0049395
910 Ga0495628_0181063
911 Ga0495630_0132966
912 Ga0495630_0784849
913 Ga0495644_0231141
914 Ga0495642_0265416
915 Ga0495640_0151660
916 Ga0495656_0035911
917 Ga0495656_0086831
918 Ga0495634_0028584
919 Ga0495634_0146854
920 Ga0495634_0199571
921 Ga0495635_0022595
922 Ga0495635_0439854
923 Ga0495646_0278609
924 Ga0495647_0064785
925 Ga0495658_0046842
926 Ga0495658_0184882
927 Ga0495613_0012667
928 Ga0495613_0034717
929 Ga0495613_0054777
930 Ga0495624_0399836
931 Ga0495670_0111368
932 Ga0495589_0123844
933 Ga0495636_0158815
934 Ga0495674_0009669
935 Ga0495676_0039647
936 Ga0495680_0006974
937 Ga0495680_0250559
938 Ga0495593_0073026
939 Ga0495614_0336565
940 Ga0496100_0004055
941 Ga0496100_0004272
942 Ga0496100_0105917
943 Ga0496100_0112827
944 Ga0496100_0258933
945 Ga0496100_0283393
946 Ga0496101_0005189
947 Ga0496101_0011585
948 Ga0496101_0161987
949 Ga0496101_0319375
950 Ga0496101_0464275
951 Ga0496102_0013185
952 Ga0496102_0026180
953 Ga0496102_0030900
954 Ga0496102_0032076
955 Ga0496102_0345814
956 Ga0496103_0009699
957 Ga0496103_0017597
958 Ga0496104_0004621
959 Ga0496104_0008731
960 Ga0496104_0062358
961 Ga0496104_0152907
962 Ga0496104_0261828
963 Ga0496104_0437471
964 Ga0496105_0000147
965 Ga0496105_0004406
966 Ga0496105_0005089
967 Ga0496105_0087608
968 Ga0496105_0198082
969 Ga0496105_0613133
970 Ga0496106_0017396
971 Ga0496106_0122820
972 Ga0496106_0148568
973 Ga0496106_0216321
974 Ga0496107_0008894
975 Ga0496107_0017744
976 Ga0496108_0005536
977 Ga0496108_0009368
978 Ga0496108_0128071
979 Ga0496108_0150193
980 Ga0496108_0308697
981 Ga0496108_0638209
982 Ga0496108_0832524
983 Ga0496109_0011770
984 Ga0496109_0014652
985 Ga0496109_0046116
986 Ga0496109_0047300
987 Ga0496109_0219172
988 Ga0496109_0223615
989 Ga0496109_0264327
990 Ga0496109_0521503
991 Ga0496109_0539969
992 Ga0496109_1336833
993 Ga0496110_0003225
994 Ga0496110_0004408
995 Ga0496110_0110959
996 Ga0496110_0117309
997 Ga0496110_0118439
998 Ga0496110_0220301
999 Ga0496110_0250292
1000 Ga0496110_0277206
1001 Ga0496110_0319114
1002 Ga0496110_0323382
1003 Ga0496110_0396538
1004 Ga0496110_0414540
1005 Ga0496111_0022064
1006 Ga0496111_0314571
1007 Ga0496111_0606783
1008 Ga0496112_0000273
1009 Ga0496112_0026858
1010 Ga0496112_0046366
1011 Ga0496112_0091236
1012 Ga0496112_0334395
1013 Ga0496112_0491808
1014 Ga0496113_0012649
1015 Ga0496113_0197329
1016 Ga0496113_0410685
1017 Ga0496114_0011069
1018 Ga0496114_0029854
1019 Ga0496114_0053753
1020 Ga0496114_0455429
1021 Ga0496115_0008795
1022 Ga0501031_0002709
1023 Ga0501031_0005329
1024 Ga0501031_0056099
1025 Ga0501031_0336062
1026 Ga0501032_0024296
1027 Ga0501032_0100615
1028 Ga0501033_0004060
1029 Ga0501033_0059105
1030 Ga0501034_0337678
1031 Ga0501034_0598129
1032 Ga0501036_0014212
1033 Ga0501036_0102222
1034 Ga0501036_0111605
1035 Ga0501037_0012038
1036 Ga0501037_0238868
1037 Ga0501037_0494763
1038 Ga0501037_0599202
1039 Ga0501038_0001571
1040 Ga0501038_0021382
1041 Ga0501039_0002091
1042 Ga0501039_0009797
1043 Ga0501040_0002120
1044 Ga0501040_0054979
1045 Ga0501040_0056672
1046 Ga0501040_0292948
1047 Ga0501040_0305759
1048 Ga0501041_0003887
1049 Ga0501041_0007898
1050 Ga0501041_0011813
1051 Ga0501041_0191368
1052 Ga0501042_0028745
1053 Ga0501042_0030365
1054 Ga0501042_0032557
1055 Ga0501042_0060756
1056 Ga0501042_0253710
1057 Ga0501042_0364346
1058 Ga0501043_0005959
1059 Ga0501043_0025507
1060 Ga0501043_0167036
1061 Ga0501046_0002584
1062 Ga0501046_0015641
1063 Ga0501046_0154290
1064 Ga0501048_0006745
1065 Ga0501048_0026491
1066 Ga0501048_0064459
1067 Ga0501067_0088445
1068 Ga0501068_0005960
