F465822
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 274 | 1158 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_11393996|Ga0105240_113939961 |
| Length | 215 |
| Sequence | MGGTGQGKGPLNENLIVAPVTAVPTDEIHEKYLQKAISEINELGDDIARAAGGVSVPVLGSGHPLGDIFLLKHTPQSSEIQEGVAFFGRSGQAVLKSLQRLHVDPMAVYGTNCVKLAEGAADEEGRGWLTRELHIVGPKVVVPMGEDARTFLNDIEFPLSQPVEPTLGELQRFTPTIQALYVPDIDESLDEAPAKTKFWNAFKALGPWWAELPPY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 132 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 133 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 134 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 137 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 141 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 158 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 159 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 160 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 161 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 162 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 163 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 164 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 165 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 166 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 167 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 168 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 169 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 170 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 171 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 172 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 173 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 174 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 175 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 176 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 179 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 272 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.69 |
| Nodule | 0 |
| Rhizoplane | 14.34 |
| Rhizosphere | 84.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_11393996 | 3300009093 | Unclassified | 737 |
| 2 | JGI25406J46586_10123306 | 3300003203 | Bacteria | 762 |
| 3 | JGI25407J50210_10000558 | 3300003373 | Bacteria | 7479 |
| 4 | JGI25407J50210_10002575 | 3300003373 | Bacteria | 4289 |
| 5 | Ga0070683_100000847 | 3300005329 | Bacteria | 22661 |
| 6 | Ga0070683_100350681 | 3300005329 | Bacteria | 1405 |
| 7 | Ga0070690_100242727 | 3300005330 | Bacteria | 1271 |
| 8 | Ga0070680_100168574 | 3300005336 | Bacteria | 1842 |
| 9 | Ga0070680_100184275 | 3300005336 | Bacteria | 1758 |
| 10 | Ga0070682_100011136 | 3300005337 | Bacteria | 5132 |
| 11 | Ga0070682_100201612 | 3300005337 | Bacteria | 1404 |
| 12 | Ga0068868_100191865 | 3300005338 | Bacteria | 1699 |
| 13 | Ga0070668_100222363 | 3300005347 | Bacteria | 1558 |
| 14 | Ga0070675_100383073 | 3300005354 | Bacteria | 1252 |
| 15 | Ga0070675_100434057 | 3300005354 | Bacteria | 1176 |
| 16 | Ga0070671_100166301 | 3300005355 | Unclassified | 1865 |
| 17 | Ga0070674_100236222 | 3300005356 | Bacteria | 1429 |
| 18 | Ga0070673_100186275 | 3300005364 | Bacteria | 1780 |
| 19 | Ga0070673_100676018 | 3300005364 | Bacteria | 947 |
| 20 | Ga0070709_10003775 | 3300005434 | Bacteria | 8141 |
| 21 | Ga0070709_10157154 | 3300005434 | Unclassified | 1577 |
| 22 | Ga0070709_10416561 | 3300005434 | Bacteria | 1006 |
| 23 | Ga0070714_100154041 | 3300005435 | Unclassified | 2074 |
| 24 | Ga0070714_100778346 | 3300005435 | Bacteria | 926 |
| 25 | Ga0070713_100092226 | 3300005436 | Unclassified | 2607 |
| 26 | Ga0070713_100308043 | 3300005436 | Bacteria | 1460 |
| 27 | Ga0070713_100715640 | 3300005436 | Bacteria | 956 |
| 28 | Ga0070710_10037789 | 3300005437 | Unclassified | 2649 |
| 29 | Ga0070710_10049672 | 3300005437 | Unclassified | 2347 |
| 30 | Ga0070710_10127747 | 3300005437 | Bacteria | 1546 |
| 31 | Ga0070711_100004058 | 3300005439 | Bacteria | 8606 |
| 32 | Ga0070711_100006624 | 3300005439 | Bacteria | 6997 |
| 33 | Ga0070705_100014332 | 3300005440 | Bacteria | 4075 |
| 34 | Ga0070705_100019118 | 3300005440 | Bacteria | 3601 |
| 35 | Ga0070705_100239943 | 3300005440 | Bacteria | 1266 |
| 36 | Ga0070708_100069324 | 3300005445 | Unclassified | 3171 |
| 37 | Ga0070708_100215208 | 3300005445 | Unclassified | 1801 |
| 38 | Ga0070708_100313567 | 3300005445 | Bacteria | 1477 |
| 39 | Ga0070708_100715432 | 3300005445 | Unclassified | 942 |
| 40 | Ga0070663_100045996 | 3300005455 | Bacteria | 3086 |
| 41 | Ga0070678_100008832 | 3300005456 | Bacteria | 6061 |
| 42 | Ga0070678_100781366 | 3300005456 | Bacteria | 866 |
| 43 | Ga0070662_100612338 | 3300005457 | Bacteria | 917 |
| 44 | Ga0070681_10006968 | 3300005458 | Bacteria | 10999 |
| 45 | Ga0070681_10569463 | 3300005458 | Bacteria | 1046 |
| 46 | Ga0070706_100270597 | 3300005467 | Bacteria | 1585 |
| 47 | Ga0070706_100544380 | 3300005467 | Unclassified | 1080 |
| 48 | Ga0070707_100043192 | 3300005468 | Bacteria | 4315 |
| 49 | Ga0070707_101006173 | 3300005468 | Bacteria | 799 |
| 50 | Ga0070698_100054760 | 3300005471 | Bacteria | 4049 |
| 51 | Ga0070698_100068618 | 3300005471 | Bacteria | 3562 |
| 52 | Ga0070698_100597735 | 3300005471 | Unclassified | 1044 |
| 53 | Ga0070699_100048280 | 3300005518 | Bacteria | 3683 |
| 54 | Ga0070699_100073037 | 3300005518 | Bacteria | 2984 |
| 55 | Ga0070699_100169785 | 3300005518 | Unclassified | 1932 |
| 56 | Ga0070679_100007549 | 3300005530 | Bacteria | 10170 |
| 57 | Ga0070684_100292932 | 3300005535 | Bacteria | 1492 |
| 58 | Ga0070697_100346320 | 3300005536 | Unclassified | 1283 |
| 59 | Ga0070672_100246151 | 3300005543 | Bacteria | 1505 |
| 60 | Ga0070686_100113958 | 3300005544 | Bacteria | 1847 |
| 61 | Ga0070686_100285420 | 3300005544 | Unclassified | 1219 |
| 62 | Ga0070695_100061638 | 3300005545 | Bacteria | 2434 |
| 63 | Ga0070695_100105118 | 3300005545 | Bacteria | 1907 |
| 64 | Ga0070695_100106932 | 3300005545 | Unclassified | 1892 |
| 65 | Ga0070696_100005071 | 3300005546 | Bacteria | 8798 |
| 66 | Ga0070696_100080784 | 3300005546 | Unclassified | 2302 |
| 67 | Ga0070693_100001104 | 3300005547 | Bacteria | 12119 |
| 68 | Ga0070693_100194354 | 3300005547 | Unclassified | 1314 |
| 69 | Ga0070693_100231979 | 3300005547 | Bacteria | 1215 |
| 70 | Ga0070665_100280194 | 3300005548 | Bacteria | 1669 |
| 71 | Ga0070704_100035670 | 3300005549 | Bacteria | 3383 |
| 72 | Ga0070704_100047407 | 3300005549 | Bacteria | 3003 |
| 73 | Ga0070704_100144467 | 3300005549 | Bacteria | 1862 |
| 74 | Ga0070704_100233245 | 3300005549 | Bacteria | 1502 |
| 75 | Ga0070664_100202659 | 3300005564 | Bacteria | 1771 |
| 76 | Ga0070664_100281070 | 3300005564 | Bacteria | 1501 |
| 77 | Ga0068854_100183195 | 3300005578 | Bacteria | 1637 |
| 78 | Ga0068854_100379130 | 3300005578 | Bacteria | 1165 |
| 79 | Ga0068856_100052276 | 3300005614 | Bacteria | 4029 |
| 80 | Ga0068856_100675154 | 3300005614 | Bacteria | 1054 |
| 81 | Ga0070702_100025736 | 3300005615 | Unclassified | 3156 |
| 82 | Ga0068861_100099992 | 3300005719 | Bacteria | 2304 |
| 83 | Ga0068870_10152071 | 3300005840 | Bacteria | 1364 |
| 84 | Ga0068858_100445246 | 3300005842 | Bacteria | 1248 |
| 85 | Ga0068860_100347248 | 3300005843 | Bacteria | 1460 |
| 86 | Ga0068862_100132412 | 3300005844 | Bacteria | 2206 |
| 87 | Ga0081455_10194130 | 3300005937 | Unclassified | 1526 |
| 88 | Ga0081538_10000795 | 3300005981 | Bacteria | 34267 |
| 89 | Ga0081538_10002124 | 3300005981 | Bacteria | 19751 |
| 90 | Ga0081538_10038054 | 3300005981 | Bacteria | 3110 |
| 91 | Ga0070717_10355700 | 3300006028 | Bacteria | 1310 |
| 92 | Ga0075365_10263632 | 3300006038 | Unclassified | 1211 |
| 93 | Ga0075364_10056662 | 3300006051 | Unclassified | 2566 |
| 94 | Ga0075432_10096770 | 3300006058 | Unclassified | 1086 |
| 95 | Ga0070715_10014187 | 3300006163 | Unclassified | 2945 |
| 96 | Ga0070715_10043057 | 3300006163 | Unclassified | 1901 |
| 97 | Ga0070716_100029701 | 3300006173 | Unclassified | 2958 |
| 98 | Ga0070716_100049090 | 3300006173 | Unclassified | 2389 |
| 99 | Ga0070716_100193269 | 3300006173 | Unclassified | 1346 |
| 100 | Ga0070712_100031111 | 3300006175 | Bacteria | 3593 |
| 101 | Ga0070712_100148023 | 3300006175 | Unclassified | 1799 |
| 102 | Ga0075362_10020822 | 3300006177 | Unclassified | 2744 |
| 103 | Ga0097621_100046478 | 3300006237 | Bacteria | 3512 |
| 104 | Ga0068871_100033893 | 3300006358 | Bacteria | 4046 |
| 105 | Ga0068871_100178460 | 3300006358 | Bacteria | 1824 |
| 106 | Ga0068871_100267557 | 3300006358 | Bacteria | 1493 |
| 107 | Ga0075433_10247331 | 3300006852 | Bacteria | 1582 |
| 108 | Ga0075434_100172501 | 3300006871 | Unclassified | 2183 |
| 109 | Ga0075434_100627108 | 3300006871 | Bacteria | 1094 |
| 110 | Ga0075435_100161170 | 3300007076 | Unclassified | 1889 |
| 111 | Ga0075435_100689564 | 3300007076 | Bacteria | 887 |
| 112 | Ga0105250_10034779 | 3300009092 | Bacteria | 2021 |
| 113 | Ga0111539_10950713 | 3300009094 | Bacteria | 999 |
| 114 | Ga0105245_10013369 | 3300009098 | Bacteria | 7155 |
| 115 | Ga0105245_10029890 | 3300009098 | Bacteria | 4817 |
| 116 | Ga0105245_10169437 | 3300009098 | Bacteria | 2078 |
| 117 | Ga0114129_10172289 | 3300009147 | Bacteria | 2949 |
| 118 | Ga0114129_10224454 | 3300009147 | Bacteria | 2533 |
| 119 | Ga0114129_10567297 | 3300009147 | Unclassified | 1474 |
| 120 | Ga0114129_11001394 | 3300009147 | Bacteria | 1052 |
| 121 | Ga0114129_11203286 | 3300009147 | Bacteria | 944 |
| 122 | Ga0105243_10074878 | 3300009148 | Bacteria | 2747 |
| 123 | Ga0105243_10181009 | 3300009148 | Bacteria | 1833 |
| 124 | Ga0105243_10275406 | 3300009148 | Bacteria | 1513 |
| 125 | Ga0105243_11192513 | 3300009148 | Bacteria | 774 |
| 126 | Ga0105241_10101988 | 3300009174 | Archaea | 2283 |
| 127 | Ga0105242_10169826 | 3300009176 | Bacteria | 1916 |
| 128 | Ga0105242_10567352 | 3300009176 | Bacteria | 1091 |
| 129 | Ga0105248_11055246 | 3300009177 | Bacteria | 918 |
| 130 | Ga0105248_11628587 | 3300009177 | Unclassified | 731 |
| 131 | Ga0105249_10268335 | 3300009553 | Bacteria | 1699 |
| 132 | Ga0105249_10338647 | 3300009553 | Bacteria | 1520 |
| 133 | Ga0105239_10439909 | 3300010375 | Unclassified | 1478 |
| 134 | Ga0105239_10441711 | 3300010375 | Unclassified | 1475 |
| 135 | Ga0157369_11069408 | 3300013105 | Unclassified | 825 |
| 136 | Ga0157374_10415199 | 3300013296 | Bacteria | 1344 |
| 137 | Ga0157378_10434999 | 3300013297 | Unclassified | 1299 |
| 138 | Ga0163162_10290832 | 3300013306 | Bacteria | 1766 |
| 139 | Ga0157375_10248758 | 3300013308 | Unclassified | 1938 |
| 140 | Ga0157375_10420132 | 3300013308 | Bacteria | 1503 |
| 141 | Ga0157375_10624641 | 3300013308 | Unclassified | 1235 |
| 142 | Ga0163163_10546991 | 3300014325 | Unclassified | 1220 |
| 143 | Ga0163163_10628096 | 3300014325 | Bacteria | 1138 |
| 144 | Ga0182008_10187055 | 3300014497 | Unclassified | 1050 |
| 145 | Ga0157377_10436483 | 3300014745 | Bacteria | 901 |
| 146 | Ga0157379_10443606 | 3300014968 | Unclassified | 1197 |
| 147 | Ga0157376_10044679 | 3300014969 | Bacteria | 3643 |
| 148 | Ga0163161_10100613 | 3300017792 | Bacteria | 2151 |
| 149 | Ga0207653_10012387 | 3300025885 | Unclassified | 2663 |
| 150 | Ga0207692_10243289 | 3300025898 | Bacteria | 1075 |
| 151 | Ga0207642_10275000 | 3300025899 | Bacteria | 966 |
| 152 | Ga0207688_10136879 | 3300025901 | Bacteria | 1439 |
| 153 | Ga0207685_10061628 | 3300025905 | Unclassified | 1488 |
| 154 | Ga0207685_10071081 | 3300025905 | Unclassified | 1411 |
| 155 | Ga0207699_10043456 | 3300025906 | Unclassified | 2610 |
| 156 | Ga0207699_10204668 | 3300025906 | Bacteria | 1339 |
| 157 | Ga0207643_10308784 | 3300025908 | Bacteria | 986 |
| 158 | Ga0207684_10115351 | 3300025910 | Bacteria | 2301 |
| 159 | Ga0207684_10245661 | 3300025910 | Bacteria | 1544 |
| 160 | Ga0207684_10460274 | 3300025910 | Unclassified | 1092 |
| 161 | Ga0207684_10500462 | 3300025910 | Unclassified | 1042 |
| 162 | Ga0207654_10055600 | 3300025911 | Unclassified | 2292 |
| 163 | Ga0207654_10218917 | 3300025911 | Bacteria | 1262 |
| 164 | Ga0207707_10002713 | 3300025912 | Bacteria | 15814 |
| 165 | Ga0207707_10668541 | 3300025912 | Bacteria | 874 |
| 166 | Ga0207693_10009780 | 3300025915 | Bacteria | 7808 |
| 167 | Ga0207693_10195778 | 3300025915 | Unclassified | 1590 |
| 168 | Ga0207693_10343024 | 3300025915 | Unclassified | 1169 |
| 169 | Ga0207663_10000759 | 3300025916 | Bacteria | 14425 |
| 170 | Ga0207663_10006071 | 3300025916 | Bacteria | 6142 |
| 171 | Ga0207663_10028497 | 3300025916 | Unclassified | 3269 |
| 172 | Ga0207663_10139994 | 3300025916 | Bacteria | 1684 |
| 173 | Ga0207660_10153174 | 3300025917 | Bacteria | 1773 |
| 174 | Ga0207660_10538573 | 3300025917 | Unclassified | 949 |
| 175 | Ga0207657_10086419 | 3300025919 | Bacteria | 2625 |
| 176 | Ga0207652_10004552 | 3300025921 | Bacteria | 11253 |
| 177 | Ga0207646_10071904 | 3300025922 | Bacteria | 3089 |
| 178 | Ga0207646_10202468 | 3300025922 | Bacteria | 1793 |
| 179 | Ga0207646_10244136 | 3300025922 | Bacteria | 1622 |
| 180 | Ga0207646_10522100 | 3300025922 | Unclassified | 1069 |
| 181 | Ga0207687_10007156 | 3300025927 | Bacteria | 7358 |
| 182 | Ga0207700_10154190 | 3300025928 | Unclassified | 1901 |
| 183 | Ga0207700_10265791 | 3300025928 | Bacteria | 1470 |
| 184 | Ga0207700_10335410 | 3300025928 | Bacteria | 1313 |
| 185 | Ga0207664_10058991 | 3300025929 | Bacteria | 3055 |
| 186 | Ga0207664_10087047 | 3300025929 | Unclassified | 2553 |
| 187 | Ga0207664_10091786 | 3300025929 | Unclassified | 2491 |
| 188 | Ga0207664_11003684 | 3300025929 | Unclassified | 748 |
| 189 | Ga0207644_10582518 | 3300025931 | Bacteria | 928 |
| 190 | Ga0207706_10045395 | 3300025933 | Bacteria | 3893 |
| 191 | Ga0207686_10089458 | 3300025934 | Bacteria | 2029 |
| 192 | Ga0207709_10366877 | 3300025935 | Bacteria | 1092 |
| 193 | Ga0207709_10703547 | 3300025935 | Bacteria | 809 |
| 194 | Ga0207709_11161689 | 3300025935 | Unclassified | 635 |
| 195 | Ga0207704_10358430 | 3300025938 | Bacteria | 1138 |
| 196 | Ga0207704_10417499 | 3300025938 | Bacteria | 1063 |
| 197 | Ga0207665_10020035 | 3300025939 | Unclassified | 4393 |
| 198 | Ga0207711_10146225 | 3300025941 | Unclassified | 2130 |
| 199 | Ga0207661_10000646 | 3300025944 | Bacteria | 22497 |
| 200 | Ga0207679_10015107 | 3300025945 | Bacteria | 5093 |
| 201 | Ga0207679_10438173 | 3300025945 | Unclassified | 1157 |
| 202 | Ga0207667_10416845 | 3300025949 | Bacteria | 1366 |