1069 Ga0501068_0408555
1070 Ga0501069_0029156
1071 Ga0501069_0094687
1072 Ga0501069_0130410
1073 Ga0501070_0000120
1074 Ga0501070_0002915
1075 Ga0501070_0051603
1076 Ga0501071_0000414
1077 Ga0501071_0003032
1078 Ga0501071_0130348
1079 Ga0501072_0001365
1080 Ga0501072_0009765
1081 Ga0501072_0107570
1082 Ga0501072_0223035
1083 Ga0501073_0018572
1084 Ga0501073_0204903
1085 Ga0501074_0002927
1086 Ga0501074_0038589
1087 Ga0501074_0330103
1088 Ga0501075_0002893
1089 Ga0501075_0020421
1090 Ga0501075_0039101
1091 Ga0501075_0256987
1092 Ga0501076_0006761
1093 Ga0501076_0012750
1094 Ga0501076_0098170
1095 Ga0501076_0231164
1096 Ga0501076_0748482
1097 Ga0501077_0011600
1098 Ga0501077_0029318
1099 Ga0501077_0143327
1100 Ga0501079_0002478
1101 Ga0501079_0011437
1102 Ga0501079_0025257
1103 Ga0501079_0069678
1104 Ga0501080_0007444
1105 Ga0501080_0034154
1106 Ga0501080_0073395
1107 Ga0501080_0248820
1108 Ga0501080_0912662
1109 Ga0501081_0050953
1110 Ga0501081_0061715
1111 Ga0501081_0129018
1112 Ga0501081_0210703
1113 Ga0501081_0220198
1114 Ga0501081_0449192
1115 Ga0501083_0010096
1116 Ga0501083_0291409
1117 Ga0501035_0012324
1118 Ga0501035_0022011
1119 Ga0501035_0140958
1120 Ga0501035_0948239
1121 Ga0501044_0166602
1122 Ga0501044_0321805
1123 Ga0501045_0009547
1124 Ga0501045_0018097
1125 Ga0501045_0018428
1126 Ga0501045_0265140
1127 nmdc:mga00v17_256896_c1
1128 nmdc:mga05p37_1501496_c1
1129 nmdc:mga05p37_25240_c1
1130 nmdc:mga05p37_401825_c1
1131 nmdc:mga05p37_826005_c1
1132 nmdc:mga0qj67_400477_c1
1133 nmdc:mga08y16_1024140_c1
1134 nmdc:mga08y16_1400394_c1
1135 nmdc:mga0n895_138690_c1
1136 nmdc:mga0n895_330352_c1
1137 nmdc:mga0n895_63477_c1
1138 nmdc:mga0n895_72879_c1
1139 nmdc:mga0rr50_323423_c1
1140 nmdc:mga0rr50_9029_c1
1141 nmdc:mga08x19_37067_c1
1142 nmdc:mga0a205_698001_c1
1143 Ga0495601_0020622
1144 Ga0495595_0037523
1145 Ga0495595_0069357
1146 Ga0495595_0108582
1147 Ga0501084_0010243
1148 Ga0501084_0012731
1149 Ga0501084_0097492
1150 Ga0501084_0137964
1151 Ga0501084_0896898
1152 Ga0590075_014794
1153 Ga0590077_024222
1154 Ga0501082_0020059
1155 Ga0501082_1090957
1156 Ga0530510_0011496
1157 Ga0530510_0041729
1158 Ga0530510_0223890

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

59

203

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.8175 21 193
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.7966 17 189
8iir-assembly1.cif.gz_A msmudgx h109s/q53a double mutant 0.795 21 192
8iip-assembly1.cif.gz_A complex form of msmudgx h109q mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx h109q 0.7917 21 192
6ail-assembly1.cif.gz_A crystal structure at 1.3 angstroms resolution of a novel udg, udgx, from mycobacterium smegmatis 0.7907 21 193
ID Description Score Start End Superfamily
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8175 21 193 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7984 21 195 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7403 21 193 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7307 21 195 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.669 39 187 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A538DHM3-F1-model_v4 Uracil-DNA glycosylase 0.9839 4 118
AF-A0A7W0Z0J1-F1-model_v4 Uracil-DNA glycosylase 0.9723 4 195 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7W0Z0J1-F1-model_v4 Uracil-DNA glycosylase 0.9673 4 195 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A538DHM3-F1-model_v4 Uracil-DNA glycosylase 0.9671 4 118
AF-A0A7V8XIA1-F1-model_v4 Uracil-DNA glycosylase 0.9641 56 195 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map