| 203 | Ga0207651_10332531 | 3300025960 | Unclassified | 1274 |
| 204 | Ga0207651_10518331 | 3300025960 | Unclassified | 1033 |
| 205 | Ga0207651_10557679 | 3300025960 | Bacteria | 997 |
| 206 | Ga0207712_10712430 | 3300025961 | Bacteria | 877 |
| 207 | Ga0207640_10189830 | 3300025981 | Bacteria | 1548 |
| 208 | Ga0207677_10068319 | 3300026023 | Bacteria | 2493 |
| 209 | Ga0207677_10279439 | 3300026023 | Bacteria | 1370 |
| 210 | Ga0207703_10700798 | 3300026035 | Bacteria | 963 |
| 211 | Ga0207678_10030538 | 3300026067 | Bacteria | 4703 |
| 212 | Ga0207678_10832065 | 3300026067 | Bacteria | 815 |
| 213 | Ga0207702_10003702 | 3300026078 | Bacteria | 13834 |
| 214 | Ga0207702_10028451 | 3300026078 | Bacteria | 4646 |
| 215 | Ga0207702_10227422 | 3300026078 | Bacteria | 1741 |
| 216 | Ga0207702_10848479 | 3300026078 | Bacteria | 904 |
| 217 | Ga0207648_10546175 | 3300026089 | Bacteria | 1064 |
| 218 | Ga0207676_10295178 | 3300026095 | Unclassified | 1478 |
| 219 | Ga0207675_100117980 | 3300026118 | Bacteria | 2509 |
| 220 | Ga0207675_100579594 | 3300026118 | Bacteria | 1123 |
| 221 | Ga0207683_10000973 | 3300026121 | Bacteria | 26237 |
| 222 | Ga0207683_10006616 | 3300026121 | Bacteria | 9918 |
| 223 | Ga0207683_10011336 | 3300026121 | Bacteria | 7606 |
| 224 | Ga0207683_10399984 | 3300026121 | Bacteria | 1263 |
| 225 | Ga0207428_10096496 | 3300027907 | Unclassified | 2289 |
| 226 | Ga0207428_10718645 | 3300027907 | Unclassified | 714 |
| 227 | Ga0268266_10204430 | 3300028379 | Bacteria | 1809 |
| 228 | Ga0268264_10633951 | 3300028381 | Bacteria | 1056 |
| 229 | Ga0265318_10025664 | 3300028577 | Bacteria | 2325 |
| 230 | Ga0307408_100392134 | 3300031548 | Bacteria | 1190 |
| 231 | Ga0307408_100408085 | 3300031548 | Bacteria | 1168 |
| 232 | Ga0307416_100120663 | 3300032002 | Bacteria | 2335 |
| 233 | Ga0307416_100576365 | 3300032002 | Bacteria | 1202 |
| 234 | Ga0307415_100044855 | 3300032126 | Bacteria | 2959 |
| 235 | Ga0373930_0003902 | 3300034816 | Bacteria | 2394 |
| 236 | Ga0373930_0077803 | 3300034816 | Bacteria | 763 |
| 237 | Ga0373948_0006074 | 3300034817 | Unclassified | 1982 |
| 238 | Ga0373950_0029304 | 3300034818 | Bacteria | 1012 |
| 239 | Ga0373959_0020113 | 3300034820 | Unclassified | 1271 |
| 240 | Ga0373928_0004514 | 3300035084 | Bacteria | 2653 |
| 241 | Ga0373928_0017321 | 3300035084 | Bacteria | 1482 |
| 242 | Ga0373929_0001468 | 3300035085 | Bacteria | 4490 |
| 243 | Ga0373929_0037870 | 3300035085 | Bacteria | 1059 |
| 244 | Ga0373940_0001916 | 3300035088 | Bacteria | 3916 |
| 245 | Ga0373949_0002441 | 3300035090 | Bacteria | 4778 |
| 246 | Ga0373951_0005321 | 3300035091 | Bacteria | 2995 |
| 247 | Ga0373952_0002355 | 3300035092 | Bacteria | 3403 |
| 248 | Ga0373932_0001300 | 3300035112 | Bacteria | 7049 |
| 249 | Ga0373932_0007554 | 3300035112 | Bacteria | 2590 |
| 250 | Ga0373939_0002372 | 3300035114 | Bacteria | 4449 |
| 251 | Ga0373941_0038151 | 3300035115 | Unclassified | 1469 |
| 252 | Ga0373960_0000715 | 3300035121 | Bacteria | 6900 |
| 253 | Ga0373960_0253418 | 3300035121 | Bacteria | 640 |
| 254 | Ga0373942_0003602 | 3300035207 | Bacteria | 3633 |
| 255 | Ga0373942_0006440 | 3300035207 | Bacteria | 2712 |
| 256 | Ga0373961_0053754 | 3300035241 | Unclassified | 1202 |
| 257 | Ga0373962_0002061 | 3300035242 | Bacteria | 4794 |
| 258 | Ga0373962_0029589 | 3300035242 | Bacteria | 1493 |
| 259 | Ga0373931_0005421 | 3300035691 | Bacteria | 5895 |
| 260 | Ga0373931_0067938 | 3300035691 | Bacteria | 1939 |
| 261 | Ga0373935_0248134 | 3300035692 | Bacteria | 1245 |
| 262 | Ga0373947_0078060 | 3300035725 | Bacteria | 2043 |
| 263 | Ga0373947_0578427 | 3300035725 | Bacteria | 765 |
| 264 | Ga0373937_0100142 | 3300036401 | Unclassified | 2689 |
| 265 | Ga0395899_0001360 | 3300037312 | Bacteria | 20970 |
| 266 | Ga0395899_0003797 | 3300037312 | Bacteria | 11928 |
| 267 | Ga0395899_0079183 | 3300037312 | Unclassified | 2393 |
| 268 | Ga0395900_0005085 | 3300037418 | Bacteria | 13803 |
| 269 | Ga0395900_0023734 | 3300037418 | Bacteria | 6274 |
| 270 | Ga0395900_0258504 | 3300037418 | Unclassified | 1740 |
| 271 | Ga0395900_0766618 | 3300037418 | Unclassified | 894 |
| 272 | Ga0395900_0789907 | 3300037418 | Bacteria | 878 |
| 273 | Ga0395898_0001821 | 3300037466 | Bacteria | 27497 |
| 274 | Ga0395898_0018646 | 3300037466 | Bacteria | 7074 |
| 275 | Ga0395898_0142037 | 3300037466 | Unclassified | 2298 |
| 276 | Ga0395898_0398249 | 3300037466 | Bacteria | 1313 |
| 277 | Ga0395905_0010094 | 3300037471 | Bacteria | 9204 |
| 278 | Ga0395905_0119176 | 3300037471 | Bacteria | 2480 |
| 279 | Ga0395901_0017741 | 3300038443 | Bacteria | 7265 |
| 280 | Ga0395901_0156973 | 3300038443 | Bacteria | 2389 |
| 281 | Ga0395901_0537324 | 3300038443 | Bacteria | 1186 |
| 282 | Ga0395901_0717977 | 3300038443 | Bacteria | 995 |
| 283 | Ga0439438_020982 | 3300041405 | Bacteria | 1827 |
| 284 | Ga0439453_0002538 | 3300041408 | Bacteria | 2530 |
| 285 | Ga0439453_0021252 | 3300041408 | Unclassified | 1169 |
| 286 | Ga0439466_0048203 | 3300041411 | Bacteria | 1402 |
| 287 | Ga0451804_0596926 | 3300041463 | Bacteria | 824 |
| 288 | Ga0439437_005060 | 3300042000 | Unclassified | 1446 |
| 289 | Ga0439441_031994 | 3300042001 | Unclassified | 1024 |
| 290 | Ga0439432_083569 | 3300042006 | Bacteria | 966 |
| 291 | Ga0439451_003682 | 3300042009 | Bacteria | 3106 |
| 292 | Ga0439454_003464 | 3300042011 | Unclassified | 1756 |
| 293 | Ga0439463_097486 | 3300042016 | Bacteria | 758 |
| 294 | Ga0450911_021476 | 3300042115 | Bacteria | 842 |
| 295 | Ga0450920_008032 | 3300042122 | Bacteria | 1923 |
| 296 | Ga0450920_055153 | 3300042122 | Bacteria | 799 |
| 297 | Ga0450888_017132 | 3300042126 | Bacteria | 898 |
| 298 | Ga0450907_003474 | 3300042146 | Bacteria | 2809 |
| 299 | Ga0439446_0005137 | 3300042156 | Bacteria | 3354 |
| 300 | Ga0439446_0008264 | 3300042156 | Bacteria | 2758 |
| 301 | Ga0450908_017564 | 3300042184 | Bacteria | 1269 |
| 302 | Ga0439434_0014300 | 3300042435 | Bacteria | 2361 |
| 303 | Ga0439434_0021814 | 3300042435 | Bacteria | 1925 |
| 304 | Ga0439435_0173269 | 3300042436 | Bacteria | 702 |
| 305 | Ga0439460_0039285 | 3300042461 | Bacteria | 1383 |
| 306 | Ga0450918_020780 | 3300042531 | Bacteria | 1147 |
| 307 | Ga0466963_0273219 | 3300044694 | Bacteria | 1187 |
| 308 | Ga0466963_0413209 | 3300044694 | Bacteria | 952 |
| 309 | Ga0466960_0195015 | 3300044901 | Bacteria | 1104 |
| 310 | Ga0466960_0215701 | 3300044901 | Bacteria | 1054 |
| 311 | Ga0466960_0431063 | 3300044901 | Unclassified | 764 |
| 312 | Ga0466960_0435677 | 3300044901 | Unclassified | 760 |
| 313 | Ga0451576_0393312 | 3300045051 | Bacteria | 1453 |
| 314 | Ga0466967_0209510 | 3300045976 | Bacteria | 1848 |
| 315 | Ga0466967_0488386 | 3300045976 | Unclassified | 1207 |
| 316 | Ga0466967_0539426 | 3300045976 | Bacteria | 1147 |
| 317 | Ga0495592_0086913 | 3300046454 | Bacteria | 2251 |
| 318 | Ga0495592_0145073 | 3300046454 | Unclassified | 1647 |
| 319 | Ga0495592_0147156 | 3300046454 | Bacteria | 1632 |
| 320 | Ga0495603_0016440 | 3300046455 | Bacteria | 4476 |
| 321 | Ga0495629_0067627 | 3300046459 | Bacteria | 2493 |
| 322 | Ga0495641_0023734 | 3300046461 | Bacteria | 3040 |
| 323 | Ga0495641_0114757 | 3300046461 | Unclassified | 1201 |
| 324 | Ga0495651_0505525 | 3300046462 | Bacteria | 773 |
| 325 | Ga0495582_0030606 | 3300046473 | Bacteria | 2956 |
| 326 | Ga0495582_0048492 | 3300046473 | Bacteria | 2339 |
| 327 | Ga0495639_0192498 | 3300046475 | Bacteria | 996 |
| 328 | Ga0495584_0138615 | 3300046491 | Bacteria | 1235 |
| 329 | Ga0495585_0154049 | 3300046492 | Bacteria | 1197 |
| 330 | Ga0495618_0049395 | 3300046514 | Bacteria | 2657 |
| 331 | Ga0495628_0181063 | 3300046516 | Bacteria | 1594 |
| 332 | Ga0495630_0132966 | 3300046517 | Bacteria | 1890 |
| 333 | Ga0495630_0784849 | 3300046517 | Bacteria | 727 |
| 334 | Ga0495644_0231141 | 3300046523 | Bacteria | 716 |
| 335 | Ga0495642_0265416 | 3300046528 | Bacteria | 751 |
| 336 | Ga0495640_0151660 | 3300046533 | Unclassified | 1489 |
| 337 | Ga0495656_0035911 | 3300046615 | Unclassified | 2039 |
| 338 | Ga0495656_0086831 | 3300046615 | Bacteria | 1424 |
| 339 | Ga0495634_0028584 | 3300046642 | Bacteria | 3869 |
| 340 | Ga0495634_0146854 | 3300046642 | Bacteria | 1494 |
| 341 | Ga0495634_0199571 | 3300046642 | Bacteria | 1243 |
| 342 | Ga0495635_0022595 | 3300046663 | Bacteria | 4383 |
| 343 | Ga0495635_0439854 | 3300046663 | Bacteria | 863 |
| 344 | Ga0495646_0278609 | 3300046680 | Bacteria | 889 |
| 345 | Ga0495647_0064785 | 3300046681 | Bacteria | 1450 |
| 346 | Ga0495658_0046842 | 3300046683 | Bacteria | 2432 |
| 347 | Ga0495658_0184882 | 3300046683 | Bacteria | 1294 |
| 348 | Ga0495613_0012667 | 3300046689 | Bacteria | 6270 |
| 349 | Ga0495613_0034717 | 3300046689 | Bacteria | 3745 |
| 350 | Ga0495613_0054777 | 3300046689 | Bacteria | 2931 |
| 351 | Ga0495624_0399836 | 3300046690 | Bacteria | 825 |
| 352 | Ga0495670_0111368 | 3300046691 | Unclassified | 1417 |
| 353 | Ga0495589_0123844 | 3300046794 | Bacteria | 1244 |
| 354 | Ga0495636_0158815 | 3300047318 | Unclassified | 1018 |
| 355 | Ga0495674_0009669 | 3300047319 | Bacteria | 9153 |
| 356 | Ga0495676_0039647 | 3300047321 | Bacteria | 3898 |
| 357 | Ga0495680_0006974 | 3300047322 | Bacteria | 10420 |
| 358 | Ga0495680_0250559 | 3300047322 | Bacteria | 1255 |
| 359 | Ga0495593_0073026 | 3300047673 | Unclassified | 1780 |
| 360 | Ga0495614_0336565 | 3300048089 | Bacteria | 702 |
| 361 | Ga0496100_0004055 | 3300048903 | Bacteria | 7721 |
| 362 | Ga0496100_0004272 | 3300048903 | Bacteria | 7559 |
| 363 | Ga0496100_0105917 | 3300048903 | Bacteria | 1945 |
| 364 | Ga0496100_0112827 | 3300048903 | Bacteria | 1891 |
| 365 | Ga0496100_0258933 | 3300048903 | Bacteria | 1290 |
| 366 | Ga0496100_0283393 | 3300048903 | Bacteria | 1236 |
| 367 | Ga0496101_0005189 | 3300048904 | Bacteria | 8287 |
| 368 | Ga0496101_0011585 | 3300048904 | Bacteria | 5855 |
| 369 | Ga0496101_0161987 | 3300048904 | Bacteria | 1716 |
| 370 | Ga0496101_0319375 | 3300048904 | Unclassified | 1218 |
| 371 | Ga0496101_0464275 | 3300048904 | Unclassified | 999 |
| 372 | Ga0496102_0013185 | 3300048905 | Bacteria | 7151 |
| 373 | Ga0496102_0026180 | 3300048905 | Bacteria | 5199 |
| 374 | Ga0496102_0030900 | 3300048905 | Bacteria | 4797 |
| 375 | Ga0496102_0032076 | 3300048905 | Bacteria | 4718 |
| 376 | Ga0496102_0345814 | 3300048905 | Bacteria | 1400 |
| 377 | Ga0496103_0009699 | 3300048906 | Bacteria | 5698 |
| 378 | Ga0496103_0017597 | 3300048906 | Bacteria | 4278 |
| 379 | Ga0496104_0004621 | 3300048907 | Bacteria | 11998 |
| 380 | Ga0496104_0008731 | 3300048907 | Bacteria | 9009 |
| 381 | Ga0496104_0062358 | 3300048907 | Bacteria | 3535 |
| 382 | Ga0496104_0152907 | 3300048907 | Bacteria | 2214 |
| 383 | Ga0496104_0261828 | 3300048907 | Unclassified | 1642 |
| 384 | Ga0496104_0437471 | 3300048907 | Bacteria | 1220 |
| 385 | Ga0496105_0000147 | 3300048908 | Bacteria | 46556 |
| 386 | Ga0496105_0004406 | 3300048908 | Bacteria | 10598 |
| 387 | Ga0496105_0005089 | 3300048908 | Bacteria | 9964 |
| 388 | Ga0496105_0087608 | 3300048908 | Bacteria | 2572 |
| 389 | Ga0496105_0198082 | 3300048908 | Bacteria | 1640 |
| 390 | Ga0496105_0613133 | 3300048908 | Bacteria | 843 |
| 391 | Ga0496106_0017396 | 3300048909 | Bacteria | 5319 |
| 392 | Ga0496106_0122820 | 3300048909 | Bacteria | 2031 |
| 393 | Ga0496106_0148568 | 3300048909 | Bacteria | 1847 |
| 394 | Ga0496106_0216321 | 3300048909 | Bacteria | 1527 |
| 395 | Ga0496107_0008894 | 3300048910 | Bacteria | 6958 |
| 396 | Ga0496107_0017744 | 3300048910 | Bacteria | 5007 |
| 397 | Ga0496108_0005536 | 3300048911 | Bacteria | 10219 |
| 398 | Ga0496108_0009368 | 3300048911 | Bacteria | 7925 |
| 399 | Ga0496108_0128071 | 3300048911 | Bacteria | 2181 |
| 400 | Ga0496108_0150193 | 3300048911 | Unclassified | 2010 |
| 401 | Ga0496108_0308697 | 3300048911 | Bacteria | 1378 |
| 402 | Ga0496108_0638209 | 3300048911 | Bacteria | 926 |
| 403 | Ga0496108_0832524 | 3300048911 | Bacteria | 795 |
| 404 | Ga0496109_0011770 | 3300048912 | Bacteria | 7529 |
| 405 | Ga0496109_0014652 | 3300048912 | Bacteria | 6821 |
| 406 | Ga0496109_0046116 | 3300048912 | Bacteria | 3958 |
| 407 | Ga0496109_0047300 | 3300048912 | Unclassified | 3911 |
| 408 | Ga0496109_0219172 | 3300048912 | Bacteria | 1789 |
| 409 | Ga0496109_0223615 | 3300048912 | Bacteria | 1770 |
| 410 | Ga0496109_0264327 | 3300048912 | Unclassified | 1621 |
| 411 | Ga0496109_0521503 | 3300048912 | Bacteria | 1121 |
| 412 | Ga0496109_0539969 | 3300048912 | Unclassified | 1100 |
| 413 | Ga0496109_1336833 | 3300048912 | Bacteria | 652 |
| 414 | Ga0496110_0003225 | 3300048913 | Bacteria | 12422 |
| 415 | Ga0496110_0004408 | 3300048913 | Bacteria | 10902 |
| 416 | Ga0496110_0110959 | 3300048913 | Bacteria | 2465 |
| 417 | Ga0496110_0117309 | 3300048913 | Bacteria | 2397 |
| 418 | Ga0496110_0118439 | 3300048913 | Unclassified | 2385 |
| 419 | Ga0496110_0220301 | 3300048913 | Bacteria | 1725 |
| 420 | Ga0496110_0250292 | 3300048913 | Bacteria | 1613 |
| 421 | Ga0496110_0277206 | 3300048913 | Unclassified | 1527 |
| 422 | Ga0496110_0319114 | 3300048913 | Bacteria | 1415 |
| 423 | Ga0496110_0323382 | 3300048913 | Unclassified | 1405 |
| 424 | Ga0496110_0396538 | 3300048913 | Unclassified | 1258 |
| 425 | Ga0496110_0414540 | 3300048913 | Bacteria | 1228 |
| 426 | Ga0496111_0022064 | 3300048914 | Bacteria | 4453 |
| 427 | Ga0496111_0314571 | 3300048914 | Bacteria | 1160 |
| 428 | Ga0496111_0606783 | 3300048914 | Bacteria | 801 |
| 429 | Ga0496112_0000273 | 3300048915 | Bacteria | 33471 |
| 430 | Ga0496112_0026858 | 3300048915 | Bacteria | 5547 |
| 431 | Ga0496112_0046366 | 3300048915 | Bacteria | 4263 |
| 432 | Ga0496112_0091236 | 3300048915 | Bacteria | 3016 |
| 433 | Ga0496112_0334395 | 3300048915 | Bacteria | 1458 |
| 434 | Ga0496112_0491808 | 3300048915 | Bacteria | 1163 |
| 435 | Ga0496113_0012649 | 3300048916 | Bacteria | 5679 |
| 436 | Ga0496113_0197329 | 3300048916 | Unclassified | 1599 |
| 437 | Ga0496113_0410685 | 3300048916 | Bacteria | 1087 |
| 438 | Ga0496114_0011069 | 3300048917 | Bacteria | 7198 |
| 439 | Ga0496114_0029854 | 3300048917 | Bacteria | 4482 |
| 440 | Ga0496114_0053753 | 3300048917 | Bacteria | 3357 |
| 441 | Ga0496114_0455429 | 3300048917 | Unclassified | 1133 |
| 442 | Ga0496115_0008795 | 3300048918 | Bacteria | 7481 |
| 443 | Ga0501031_0002709 | 3300049568 | Bacteria | 11275 |
| 444 | Ga0501031_0005329 | 3300049568 | Bacteria | 8375 |
| 445 | Ga0501031_0056099 | 3300049568 | Bacteria | 2566 |
| 446 | Ga0501031_0336062 | 3300049568 | Unclassified | 978 |
| 447 | Ga0501032_0024296 | 3300049569 | Unclassified | 4186 |
| 448 | Ga0501032_0100615 | 3300049569 | Unclassified | 1915 |
| 449 | Ga0501033_0004060 | 3300049570 | Bacteria | 11820 |
| 450 | Ga0501033_0059105 | 3300049570 | Bacteria | 2831 |
| 451 | Ga0501034_0337678 | 3300049571 | Unclassified | 1437 |
| 452 | Ga0501034_0598129 | 3300049571 | Bacteria | 1009 |
| 453 | Ga0501036_0014212 | 3300049572 | Bacteria | 6623 |
| 454 | Ga0501036_0102222 | 3300049572 | Bacteria | 2425 |
| 455 | Ga0501036_0111605 | 3300049572 | Bacteria | 2310 |
| 456 | Ga0501037_0012038 | 3300049573 | Bacteria | 6370 |
| 457 | Ga0501037_0238868 | 3300049573 | Unclassified | 1274 |
| 458 | Ga0501037_0494763 | 3300049573 | Unclassified | 830 |
| 459 | Ga0501037_0599202 | 3300049573 | Bacteria | 740 |
| 460 | Ga0501038_0001571 | 3300049574 | Bacteria | 21153 |
| 461 | Ga0501038_0021382 | 3300049574 | Bacteria | 5808 |
| 462 | Ga0501039_0002091 | 3300049575 | Bacteria | 14799 |
| 463 | Ga0501039_0009797 | 3300049575 | Bacteria | 7300 |
| 464 | Ga0501040_0002120 | 3300049576 | Bacteria | 12789 |
| 465 | Ga0501040_0054979 | 3300049576 | Bacteria | 2729 |
| 466 | Ga0501040_0056672 | 3300049576 | Bacteria | 2689 |
| 467 | Ga0501040_0292948 | 3300049576 | Bacteria | 1163 |
| 468 | Ga0501040_0305759 | 3300049576 | Unclassified | 1137 |
| 469 | Ga0501041_0003887 | 3300049577 | Bacteria | 8604 |
| 470 | Ga0501041_0007898 | 3300049577 | Bacteria | 6253 |
| 471 | Ga0501041_0011813 | 3300049577 | Bacteria | 5169 |
| 472 | Ga0501041_0191368 | 3300049577 | Unclassified | 1282 |
| 473 | Ga0501042_0028745 | 3300049578 | Bacteria | 3921 |
| 474 | Ga0501042_0030365 | 3300049578 | Bacteria | 3815 |
| 475 | Ga0501042_0032557 | 3300049578 | Bacteria | 3692 |
| 476 | Ga0501042_0060756 | 3300049578 | Bacteria | 2699 |
| 477 | Ga0501042_0253710 | 3300049578 | Unclassified | 1269 |
| 478 | Ga0501042_0364346 | 3300049578 | Bacteria | 1046 |
| 479 | Ga0501043_0005959 | 3300049579 | Bacteria | 9801 |
| 480 | Ga0501043_0025507 | 3300049579 | Bacteria | 4639 |
| 481 | Ga0501043_0167036 | 3300049579 | Bacteria | 1718 |
| 482 | Ga0501046_0002584 | 3300049580 | Bacteria | 16929 |
| 483 | Ga0501046_0015641 | 3300049580 | Bacteria | 6370 |
| 484 | Ga0501046_0154290 | 3300049580 | Bacteria | 1731 |
| 485 | Ga0501048_0006745 | 3300049582 | Bacteria | 8721 |
| 486 | Ga0501048_0026491 | 3300049582 | Bacteria | 4221 |
| 487 | Ga0501048_0064459 | 3300049582 | Unclassified | 2591 |
| 488 | Ga0501067_0088445 | 3300049583 | Unclassified | 1719 |
| 489 | Ga0501068_0005960 | 3300049584 | Bacteria | 6688 |
| 490 | Ga0501068_0408555 | 3300049584 | Archaea | 876 |
| 491 | Ga0501069_0029156 | 3300049585 | Bacteria | 3029 |
| 492 | Ga0501069_0094687 | 3300049585 | Bacteria | 1690 |
| 493 | Ga0501069_0130410 | 3300049585 | Bacteria | 1439 |
| 494 | Ga0501070_0000120 | 3300049586 | Bacteria | 70354 |
| 495 | Ga0501070_0002915 | 3300049586 | Bacteria | 14886 |
| 496 | Ga0501070_0051603 | 3300049586 | Bacteria | 3414 |
| 497 | Ga0501071_0000414 | 3300049587 | Bacteria | 21222 |
| 498 | Ga0501071_0003032 | 3300049587 | Bacteria | 10397 |
| 499 | Ga0501071_0130348 | 3300049587 | Bacteria | 1867 |
| 500 | Ga0501072_0001365 | 3300049588 | Bacteria | 18321 |
| 501 | Ga0501072_0009765 | 3300049588 | Bacteria | 7296 |
| 502 | Ga0501072_0107570 | 3300049588 | Unclassified | 2218 |
| 503 | Ga0501072_0223035 | 3300049588 | Bacteria | 1502 |
| 504 | Ga0501073_0018572 | 3300049589 | Bacteria | 5027 |
| 505 | Ga0501073_0204903 | 3300049589 | Unclassified | 1363 |
| 506 | Ga0501074_0002927 | 3300049590 | Bacteria | 11991 |
| 507 | Ga0501074_0038589 | 3300049590 | Bacteria | 3460 |
| 508 | Ga0501074_0330103 | 3300049590 | Bacteria | 1083 |
| 509 | Ga0501075_0002893 | 3300049591 | Bacteria | 11524 |
| 510 | Ga0501075_0020421 | 3300049591 | Bacteria | 4819 |
| 511 | Ga0501075_0039101 | 3300049591 | Bacteria | 3549 |
| 512 | Ga0501075_0256987 | 3300049591 | Unclassified | 1331 |
| 513 | Ga0501076_0006761 | 3300049592 | Bacteria | 8324 |
| 514 | Ga0501076_0012750 | 3300049592 | Bacteria | 6292 |
| 515 | Ga0501076_0098170 | 3300049592 | Unclassified | 2359 |
| 516 | Ga0501076_0231164 | 3300049592 | Unclassified | 1512 |
| 517 | Ga0501076_0748482 | 3300049592 | Bacteria | 806 |
| 518 | Ga0501077_0011600 | 3300049593 | Bacteria | 5507 |
| 519 | Ga0501077_0029318 | 3300049593 | Bacteria | 3499 |
| 520 | Ga0501077_0143327 | 3300049593 | Bacteria | 1516 |
| 521 | Ga0501079_0002478 | 3300049741 | Bacteria | 13412 |
| 522 | Ga0501079_0011437 | 3300049741 | Bacteria | 6773 |
| 523 | Ga0501079_0025257 | 3300049741 | Bacteria | 4557 |
| 524 | Ga0501079_0069678 | 3300049741 | Bacteria | 2715 |
| 525 | Ga0501080_0007444 | 3300049742 | Bacteria | 9882 |
| 526 | Ga0501080_0034154 | 3300049742 | Bacteria | 4747 |
| 527 | Ga0501080_0073395 | 3300049742 | Bacteria | 3183 |
| 528 | Ga0501080_0248820 | 3300049742 | Bacteria | 1621 |
| 529 | Ga0501080_0912662 | 3300049742 | Bacteria | 765 |
| 530 | Ga0501081_0050953 | 3300049743 | Bacteria | 2853 |
| 531 | Ga0501081_0061715 | 3300049743 | Bacteria | 2599 |
| 532 | Ga0501081_0129018 | 3300049743 | Unclassified | 1805 |
| 533 | Ga0501081_0210703 | 3300049743 | Unclassified | 1411 |
| 534 | Ga0501081_0220198 | 3300049743 | Bacteria | 1380 |
| 535 | Ga0501081_0449192 | 3300049743 | Unclassified | 958 |
| 536 | Ga0501083_0010096 | 3300049744 | Bacteria | 6654 |
| 537 | Ga0501083_0291409 | 3300049744 | Bacteria | 1062 |
| 538 | Ga0501035_0012324 | 3300049822 | Bacteria | 7905 |
| 539 | Ga0501035_0022011 | 3300049822 | Bacteria | 5856 |
| 540 | Ga0501035_0140958 | 3300049822 | Bacteria | 2096 |
| 541 | Ga0501035_0948239 | 3300049822 | Bacteria | 679 |
| 542 | Ga0501044_0166602 | 3300049823 | Unclassified | 2177 |
| 543 | Ga0501044_0321805 | 3300049823 | Bacteria | 1471 |
| 544 | Ga0501045_0009547 | 3300049824 | Bacteria | 6788 |
| 545 | Ga0501045_0018097 | 3300049824 | Bacteria | 5006 |
| 546 | Ga0501045_0018428 | 3300049824 | Bacteria | 4965 |
| 547 | Ga0501045_0265140 | 3300049824 | Unclassified | 1279 |
| 548 | nmdc:mga00v17_256896_c1 | 3300050491 | Unclassified | 1133 |
| 549 | nmdc:mga05p37_1501496_c1 | 3300050507 | Bacteria | 671 |
| 550 | nmdc:mga05p37_25240_c1 | 3300050507 | Bacteria | 7227 |
| 551 | nmdc:mga05p37_401825_c1 | 3300050507 | Unclassified | 1599 |
| 552 | nmdc:mga05p37_826005_c1 | 3300050507 | Unclassified | 1010 |
| 553 | nmdc:mga0qj67_400477_c1 | 3300050509 | Unclassified | 1108 |
| 554 | nmdc:mga08y16_1024140_c1 | 3300050511 | Bacteria | 804 |
| 555 | nmdc:mga08y16_1400394_c1 | 3300050511 | Unclassified | 662 |
| 556 | nmdc:mga0n895_138690_c1 | 3300050512 | Bacteria | 2459 |
| 557 | nmdc:mga0n895_330352_c1 | 3300050512 | Bacteria | 1545 |
| 558 | nmdc:mga0n895_63477_c1 | 3300050512 | Bacteria | 3652 |
| 559 | nmdc:mga0n895_72879_c1 | 3300050512 | Bacteria | 3408 |
| 560 | nmdc:mga0rr50_323423_c1 | 3300050513 | Bacteria | 1293 |
| 561 | nmdc:mga0rr50_9029_c1 | 3300050513 | Bacteria | 6238 |
| 562 | nmdc:mga08x19_37067_c1 | 3300050514 | Bacteria | 3093 |
| 563 | nmdc:mga0a205_698001_c1 | 3300050515 | Bacteria | 865 |
| 564 | Ga0495601_0020622 | 3300053077 | Bacteria | 4027 |
| 565 | Ga0495595_0037523 | 3300053084 | Bacteria | 2204 |
| 566 | Ga0495595_0069357 | 3300053084 | Unclassified | 1664 |
| 567 | Ga0495595_0108582 | 3300053084 | Unclassified | 1344 |
| 568 | Ga0501084_0010243 | 3300054114 | Bacteria | 7756 |
| 569 | Ga0501084_0012731 | 3300054114 | Bacteria | 6968 |
| 570 | Ga0501084_0097492 | 3300054114 | Bacteria | 2468 |
| 571 | Ga0501084_0137964 | 3300054114 | Bacteria | 2053 |
| 572 | Ga0501084_0896898 | 3300054114 | Unclassified | 746 |
| 573 | Ga0590075_014794 | 3300059424 | Bacteria | 1909 |
| 574 | Ga0590077_024222 | 3300059426 | Bacteria | 1303 |
| 575 | Ga0501082_0020059 | 3300060353 | Bacteria | 5760 |
| 576 | Ga0501082_1090957 | 3300060353 | Bacteria | 698 |
| 577 | Ga0530510_0011496 | 3300061734 | Bacteria | 6209 |
| 578 | Ga0530510_0041729 | 3300061734 | Bacteria | 3313 |
| 579 | Ga0530510_0223890 | 3300061734 | Unclassified | 1398 |
| 580 | Ga0105240_11393996 | |||
| 581 | JGI25406J46586_10123306 | |||
| 582 | JGI25407J50210_10000558 | |||
| 583 | JGI25407J50210_10002575 | |||
| 584 | Ga0070683_100000847 | |||
| 585 | Ga0070683_100350681 | |||
| 586 | Ga0070690_100242727 | |||
| 587 | Ga0070680_100168574 | |||
| 588 | Ga0070680_100184275 | |||
| 589 | Ga0070682_100011136 | |||
| 590 | Ga0070682_100201612 | |||
| 591 | Ga0068868_100191865 | |||
| 592 | Ga0070668_100222363 | |||
| 593 | Ga0070675_100383073 | |||
| 594 | Ga0070675_100434057 | |||
| 595 | Ga0070671_100166301 | |||
| 596 | Ga0070674_100236222 | |||
| 597 | Ga0070673_100186275 | |||
| 598 | Ga0070673_100676018 | |||
| 599 | Ga0070709_10003775 | |||
| 600 | Ga0070709_10157154 | |||
| 601 | Ga0070709_10416561 | |||
| 602 | Ga0070714_100154041 | |||
| 603 | Ga0070714_100778346 | |||
| 604 | Ga0070713_100092226 | |||
| 605 | Ga0070713_100308043 | |||
| 606 | Ga0070713_100715640 | |||
| 607 | Ga0070710_10037789 | |||
| 608 | Ga0070710_10049672 | |||
| 609 | Ga0070710_10127747 | |||
| 610 | Ga0070711_100004058 | |||
| 611 | Ga0070711_100006624 | |||
| 612 | Ga0070705_100014332 | |||
| 613 | Ga0070705_100019118 | |||
| 614 | Ga0070705_100239943 | |||
| 615 | Ga0070708_100069324 | |||
| 616 | Ga0070708_100215208 | |||
| 617 | Ga0070708_100313567 | |||
| 618 | Ga0070708_100715432 | |||
| 619 | Ga0070663_100045996 | |||
| 620 | Ga0070678_100008832 | |||
| 621 | Ga0070678_100781366 | |||
| 622 | Ga0070662_100612338 | |||
| 623 | Ga0070681_10006968 | |||
| 624 | Ga0070681_10569463 | |||
| 625 | Ga0070706_100270597 | |||
| 626 | Ga0070706_100544380 | |||
| 627 | Ga0070707_100043192 | |||
| 628 | Ga0070707_101006173 | |||
| 629 | Ga0070698_100054760 | |||
| 630 | Ga0070698_100068618 | |||
| 631 | Ga0070698_100597735 | |||
| 632 | Ga0070699_100048280 | |||
| 633 | Ga0070699_100073037 | |||
| 634 | Ga0070699_100169785 | |||
| 635 | Ga0070679_100007549 | |||
| 636 | Ga0070684_100292932 | |||
| 637 | Ga0070697_100346320 | |||
| 638 | Ga0070672_100246151 | |||
| 639 | Ga0070686_100113958 | |||
| 640 | Ga0070686_100285420 | |||
| 641 | Ga0070695_100061638 | |||
| 642 | Ga0070695_100105118 | |||
| 643 | Ga0070695_100106932 | |||
| 644 | Ga0070696_100005071 | |||
| 645 | Ga0070696_100080784 | |||
| 646 | Ga0070693_100001104 | |||
| 647 | Ga0070693_100194354 | |||
| 648 | Ga0070693_100231979 | |||
| 649 | Ga0070665_100280194 | |||
| 650 | Ga0070704_100035670 | |||
| 651 | Ga0070704_100047407 | |||
| 652 | Ga0070704_100144467 | |||
| 653 | Ga0070704_100233245 | |||
| 654 | Ga0070664_100202659 | |||
| 655 | Ga0070664_100281070 | |||
| 656 | Ga0068854_100183195 | |||
| 657 | Ga0068854_100379130 | |||
| 658 | Ga0068856_100052276 | |||
| 659 | Ga0068856_100675154 | |||
| 660 | Ga0070702_100025736 | |||
| 661 | Ga0068861_100099992 | |||
| 662 | Ga0068870_10152071 | |||
| 663 | Ga0068858_100445246 | |||
| 664 | Ga0068860_100347248 | |||
| 665 | Ga0068862_100132412 | |||
| 666 | Ga0081455_10194130 | |||
| 667 | Ga0081538_10000795 | |||
| 668 | Ga0081538_10002124 | |||
| 669 | Ga0081538_10038054 | |||
| 670 | Ga0070717_10355700 | |||
| 671 | Ga0075365_10263632 | |||
| 672 | Ga0075364_10056662 | |||
| 673 | Ga0075432_10096770 | |||
| 674 | Ga0070715_10014187 | |||
| 675 | Ga0070715_10043057 | |||
| 676 | Ga0070716_100029701 | |||
| 677 | Ga0070716_100049090 | |||
| 678 | Ga0070716_100193269 | |||
| 679 | Ga0070712_100031111 | |||
| 680 | Ga0070712_100148023 | |||
| 681 | Ga0075362_10020822 | |||
| 682 | Ga0097621_100046478 | |||
| 683 | Ga0068871_100033893 | |||
| 684 | Ga0068871_100178460 | |||
| 685 | Ga0068871_100267557 | |||
| 686 | Ga0075433_10247331 | |||
| 687 | Ga0075434_100172501 | |||
| 688 | Ga0075434_100627108 | |||
| 689 | Ga0075435_100161170 | |||
| 690 | Ga0075435_100689564 | |||
| 691 | Ga0105250_10034779 | |||
| 692 | Ga0111539_10950713 | |||
| 693 | Ga0105245_10013369 | |||
| 694 | Ga0105245_10029890 | |||
| 695 | Ga0105245_10169437 | |||
| 696 | Ga0114129_10172289 | |||
| 697 | Ga0114129_10224454 | |||
| 698 | Ga0114129_10567297 | |||
| 699 | Ga0114129_11001394 | |||
| 700 | Ga0114129_11203286 | |||
| 701 | Ga0105243_10074878 | |||
| 702 | Ga0105243_10181009 | |||
| 703 | Ga0105243_10275406 | |||
| 704 | Ga0105243_11192513 | |||
| 705 | Ga0105241_10101988 | |||
| 706 | Ga0105242_10169826 | |||
| 707 | Ga0105242_10567352 | |||
| 708 | Ga0105248_11055246 | |||
| 709 | Ga0105248_11628587 | |||
| 710 | Ga0105249_10268335 | |||
| 711 | Ga0105249_10338647 | |||
| 712 | Ga0105239_10439909 | |||
| 713 | Ga0105239_10441711 | |||
| 714 | Ga0157369_11069408 | |||
| 715 | Ga0157374_10415199 | |||
| 716 | Ga0157378_10434999 | |||
| 717 | Ga0163162_10290832 | |||
| 718 | Ga0157375_10248758 | |||
| 719 | Ga0157375_10420132 | |||
| 720 | Ga0157375_10624641 | |||
| 721 | Ga0163163_10546991 | |||
| 722 | Ga0163163_10628096 | |||
| 723 | Ga0182008_10187055 | |||
| 724 | Ga0157377_10436483 | |||
| 725 | Ga0157379_10443606 | |||
| 726 | Ga0157376_10044679 | |||
| 727 | Ga0163161_10100613 | |||
| 728 | Ga0207653_10012387 | |||
| 729 | Ga0207692_10243289 | |||
| 730 | Ga0207642_10275000 | |||
| 731 | Ga0207688_10136879 | |||
| 732 | Ga0207685_10061628 | |||
| 733 | Ga0207685_10071081 | |||
| 734 | Ga0207699_10043456 | |||
| 735 | Ga0207699_10204668 | |||
| 736 | Ga0207643_10308784 | |||
| 737 | Ga0207684_10115351 | |||
| 738 | Ga0207684_10245661 | |||
| 739 | Ga0207684_10460274 | |||
| 740 | Ga0207684_10500462 | |||
| 741 | Ga0207654_10055600 | |||
| 742 | Ga0207654_10218917 | |||
| 743 | Ga0207707_10002713 | |||
| 744 | Ga0207707_10668541 | |||
| 745 | Ga0207693_10009780 | |||
| 746 | Ga0207693_10195778 | |||
| 747 | Ga0207693_10343024 | |||
| 748 | Ga0207663_10000759 | |||
| 749 | Ga0207663_10006071 | |||
| 750 | Ga0207663_10028497 | |||
| 751 | Ga0207663_10139994 | |||
| 752 | Ga0207660_10153174 | |||
| 753 | Ga0207660_10538573 | |||
| 754 | Ga0207657_10086419 | |||
| 755 | Ga0207652_10004552 | |||
| 756 | Ga0207646_10071904 | |||
| 757 | Ga0207646_10202468 | |||
| 758 | Ga0207646_10244136 | |||
| 759 | Ga0207646_10522100 | |||
| 760 | Ga0207687_10007156 | |||
| 761 | Ga0207700_10154190 | |||
| 762 | Ga0207700_10265791 | |||
| 763 | Ga0207700_10335410 | |||
| 764 | Ga0207664_10058991 | |||
| 765 | Ga0207664_10087047 | |||
| 766 | Ga0207664_10091786 | |||
| 767 | Ga0207664_11003684 | |||
| 768 | Ga0207644_10582518 | |||
| 769 | Ga0207706_10045395 | |||
| 770 | Ga0207686_10089458 | |||
| 771 | Ga0207709_10366877 | |||
| 772 | Ga0207709_10703547 | |||
| 773 | Ga0207709_11161689 | |||
| 774 | Ga0207704_10358430 | |||
| 775 | Ga0207704_10417499 | |||
| 776 | Ga0207665_10020035 | |||
| 777 | Ga0207711_10146225 | |||
| 778 | Ga0207661_10000646 | |||
| 779 | Ga0207679_10015107 | |||
| 780 | Ga0207679_10438173 | |||
| 781 | Ga0207667_10416845 | |||
| 782 | Ga0207651_10332531 | |||
| 783 | Ga0207651_10518331 | |||
| 784 | Ga0207651_10557679 | |||
| 785 | Ga0207712_10712430 | |||
| 786 | Ga0207640_10189830 | |||
| 787 | Ga0207677_10068319 | |||
| 788 | Ga0207677_10279439 | |||
| 789 | Ga0207703_10700798 | |||
| 790 | Ga0207678_10030538 | |||
| 791 | Ga0207678_10832065 | |||
| 792 | Ga0207702_10003702 | |||
| 793 | Ga0207702_10028451 | |||
| 794 | Ga0207702_10227422 | |||
| 795 | Ga0207702_10848479 | |||
| 796 | Ga0207648_10546175 | |||
| 797 | Ga0207676_10295178 | |||
| 798 | Ga0207675_100117980 | |||
| 799 | Ga0207675_100579594 | |||
| 800 | Ga0207683_10000973 | |||
| 801 | Ga0207683_10006616 | |||
| 802 | Ga0207683_10011336 | |||
| 803 | Ga0207683_10399984 | |||
| 804 | Ga0207428_10096496 | |||
| 805 | Ga0207428_10718645 | |||
| 806 | Ga0268266_10204430 | |||
| 807 | Ga0268264_10633951 | |||
| 808 | Ga0265318_10025664 | |||
| 809 | Ga0307408_100392134 | |||
| 810 | Ga0307408_100408085 | |||
| 811 | Ga0307416_100120663 | |||
| 812 | Ga0307416_100576365 | |||
| 813 | Ga0307415_100044855 | |||
| 814 | Ga0373930_0003902 | |||
| 815 | Ga0373930_0077803 | |||
| 816 | Ga0373948_0006074 | |||
| 817 | Ga0373950_0029304 | |||
| 818 | Ga0373959_0020113 | |||
| 819 | Ga0373928_0004514 | |||
| 820 | Ga0373928_0017321 | |||
| 821 | Ga0373929_0001468 | |||
| 822 | Ga0373929_0037870 | |||
| 823 | Ga0373940_0001916 | |||
| 824 | Ga0373949_0002441 | |||
| 825 | Ga0373951_0005321 | |||
| 826 | Ga0373952_0002355 | |||
| 827 | Ga0373932_0001300 | |||
| 828 | Ga0373932_0007554 | |||
| 829 | Ga0373939_0002372 | |||
| 830 | Ga0373941_0038151 | |||
| 831 | Ga0373960_0000715 | |||
| 832 | Ga0373960_0253418 | |||
| 833 | Ga0373942_0003602 | |||
| 834 | Ga0373942_0006440 | |||
| 835 | Ga0373961_0053754 | |||
| 836 | Ga0373962_0002061 | |||
| 837 | Ga0373962_0029589 | |||
| 838 | Ga0373931_0005421 | |||
| 839 | Ga0373931_0067938 | |||
| 840 | Ga0373935_0248134 | |||
| 841 | Ga0373947_0078060 | |||
| 842 | Ga0373947_0578427 | |||
| 843 | Ga0373937_0100142 | |||
| 844 | Ga0395899_0001360 | |||
| 845 | Ga0395899_0003797 | |||
| 846 | Ga0395899_0079183 | |||
| 847 | Ga0395900_0005085 | |||
| 848 | Ga0395900_0023734 | |||
| 849 | Ga0395900_0258504 | |||
| 850 | Ga0395900_0766618 | |||
| 851 | Ga0395900_0789907 | |||
| 852 | Ga0395898_0001821 | |||
| 853 | Ga0395898_0018646 | |||
| 854 | Ga0395898_0142037 | |||
| 855 | Ga0395898_0398249 | |||
| 856 | Ga0395905_0010094 | |||
| 857 | Ga0395905_0119176 | |||
| 858 | Ga0395901_0017741 | |||
| 859 | Ga0395901_0156973 | |||
| 860 | Ga0395901_0537324 | |||
| 861 | Ga0395901_0717977 | |||
| 862 | Ga0439438_020982 | |||
| 863 | Ga0439453_0002538 | |||
| 864 | Ga0439453_0021252 | |||
| 865 | Ga0439466_0048203 | |||
| 866 | Ga0451804_0596926 | |||
| 867 | Ga0439437_005060 | |||
| 868 | Ga0439441_031994 | |||
| 869 | Ga0439432_083569 | |||
| 870 | Ga0439451_003682 | |||
| 871 | Ga0439454_003464 | |||
| 872 | Ga0439463_097486 | |||
| 873 | Ga0450911_021476 | |||
| 874 | Ga0450920_008032 | |||
| 875 | Ga0450920_055153 | |||
| 876 | Ga0450888_017132 | |||
| 877 | Ga0450907_003474 | |||
| 878 | Ga0439446_0005137 | |||
| 879 | Ga0439446_0008264 | |||
| 880 | Ga0450908_017564 | |||
| 881 | Ga0439434_0014300 | |||
| 882 | Ga0439434_0021814 | |||
| 883 | Ga0439435_0173269 | |||
| 884 | Ga0439460_0039285 | |||
| 885 | Ga0450918_020780 | |||
| 886 | Ga0466963_0273219 | |||
| 887 | Ga0466963_0413209 | |||
| 888 | Ga0466960_0195015 | |||
| 889 | Ga0466960_0215701 | |||
| 890 | Ga0466960_0431063 | |||
| 891 | Ga0466960_0435677 | |||
| 892 | Ga0451576_0393312 | |||
| 893 | Ga0466967_0209510 | |||
| 894 | Ga0466967_0488386 | |||
| 895 | Ga0466967_0539426 | |||
| 896 | Ga0495592_0086913 | |||
| 897 | Ga0495592_0145073 | |||
| 898 | Ga0495592_0147156 | |||
| 899 | Ga0495603_0016440 | |||
| 900 | Ga0495629_0067627 | |||
| 901 | Ga0495641_0023734 | |||
| 902 | Ga0495641_0114757 | |||
| 903 | Ga0495651_0505525 | |||
| 904 | Ga0495582_0030606 | |||
| 905 | Ga0495582_0048492 | |||
| 906 | Ga0495639_0192498 | |||
| 907 | Ga0495584_0138615 | |||
| 908 | Ga0495585_0154049 | |||
| 909 | Ga0495618_0049395 | |||
| 910 | Ga0495628_0181063 | |||
| 911 | Ga0495630_0132966 | |||
| 912 | Ga0495630_0784849 | |||
| 913 | Ga0495644_0231141 | |||
| 914 | Ga0495642_0265416 | |||
| 915 | Ga0495640_0151660 | |||
| 916 | Ga0495656_0035911 | |||
| 917 | Ga0495656_0086831 | |||
| 918 | Ga0495634_0028584 | |||
| 919 | Ga0495634_0146854 | |||
| 920 | Ga0495634_0199571 | |||
| 921 | Ga0495635_0022595 | |||
| 922 | Ga0495635_0439854 | |||
| 923 | Ga0495646_0278609 | |||
| 924 | Ga0495647_0064785 | |||
| 925 | Ga0495658_0046842 | |||
| 926 | Ga0495658_0184882 | |||
| 927 | Ga0495613_0012667 | |||
| 928 | Ga0495613_0034717 | |||
| 929 | Ga0495613_0054777 | |||
| 930 | Ga0495624_0399836 | |||
| 931 | Ga0495670_0111368 | |||
| 932 | Ga0495589_0123844 | |||
| 933 | Ga0495636_0158815 | |||
| 934 | Ga0495674_0009669 | |||
| 935 | Ga0495676_0039647 | |||
| 936 | Ga0495680_0006974 | |||
| 937 | Ga0495680_0250559 | |||
| 938 | Ga0495593_0073026 | |||
| 939 | Ga0495614_0336565 | |||
| 940 | Ga0496100_0004055 | |||
| 941 | Ga0496100_0004272 | |||
| 942 | Ga0496100_0105917 | |||
| 943 | Ga0496100_0112827 | |||
| 944 | Ga0496100_0258933 | |||
| 945 | Ga0496100_0283393 | |||
| 946 | Ga0496101_0005189 | |||
| 947 | Ga0496101_0011585 | |||
| 948 | Ga0496101_0161987 | |||
| 949 | Ga0496101_0319375 | |||
| 950 | Ga0496101_0464275 | |||
| 951 | Ga0496102_0013185 | |||
| 952 | Ga0496102_0026180 | |||
| 953 | Ga0496102_0030900 | |||
| 954 | Ga0496102_0032076 | |||
| 955 | Ga0496102_0345814 | |||
| 956 | Ga0496103_0009699 | |||
| 957 | Ga0496103_0017597 | |||
| 958 | Ga0496104_0004621 | |||
| 959 | Ga0496104_0008731 | |||
| 960 | Ga0496104_0062358 | |||
| 961 | Ga0496104_0152907 | |||
| 962 | Ga0496104_0261828 | |||
| 963 | Ga0496104_0437471 | |||
| 964 | Ga0496105_0000147 | |||
| 965 | Ga0496105_0004406 | |||
| 966 | Ga0496105_0005089 | |||
| 967 | Ga0496105_0087608 | |||
| 968 | Ga0496105_0198082 | |||
| 969 | Ga0496105_0613133 | |||
| 970 | Ga0496106_0017396 | |||
| 971 | Ga0496106_0122820 | |||
| 972 | Ga0496106_0148568 | |||
| 973 | Ga0496106_0216321 | |||
| 974 | Ga0496107_0008894 | |||
| 975 | Ga0496107_0017744 | |||
| 976 | Ga0496108_0005536 | |||
| 977 | Ga0496108_0009368 | |||
| 978 | Ga0496108_0128071 | |||
| 979 | Ga0496108_0150193 | |||
| 980 | Ga0496108_0308697 | |||
| 981 | Ga0496108_0638209 | |||
| 982 | Ga0496108_0832524 | |||
| 983 | Ga0496109_0011770 | |||
| 984 | Ga0496109_0014652 | |||
| 985 | Ga0496109_0046116 | |||
| 986 | Ga0496109_0047300 | |||
| 987 | Ga0496109_0219172 | |||
| 988 | Ga0496109_0223615 | |||
| 989 | Ga0496109_0264327 | |||
| 990 | Ga0496109_0521503 | |||
| 991 | Ga0496109_0539969 | |||
| 992 | Ga0496109_1336833 | |||
| 993 | Ga0496110_0003225 | |||
| 994 | Ga0496110_0004408 | |||
| 995 | Ga0496110_0110959 | |||
| 996 | Ga0496110_0117309 | |||
| 997 | Ga0496110_0118439 | |||
| 998 | Ga0496110_0220301 | |||
| 999 | Ga0496110_0250292 | |||
| 1000 | Ga0496110_0277206 | |||
| 1001 | Ga0496110_0319114 | |||
| 1002 | Ga0496110_0323382 | |||
| 1003 | Ga0496110_0396538 | |||
| 1004 | Ga0496110_0414540 | |||
| 1005 | Ga0496111_0022064 | |||
| 1006 | Ga0496111_0314571 | |||
| 1007 | Ga0496111_0606783 | |||
| 1008 | Ga0496112_0000273 | |||
| 1009 | Ga0496112_0026858 | |||
| 1010 | Ga0496112_0046366 | |||
| 1011 | Ga0496112_0091236 | |||
| 1012 | Ga0496112_0334395 | |||
| 1013 | Ga0496112_0491808 | |||
| 1014 | Ga0496113_0012649 | |||
| 1015 | Ga0496113_0197329 | |||
| 1016 | Ga0496113_0410685 | |||
| 1017 | Ga0496114_0011069 | |||
| 1018 | Ga0496114_0029854 | |||
| 1019 | Ga0496114_0053753 | |||
| 1020 | Ga0496114_0455429 | |||
| 1021 | Ga0496115_0008795 | |||
| 1022 | Ga0501031_0002709 | |||
| 1023 | Ga0501031_0005329 | |||
| 1024 | Ga0501031_0056099 | |||
| 1025 | Ga0501031_0336062 | |||
| 1026 | Ga0501032_0024296 | |||
| 1027 | Ga0501032_0100615 | |||
| 1028 | Ga0501033_0004060 | |||
| 1029 | Ga0501033_0059105 | |||
| 1030 | Ga0501034_0337678 | |||
| 1031 | Ga0501034_0598129 | |||
| 1032 | Ga0501036_0014212 | |||
| 1033 | Ga0501036_0102222 | |||
| 1034 | Ga0501036_0111605 | |||
| 1035 | Ga0501037_0012038 | |||
| 1036 | Ga0501037_0238868 | |||
| 1037 | Ga0501037_0494763 | |||
| 1038 | Ga0501037_0599202 | |||
| 1039 | Ga0501038_0001571 | |||
| 1040 | Ga0501038_0021382 | |||
| 1041 | Ga0501039_0002091 | |||
| 1042 | Ga0501039_0009797 | |||
| 1043 | Ga0501040_0002120 | |||
| 1044 | Ga0501040_0054979 | |||
| 1045 | Ga0501040_0056672 | |||
| 1046 | Ga0501040_0292948 | |||
| 1047 | Ga0501040_0305759 | |||
| 1048 | Ga0501041_0003887 | |||
| 1049 | Ga0501041_0007898 | |||
| 1050 | Ga0501041_0011813 | |||
| 1051 | Ga0501041_0191368 | |||
| 1052 | Ga0501042_0028745 | |||
| 1053 | Ga0501042_0030365 | |||
| 1054 | Ga0501042_0032557 | |||
| 1055 | Ga0501042_0060756 | |||
| 1056 | Ga0501042_0253710 | |||
| 1057 | Ga0501042_0364346 | |||
| 1058 | Ga0501043_0005959 | |||
| 1059 | Ga0501043_0025507 | |||
| 1060 | Ga0501043_0167036 | |||
| 1061 | Ga0501046_0002584 | |||
| 1062 | Ga0501046_0015641 | |||
| 1063 | Ga0501046_0154290 | |||
| 1064 | Ga0501048_0006745 | |||
| 1065 | Ga0501048_0026491 | |||
| 1066 | Ga0501048_0064459 | |||
| 1067 | Ga0501067_0088445 | |||
| 1068 | Ga0501068_0005960 | |||
| 1069 | Ga0501068_0408555 | |||
| 1070 | Ga0501069_0029156 | |||
| 1071 | Ga0501069_0094687 | |||
| 1072 | Ga0501069_0130410 | |||
| 1073 | Ga0501070_0000120 | |||
| 1074 | Ga0501070_0002915 | |||
| 1075 | Ga0501070_0051603 | |||
| 1076 | Ga0501071_0000414 | |||
| 1077 | Ga0501071_0003032 | |||
| 1078 | Ga0501071_0130348 | |||
| 1079 | Ga0501072_0001365 | |||
| 1080 | Ga0501072_0009765 | |||
| 1081 | Ga0501072_0107570 | |||
| 1082 | Ga0501072_0223035 | |||
| 1083 | Ga0501073_0018572 | |||
| 1084 | Ga0501073_0204903 | |||
| 1085 | Ga0501074_0002927 | |||
| 1086 | Ga0501074_0038589 | |||
| 1087 | Ga0501074_0330103 | |||
| 1088 | Ga0501075_0002893 | |||
| 1089 | Ga0501075_0020421 | |||
| 1090 | Ga0501075_0039101 | |||
| 1091 | Ga0501075_0256987 | |||
| 1092 | Ga0501076_0006761 | |||
| 1093 | Ga0501076_0012750 | |||
| 1094 | Ga0501076_0098170 | |||
| 1095 | Ga0501076_0231164 | |||
| 1096 | Ga0501076_0748482 | |||
| 1097 | Ga0501077_0011600 | |||
| 1098 | Ga0501077_0029318 | |||
| 1099 | Ga0501077_0143327 | |||
| 1100 | Ga0501079_0002478 | |||
| 1101 | Ga0501079_0011437 | |||
| 1102 | Ga0501079_0025257 | |||
| 1103 | Ga0501079_0069678 | |||
| 1104 | Ga0501080_0007444 | |||
| 1105 | Ga0501080_0034154 | |||
| 1106 | Ga0501080_0073395 | |||
| 1107 | Ga0501080_0248820 | |||
| 1108 | Ga0501080_0912662 | |||
| 1109 | Ga0501081_0050953 | |||
| 1110 | Ga0501081_0061715 | |||
| 1111 | Ga0501081_0129018 | |||
| 1112 | Ga0501081_0210703 | |||
| 1113 | Ga0501081_0220198 | |||
| 1114 | Ga0501081_0449192 | |||
| 1115 | Ga0501083_0010096 | |||
| 1116 | Ga0501083_0291409 | |||
| 1117 | Ga0501035_0012324 | |||
| 1118 | Ga0501035_0022011 | |||
| 1119 | Ga0501035_0140958 | |||
| 1120 | Ga0501035_0948239 | |||
| 1121 | Ga0501044_0166602 | |||
| 1122 | Ga0501044_0321805 | |||
| 1123 | Ga0501045_0009547 | |||
| 1124 | Ga0501045_0018097 | |||
| 1125 | Ga0501045_0018428 | |||
| 1126 | Ga0501045_0265140 | |||
| 1127 | nmdc:mga00v17_256896_c1 | |||
| 1128 | nmdc:mga05p37_1501496_c1 | |||
| 1129 | nmdc:mga05p37_25240_c1 | |||
| 1130 | nmdc:mga05p37_401825_c1 | |||
| 1131 | nmdc:mga05p37_826005_c1 | |||
| 1132 | nmdc:mga0qj67_400477_c1 | |||
| 1133 | nmdc:mga08y16_1024140_c1 | |||
| 1134 | nmdc:mga08y16_1400394_c1 | |||
| 1135 | nmdc:mga0n895_138690_c1 | |||
| 1136 | nmdc:mga0n895_330352_c1 | |||
| 1137 | nmdc:mga0n895_63477_c1 | |||
| 1138 | nmdc:mga0n895_72879_c1 | |||
| 1139 | nmdc:mga0rr50_323423_c1 | |||
| 1140 | nmdc:mga0rr50_9029_c1 | |||
| 1141 | nmdc:mga08x19_37067_c1 | |||
| 1142 | nmdc:mga0a205_698001_c1 | |||
| 1143 | Ga0495601_0020622 | |||
| 1144 | Ga0495595_0037523 | |||
| 1145 | Ga0495595_0069357 | |||
| 1146 | Ga0495595_0108582 | |||
| 1147 | Ga0501084_0010243 | |||
| 1148 | Ga0501084_0012731 | |||
| 1149 | Ga0501084_0097492 | |||
| 1150 | Ga0501084_0137964 | |||
| 1151 | Ga0501084_0896898 | |||
| 1152 | Ga0590075_014794 | |||
| 1153 | Ga0590077_024222 | |||
| 1154 | Ga0501082_0020059 | |||
| 1155 | Ga0501082_1090957 | |||
| 1156 | Ga0530510_0011496 | |||
| 1157 | Ga0530510_0041729 | |||
| 1158 | Ga0530510_0223890 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.8175 | 21 | 193 |
| 1vk2-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution | 0.7966 | 17 | 189 |
| 8iir-assembly1.cif.gz_A | msmudgx h109s/q53a double mutant | 0.795 | 21 | 192 |
| 8iip-assembly1.cif.gz_A | complex form of msmudgx h109q mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx h109q | 0.7917 | 21 | 192 |
| 6ail-assembly1.cif.gz_A | crystal structure at 1.3 angstroms resolution of a novel udg, udgx, from mycobacterium smegmatis | 0.7907 | 21 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8175 | 21 | 193 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7984 | 21 | 195 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7403 | 21 | 193 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7307 | 21 | 195 | 3.40.470.10 |
| 3uobA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.669 | 39 | 187 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538DHM3-F1-model_v4 | Uracil-DNA glycosylase | 0.9839 | 4 | 118 |
|
| AF-A0A7W0Z0J1-F1-model_v4 | Uracil-DNA glycosylase | 0.9723 | 4 | 195 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A7W0Z0J1-F1-model_v4 | Uracil-DNA glycosylase | 0.9673 | 4 | 195 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A538DHM3-F1-model_v4 | Uracil-DNA glycosylase | 0.9671 | 4 | 118 |
|
| AF-A0A7V8XIA1-F1-model_v4 | Uracil-DNA glycosylase | 0.9641 | 56 | 195 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |