F465806

General Info

Members Datasets Scaffolds Average Seq Length
579 266 1158 362

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100040872|Ga0070711_1000408722
Length 381
Sequence MRFTVERRLHQPRWLAVAVPVASVAFAFFLAAIVLLVTGHNPLSTYRQLFDAAFLQTGTLDQTLIVATPLAFTGLAAAAAFRMKLFNIGAEGQLYIGAITGAAAGLYLGGRGGSSVFVISAMVVMGCLGGAAWGLIPGILRAFFKTSEILTSLLLNYVAGLLLTYLIFESQSYWRQTKGFNATVFPTGKPLPPSAVWPSWTIDVQGGVTVPLGAVLAVVVAVVLWVLYKRTRFGFEAEVLGDSDRAARYSGVRVRRKILAVMALSGAIAGLGGASQVGDFAHSVDGDPNGLQKLGYGYTGIVIAALARYNPFAVVLVAFLMGGLENAGNTLQGANFPAGLVGVIQGIILFSALGGEVLVRHRVRIVRTNRGGAAPGLEPAA

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
154 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
155 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 15.54
Rhizosphere 84.11
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100040872 3300005439 Bacteria 3130
2 JGI24738J21930_10005909 3300002075 Bacteria 2905
3 JGI25406J46586_10003236 3300003203 Bacteria 7662
4 Ga0070658_10040351 3300005327 Bacteria 3765
5 Ga0070683_100007449 3300005329 Bacteria 9246
6 Ga0070683_100083613 3300005329 Bacteria 2990
7 Ga0070683_100230525 3300005329 Bacteria 1761
8 Ga0070670_100003392 3300005331 Bacteria 13202
9 Ga0070670_100041146 3300005331 Bacteria 3971
10 Ga0068869_100206557 3300005334 Bacteria 1551
11 Ga0070682_100019948 3300005337 Bacteria 3938
12 Ga0070682_100033749 3300005337 Bacteria 3111
13 Ga0070682_100054632 3300005337 Bacteria 2507
14 Ga0070682_100181781 3300005337 Bacteria 1470
15 Ga0070682_100214905 3300005337 Bacteria 1365
16 Ga0068868_100048582 3300005338 Bacteria 3328
17 Ga0068868_100064503 3300005338 Bacteria 2908
18 Ga0068868_100136220 3300005338 Bacteria 2013
19 Ga0070660_100003055 3300005339 Bacteria 11513
20 Ga0070660_100071474 3300005339 Bacteria 2709
21 Ga0070689_100017164 3300005340 Bacteria 5310
22 Ga0070689_100060011 3300005340 Bacteria 2956
23 Ga0070691_10053162 3300005341 Bacteria 1937
24 Ga0070687_100074015 3300005343 Bacteria 1838
25 Ga0070661_100079415 3300005344 Bacteria 2421
26 Ga0070692_10010240 3300005345 Bacteria 4259
27 Ga0070668_100142386 3300005347 Bacteria 1933
28 Ga0070669_100216069 3300005353 Bacteria 1514
29 Ga0070675_100001435 3300005354 Bacteria 17496
30 Ga0070675_100165160 3300005354 Bacteria 1906
31 Ga0070671_100016937 3300005355 Bacteria 5895
32 Ga0070671_100147993 3300005355 Bacteria 1983
33 Ga0070674_100001639 3300005356 Bacteria 12060
34 Ga0070674_100004240 3300005356 Bacteria 8151
35 Ga0070674_100010175 3300005356 Bacteria 5667
36 Ga0070674_100057665 3300005356 Bacteria 2696
37 Ga0070674_100097286 3300005356 Bacteria 2137
38 Ga0070674_100106503 3300005356 Bacteria 2052
39 Ga0070673_100004042 3300005364 Bacteria 9232
40 Ga0070673_100011881 3300005364 Bacteria 5961
41 Ga0070673_100209754 3300005364 Bacteria 1682
42 Ga0070688_100003618 3300005365 Bacteria 7979
43 Ga0070688_100022193 3300005365 Bacteria 3715
44 Ga0070659_100014935 3300005366 Bacteria 5808
45 Ga0070703_10025805 3300005406 Bacteria 1744
46 Ga0070714_100015959 3300005435 Bacteria 6056
47 Ga0070714_100035496 3300005435 Bacteria 4179
48 Ga0070713_100019632 3300005436 Bacteria 5167
49 Ga0070713_100060206 3300005436 Bacteria 3174
50 Ga0070710_10009872 3300005437 Bacteria 4679
51 Ga0070701_10006948 3300005438 Bacteria 4800
52 Ga0070701_10036751 3300005438 Bacteria 2469
53 Ga0070701_10082803 3300005438 Bacteria 1741
54 Ga0070711_100008489 3300005439 Bacteria 6293
55 Ga0070705_100028434 3300005440 Bacteria 3062
56 Ga0070705_100038467 3300005440 Bacteria 2707
57 Ga0070700_100009253 3300005441 Bacteria 5402
58 Ga0070700_100012443 3300005441 Bacteria 4750
59 Ga0070700_100054191 3300005441 Bacteria 2505
60 Ga0070708_100057529 3300005445 Bacteria 3462
61 Ga0070678_100002181 3300005456 Bacteria 10639
62 Ga0070678_100003522 3300005456 Bacteria 8733
63 Ga0070678_100004543 3300005456 Bacteria 7882
64 Ga0070678_100013281 3300005456 Bacteria 5157
65 Ga0070678_100031406 3300005456 Bacteria 3664
66 Ga0070678_100117391 3300005456 Bacteria 2092
67 Ga0070678_100206123 3300005456 Bacteria 1626
68 Ga0070678_100248412 3300005456 Bacteria 1491
69 Ga0070681_10054990 3300005458 Bacteria 3965
70 Ga0068867_100029114 3300005459 Bacteria 3979
71 Ga0068867_100113995 3300005459 Bacteria 2081
72 Ga0068867_100165518 3300005459 Bacteria 1747
73 Ga0070685_10015833 3300005466 Bacteria 4009
74 Ga0070685_10019835 3300005466 Bacteria 3632
75 Ga0070685_10239014 3300005466 Bacteria 1198
76 Ga0070706_100017676 3300005467 Bacteria 6581
77 Ga0070706_100092737 3300005467 Bacteria 2802
78 Ga0070707_100004690 3300005468 Bacteria 12810
79 Ga0070707_100015887 3300005468 Bacteria 7066
80 Ga0070698_100012752 3300005471 Bacteria 8901
81 Ga0070698_100033813 3300005471 Bacteria 5296
82 Ga0070699_100008247 3300005518 Bacteria 9036
83 Ga0070699_100025063 3300005518 Bacteria 5142
84 Ga0070699_100071941 3300005518 Bacteria 3008
85 Ga0070699_100201077 3300005518 Bacteria 1772
86 Ga0070684_100007182 3300005535 Bacteria 8656
87 Ga0070684_100022555 3300005535 Bacteria 5253
88 Ga0070684_100085419 3300005535 Bacteria 2798
89 Ga0070684_100300122 3300005535 Bacteria 1474
90 Ga0070697_100054651 3300005536 Bacteria 3246
91 Ga0068853_100048708 3300005539 Bacteria 3640
92 Ga0070672_100024072 3300005543 Bacteria 4494
93 Ga0070686_100026338 3300005544 Bacteria 3509
94 Ga0070686_100031872 3300005544 Bacteria 3227
95 Ga0070686_100096631 3300005544 Bacteria 1987
96 Ga0070695_100101547 3300005545 Bacteria 1938
97 Ga0070696_100019741 3300005546 Bacteria 4567
98 Ga0070696_100252175 3300005546 Bacteria 1335
99 Ga0070693_100004438 3300005547 Bacteria 6635
100 Ga0070693_100008448 3300005547 Bacteria 5078
101 Ga0070665_100009097 3300005548 Bacteria 10062
102 Ga0070664_100052128 3300005564 Bacteria 3465
103 Ga0070664_100086043 3300005564 Bacteria 2716
104 Ga0068854_100021965 3300005578 Bacteria 4339
105 Ga0068856_100010772 3300005614 Bacteria 8880
106 Ga0068856_100059976 3300005614 Bacteria 3759
107 Ga0068856_100155036 3300005614 Bacteria 2300
108 Ga0070702_100005529 3300005615 Bacteria 5901
109 Ga0070702_100007316 3300005615 Bacteria 5281
110 Ga0070702_100015432 3300005615 Bacteria 3900
111 Ga0068852_100016506 3300005616 Bacteria 5761
112 Ga0068859_100052861 3300005617 Bacteria 4085
113 Ga0068864_100005717 3300005618 Bacteria 10193
114 Ga0068866_10007133 3300005718 Bacteria 4672
115 Ga0068866_10007987 3300005718 Bacteria 4444
116 Ga0068866_10038043 3300005718 Bacteria 2367
117 Ga0068870_10016018 3300005840 Bacteria 3572
118 Ga0068860_100056183 3300005843 Bacteria 3743
119 Ga0068860_100129770 3300005843 Bacteria 2418
120 Ga0068862_100065538 3300005844 Bacteria 3129
121 Ga0068862_100120988 3300005844 Bacteria 2307
122 Ga0081455_10011450 3300005937 Bacteria 8912
123 Ga0081455_10113247 3300005937 Bacteria 2152
124 Ga0081539_10000244 3300005985 Bacteria 127514
125 Ga0070717_10006208 3300006028 Bacteria 8776
126 Ga0070717_10267500 3300006028 Bacteria 1513
127 Ga0070717_10320644 3300006028 Bacteria 1381
128 Ga0075432_10008593 3300006058 Bacteria 3485
129 Ga0070715_10023158 3300006163 Bacteria 2430
130 Ga0070715_10023619 3300006163 Bacteria 2412
131 Ga0070716_100047375 3300006173 Bacteria 2425
132 Ga0070712_100118444 3300006175 Bacteria 1989
133 Ga0097621_100004896 3300006237 Bacteria 9388
134 Ga0097621_100011611 3300006237 Bacteria 6494
135 Ga0097621_100032298 3300006237 Bacteria 4160
136 Ga0097621_100040339 3300006237 Bacteria 3753
137 Ga0097621_100155274 3300006237 Bacteria 1964
138 Ga0068871_100003811 3300006358 Bacteria 10395
139 Ga0068871_100010425 3300006358 Bacteria 6781
140 Ga0068871_100234496 3300006358 Bacteria 1594
141 Ga0075428_100263456 3300006844 Bacteria 1856
142 Ga0075434_100032010 3300006871 Bacteria 5184
143 Ga0075429_100261323 3300006880 Bacteria 1516
144 Ga0068865_100006678 3300006881 Bacteria 7056
145 Ga0068865_100034333 3300006881 Bacteria 3403
146 Ga0068865_100049439 3300006881 Bacteria 2898
147 Ga0068865_100050958 3300006881 Bacteria 2863
148 Ga0068865_100198658 3300006881 Bacteria 1556
149 Ga0097620_100052863 3300006931 Bacteria 4085
150 Ga0075435_100020038 3300007076 Bacteria 5115
151 Ga0111539_10076215 3300009094 Bacteria 3949
152 Ga0111539_10128599 3300009094 Bacteria 2967
153 Ga0111539_10185350 3300009094 Bacteria 2430
154 Ga0111539_10462038 3300009094 Bacteria 1478
155 Ga0105245_10018015 3300009098 Bacteria 6168
156 Ga0105245_10020922 3300009098 Bacteria 5735
157 Ga0105245_10079939 3300009098 Bacteria 2986
158 Ga0105245_10094226 3300009098 Bacteria 2760
159 Ga0105245_10194839 3300009098 Bacteria 1943
160 Ga0105245_10224775 3300009098 Bacteria 1813
161 Ga0105247_10005276 3300009101 Bacteria 8155
162 Ga0114129_10085611 3300009147 Bacteria 4373
163 Ga0114129_10110921 3300009147 Bacteria 3786
164 Ga0114129_10123135 3300009147 Bacteria 3567
165 Ga0114129_10695665 3300009147 Bacteria 1307
166 Ga0105243_10001545 3300009148 Bacteria 20121
167 Ga0105243_10013203 3300009148 Bacteria 6245
168 Ga0105243_10044613 3300009148 Bacteria 3479
169 Ga0105241_10195302 3300009174 Bacteria 1687
170 Ga0105242_10006264 3300009176 Bacteria 9162
171 Ga0105242_10039931 3300009176 Bacteria 3780
172 Ga0105242_10085131 3300009176 Bacteria 2651
173 Ga0105242_10099795 3300009176 Bacteria 2458
174 Ga0105248_10127714 3300009177 Bacteria 2868
175 Ga0105248_10162292 3300009177 Bacteria 2520
176 Ga0105248_10249400 3300009177 Bacteria 1998
177 Ga0105238_10241859 3300009551 Bacteria 1782
178 Ga0105239_10027277 3300010375 Bacteria 6288
179 Ga0105239_10122181 3300010375 Bacteria 2893
180 Ga0105246_10133618 3300011119 Bacteria 1857
181 Ga0157371_10039631 3300013102 Bacteria 3369
182 Ga0157371_10072766 3300013102 Bacteria 2434
183 Ga0157370_10103330 3300013104 Bacteria 2667
184 Ga0157369_10012637 3300013105 Bacteria 9574
185 Ga0157369_10029750 3300013105 Bacteria 6033
186 Ga0157374_10142254 3300013296 Bacteria 2329
187 Ga0157374_10173775 3300013296 Bacteria 2102
188 Ga0157378_10024182 3300013297 Bacteria 5343
189 Ga0157378_10027833 3300013297 Bacteria 4985
190 Ga0157372_10047104 3300013307 Bacteria 4789
191 Ga0157375_10005283 3300013308 Bacteria 11216
192 Ga0157375_10143218 3300013308 Bacteria 2519
193 Ga0157375_10447094 3300013308 Bacteria 1458
194 Ga0163163_10021065 3300014325 Bacteria 6149
195 Ga0163163_10517017 3300014325 Bacteria 1256
196 Ga0157380_10050537 3300014326 Bacteria 3284
197 Ga0157377_10003742 3300014745 Bacteria 6901
198 Ga0157377_10027790 3300014745 Bacteria 3040
199 Ga0157377_10057477 3300014745 Bacteria 2212
200 Ga0157379_10014425 3300014968 Bacteria 6932
201 Ga0157379_10107644 3300014968 Bacteria 2503
202 Ga0157379_10153353 3300014968 Bacteria 2078
203 Ga0157376_10001626 3300014969 Bacteria 14877
204 Ga0157376_10022656 3300014969 Bacteria 4901
205 Ga0157376_10131713 3300014969 Bacteria 2232
206 Ga0157376_10263720 3300014969 Bacteria 1615
207 Ga0207692_10004733 3300025898 Bacteria 5406
208 Ga0207642_10029367 3300025899 Bacteria 2276
209 Ga0207642_10056010 3300025899 Bacteria 1807
210 Ga0207642_10098824 3300025899 Bacteria 1460
211 Ga0207710_10003335 3300025900 Bacteria 7174
212 Ga0207688_10002806 3300025901 Bacteria 9457
213 Ga0207680_10084316 3300025903 Bacteria 2005
214 Ga0207699_10074354 3300025906 Bacteria 2087
215 Ga0207645_10028925 3300025907 Bacteria 3574
216 Ga0207643_10049309 3300025908 Bacteria 2386
217 Ga0207684_10160472 3300025910 Bacteria 1936
218 Ga0207693_10003565 3300025915 Bacteria 13299
219 Ga0207693_10034806 3300025915 Bacteria 3972
220 Ga0207693_10075473 3300025915 Bacteria 2640
221 Ga0207663_10025943 3300025916 Bacteria 3395
222 Ga0207663_10079863 3300025916 Bacteria 2137
223 Ga0207660_10039205 3300025917 Bacteria 3310
224 Ga0207660_10089832 3300025917 Bacteria 2275
225 Ga0207662_10011313 3300025918 Bacteria 4943
226 Ga0207662_10108533 3300025918 Bacteria 1728
227 Ga0207662_10198890 3300025918 Bacteria 1296
228 Ga0207657_10002463 3300025919 Bacteria 20019
229 Ga0207657_10032997 3300025919 Bacteria 4671
230 Ga0207649_10039196 3300025920 Bacteria 2871
231 Ga0207652_10014627 3300025921 Bacteria 6360
232 Ga0207652_10192877 3300025921 Bacteria 1832
233 Ga0207646_10001592 3300025922 Bacteria 27715
234 Ga0207646_10085894 3300025922 Bacteria 2814
235 Ga0207646_10112127 3300025922 Bacteria 2448
236 Ga0207681_10131069 3300025923 Bacteria 1854
237 Ga0207694_10214402 3300025924 Bacteria 1569
238 Ga0207650_10013924 3300025925 Bacteria 5579
239 Ga0207650_10026761 3300025925 Bacteria 4119
240 Ga0207659_10194208 3300025926 Bacteria 1617
241 Ga0207659_10276598 3300025926 Bacteria 1371
242 Ga0207687_10053696 3300025927 Bacteria 2816
243 Ga0207687_10055241 3300025927 Bacteria 2782
244 Ga0207687_10083266 3300025927 Bacteria 2316
245 Ga0207687_10116403 3300025927 Bacteria 1992
246 Ga0207664_10004972 3300025929 Bacteria 9039
247 Ga0207664_10107020 3300025929 Bacteria 2320
248 Ga0207644_10129725 3300025931 Bacteria 1929
249 Ga0207690_10018040 3300025932 Bacteria 4322
250 Ga0207686_10101679 3300025934 Bacteria 1920
251 Ga0207709_10006975 3300025935 Bacteria 6316
252 Ga0207709_10033140 3300025935 Bacteria 3031
253 Ga0207670_10089796 3300025936 Bacteria 2169
254 Ga0207669_10016708 3300025937 Bacteria 3738
255 Ga0207669_10028287 3300025937 Bacteria 3082
256 Ga0207669_10036913 3300025937 Bacteria 2798
257 Ga0207669_10150106 3300025937 Bacteria 1631
258 Ga0207704_10015232 3300025938 Bacteria 3912
259 Ga0207704_10051375 3300025938 Bacteria 2492
260 Ga0207704_10081363 3300025938 Bacteria 2094
261 Ga0207665_10007966 3300025939 Bacteria 6995
262 Ga0207665_10071709 3300025939 Bacteria 2365
263 Ga0207691_10243766 3300025940 Bacteria 1553
264 Ga0207711_10209470 3300025941 Bacteria 1780
265 Ga0207689_10279230 3300025942 Bacteria 1383
266 Ga0207661_10062363 3300025944 Bacteria 3016
267 Ga0207661_10071162 3300025944 Bacteria 2841
268 Ga0207661_10168637 3300025944 Bacteria 1904
269 Ga0207679_10130778 3300025945 Bacteria 2013
270 Ga0207667_10123102 3300025949 Bacteria 2672
271 Ga0207651_10109723 3300025960 Bacteria 2068
272 Ga0207712_10031946 3300025961 Bacteria 3550
273 Ga0207668_10121729 3300025972 Bacteria 1977
274 Ga0207677_10154768 3300026023 Bacteria 1774
275 Ga0207677_10186037 3300026023 Bacteria 1638
276 Ga0207703_10081534 3300026035 Bacteria 2697
277 Ga0207703_10296502 3300026035 Bacteria 1473
278 Ga0207703_10440347 3300026035 Bacteria 1216
279 Ga0207639_10323203 3300026041 Bacteria 1371
280 Ga0207708_10008151 3300026075 Bacteria 7759
281 Ga0207708_10019851 3300026075 Bacteria 5067
282 Ga0207708_10035303 3300026075 Bacteria 3805
283 Ga0207708_10066345 3300026075 Bacteria 2759
284 Ga0207702_10019815 3300026078 Bacteria 5570
285 Ga0207702_10065478 3300026078 Bacteria 3112
286 Ga0207702_10088076 3300026078 Bacteria 2711
287 Ga0207648_10004050 3300026089 Bacteria 15221
288 Ga0207648_10224567 3300026089 Bacteria 1670
289 Ga0207648_10396178 3300026089 Bacteria 1250
290 Ga0207676_10193084 3300026095 Bacteria 1793
291 Ga0207674_10118356 3300026116 Bacteria 2619
292 Ga0207675_100057063 3300026118 Bacteria 3642
293 Ga0207675_100145108 3300026118 Bacteria 2256
294 Ga0207683_10000903 3300026121 Bacteria 27320
295 Ga0207683_10002338 3300026121 Bacteria 16626
296 Ga0207683_10004835 3300026121 Bacteria 11599
297 Ga0207683_10010245 3300026121 Bacteria 7992
298 Ga0207683_10015871 3300026121 Bacteria 6413
299 Ga0207683_10023675 3300026121 Bacteria 5283
300 Ga0207683_10030797 3300026121 Bacteria 4651
301 Ga0207683_10151843 3300026121 Bacteria 2090
302 Ga0207428_10024199 3300027907 Bacteria 5101
303 Ga0207428_10036157 3300027907 Bacteria 4030
304 Ga0268264_10140921 3300028381 Bacteria 2150
305 Ga0265337_1023838 3300028556 Bacteria 1878
306 Ga0265319_1002293 3300028563 Bacteria 10554
307 Ga0265334_10001486 3300028573 Bacteria 11301
308 Ga0265318_10001895 3300028577 Bacteria 11726
309 Ga0265318_10003972 3300028577 Bacteria 7285
310 Ga0265318_10022292 3300028577 Bacteria 2535
311 Ga0265318_10028578 3300028577 Bacteria 2180
312 Ga0265322_10003782 3300028654 Bacteria 4550
313 Ga0265322_10005149 3300028654 Bacteria 3871
314 Ga0265322_10011993 3300028654 Bacteria 2507
315 Ga0265336_10024021 3300028666 Bacteria 1929
316 Ga0265338_10010376 3300028800 Bacteria 10931
317 Ga0265338_10014603 3300028800 Bacteria 8718
318 Ga0265338_10017277 3300028800 Bacteria 7786
319 Ga0265338_10018370 3300028800 Bacteria 7488
320 Ga0265338_10026869 3300028800 Bacteria 5792
321 Ga0265330_10002675 3300031235 Bacteria 9628
322 Ga0265330_10017895 3300031235 Bacteria 3259
323 Ga0265330_10059647 3300031235 Bacteria 1661
324 Ga0265332_10011290 3300031238 Bacteria 3971
325 Ga0265332_10050842 3300031238 Bacteria 1781
326 Ga0265320_10005814 3300031240 Bacteria 7857
327 Ga0265320_10024586 3300031240 Bacteria 3184
328 Ga0265325_10000549 3300031241 Bacteria 27215
329 Ga0265329_10019300 3300031242 Bacteria 2317
330 Ga0265340_10017013 3300031247 Bacteria 3760
331 Ga0265339_10006675 3300031249 Bacteria 7543
332 Ga0265339_10029032 3300031249 Bacteria 3141
333 Ga0265339_10066577 3300031249 Bacteria 1928
334 Ga0265327_10015488 3300031251 Bacteria 4914
335 Ga0265327_10020934 3300031251 Bacteria 3964
336 Ga0265327_10026890 3300031251 Bacteria 3323
337 Ga0265327_10029431 3300031251 Bacteria 3124
338 Ga0265316_10009735 3300031344 Bacteria 8824
339 Ga0265316_10015484 3300031344 Bacteria 6665
340 Ga0265316_10021838 3300031344 Bacteria 5410
341 Ga0265316_10031870 3300031344 Bacteria 4307
342 Ga0265316_10089615 3300031344 Bacteria 2347
343 Ga0265313_10002613 3300031595 Bacteria 15334
344 Ga0265313_10019104 3300031595 Bacteria 3828
345 Ga0265314_10006396 3300031711 Bacteria 10437
346 Ga0265314_10011505 3300031711 Bacteria 7298
347 Ga0265314_10028685 3300031711 Bacteria 4146
348 Ga0265314_10148509 3300031711 Bacteria 1440
349 Ga0265342_10005464 3300031712 Bacteria 9675
350 Ga0265342_10072425 3300031712 Bacteria 2005
351 Ga0373951_0017991 3300035091 Bacteria 1603
352 Ga0373952_0013134 3300035092 Bacteria 1638
353 Ga0373952_0016069 3300035092 Bacteria 1517
354 Ga0373942_0005116 3300035207 Bacteria 3040
355 Ga0373961_0021324 3300035241 Bacteria 1722
356 Ga0373931_0015781 3300035691 Bacteria 3708
357 Ga0373931_0084214 3300035691 Bacteria 1760
358 Ga0373947_0017158 3300035725 Bacteria 4163
359 Ga0373937_0006259 3300036401 Bacteria 10269
360 Ga0373937_0120078 3300036401 Bacteria 2449
361 Ga0395899_0031739 3300037312 Bacteria 3969
362 Ga0395899_0038777 3300037312 Bacteria 3567
363 Ga0395899_0147269 3300037312 Bacteria 1671
364 Ga0395900_0002584 3300037418 Bacteria 19827
365 Ga0395900_0002845 3300037418 Bacteria 18882
366 Ga0395900_0004700 3300037418 Bacteria 14396
367 Ga0395900_0028796 3300037418 Bacteria 5694
368 Ga0395900_0030697 3300037418 Bacteria 5519
369 Ga0395900_0127924 3300037418 Bacteria 2604
370 Ga0395900_0149916 3300037418 Bacteria 2383
371 Ga0395898_0004894 3300037466 Bacteria 14544
372 Ga0395898_0005978 3300037466 Bacteria 13070
373 Ga0395898_0009809 3300037466 Bacteria 10035
374 Ga0395898_0021501 3300037466 Bacteria 6543
375 Ga0395905_0012888 3300037471 Bacteria 8036
376 Ga0395905_0053853 3300037471 Bacteria 3765
377 Ga0395905_0102666 3300037471 Bacteria 2684
378 Ga0395905_0110634 3300037471 Bacteria 2580
379 Ga0395905_0149471 3300037471 Bacteria 2198
380 Ga0395905_0216636 3300037471 Bacteria 1793
381 Ga0395905_0251367 3300037471 Bacteria 1651
382 Ga0395905_0300755 3300037471 Bacteria 1492
383 Ga0395901_0002794 3300038443 Bacteria 17608
384 Ga0395901_0003307 3300038443 Bacteria 16233
385 Ga0395901_0020352 3300038443 Bacteria 6792
386 Ga0395901_0028729 3300038443 Bacteria 5722
387 Ga0395901_0034134 3300038443 Bacteria 5253
388 Ga0395901_0047358 3300038443 Bacteria 4464
389 Ga0395901_0202536 3300038443 Bacteria 2080
390 Ga0400483_224466 3300039062 Bacteria 4149
391 Ga0451807_0876225 3300041486 Bacteria 2941
392 Ga0466966_0053869 3300044684 Bacteria 2551
393 Ga0466961_0028493 3300044693 Bacteria 3591
394 Ga0466961_0168799 3300044693 Bacteria 1361
395 Ga0466963_0008555 3300044694 Bacteria 6142
396 Ga0466968_0011737 3300044735 Bacteria 3417
397 Ga0466970_0096872 3300044765 Bacteria 1605
398 Ga0466957_0047707 3300044842 Bacteria 2603
399 Ga0466957_0064062 3300044842 Archaea 2261
400 Ga0466957_0216226 3300044842 Bacteria 1264
401 Ga0466959_0022424 3300045049 Bacteria 4668
402 Ga0451576_0205552 3300045051 Bacteria 2056
403 Ga0466958_0022890 3300045836 Bacteria 3664
404 Ga0466958_0026781 3300045836 Bacteria 3408
405 Ga0466967_0000761 3300045976 Bacteria 16639
406 Ga0466967_0062770 3300045976 Bacteria 3299
407 Ga0466967_0071588 3300045976 Bacteria 3105
408 Ga0466967_0222498 3300045976 Bacteria 1794
409 Ga0466967_0239044 3300045976 Bacteria 1732
410 Ga0495603_0001198 3300046455 Bacteria 15133
411 Ga0495603_0017766 3300046455 Bacteria 4305
412 Ga0495603_0049476 3300046455 Bacteria 2502
413 Ga0495603_0059682 3300046455 Bacteria 2255
414 Ga0495641_0001460 3300046461 Bacteria 20059
415 Ga0495653_0118686 3300046463 Bacteria 1889
416 Ga0495580_0094317 3300046472 Bacteria 2082
417 Ga0495582_0025878 3300046473 Bacteria 3215
418 Ga0495582_0077959 3300046473 Bacteria 1838
419 Ga0495605_0027945 3300046474 Bacteria 2917
420 Ga0495605_0095411 3300046474 Bacteria 1373
421 Ga0495662_0051531 3300046476 Bacteria 1987
422 Ga0495664_0106198 3300046477 Bacteria 1693
423 Ga0495584_0080506 3300046491 Bacteria 1639
424 Ga0495594_0005945 3300046499 Bacteria 6274
425 Ga0495594_0065844 3300046499 Bacteria 2010
426 Ga0495608_0137227 3300046511 Bacteria 1562
427 Ga0495618_0030614 3300046514 Bacteria 3362
428 Ga0495628_0131258 3300046516 Bacteria 1916
429 Ga0495630_0060432 3300046517 Bacteria 2844
430 Ga0495666_0004989 3300046526 Bacteria 6716
431 Ga0495587_0048075 3300046536 Bacteria 2527
432 Ga0495587_0053100 3300046536 Bacteria 2390
433 Ga0495587_0132801 3300046536 Unclassified 1423
434 Ga0495645_0152027 3300046543 Bacteria 1607
435 Ga0495667_0015982 3300046559 Bacteria 5072
436 Ga0495656_0047931 3300046615 Bacteria 1814
437 Ga0495634_0102599 3300046642 Bacteria 1847
438 Ga0495635_0031651 3300046663 Bacteria 3671
439 Ga0495635_0103825 3300046663 Bacteria 1942
440 Ga0495659_0030350 3300046664 Bacteria 1881
441 Ga0495657_0014202 3300046675 Bacteria 5852
442 Ga0495623_0017665 3300046679 Bacteria 4607
443 Ga0495658_0102542 3300046683 Bacteria 1710
444 Ga0495613_0137489 3300046689 Bacteria 1747
445 Ga0495600_0047315 3300046809 Bacteria 2805
446 Ga0495581_0001035 3300047315 Bacteria 15047
447 Ga0495604_0030126 3300047317 Bacteria 4312
448 Ga0495674_0085135 3300047319 Bacteria 2708
449 Ga0495674_0158740 3300047319 Bacteria 1893
450 Ga0495676_0088396 3300047321 Bacteria 2324
451 Ga0495675_0085538 3300047444 Bacteria 1983
452 Ga0495684_0022774 3300047471 Bacteria 4818
453 Ga0495684_0037967 3300047471 Bacteria 3694
454 Ga0495602_0151293 3300048088 Bacteria 1824
455 Ga0495602_0256383 3300048088 Bacteria 1300
456 Ga0496100_0045971 3300048903 Bacteria 2804
457 Ga0496100_0063521 3300048903 Bacteria 2440
458 Ga0496101_0003097 3300048904 Bacteria 10285
459 Ga0496101_0024210 3300048904 Bacteria 4200
460 Ga0496101_0034004 3300048904 Bacteria 3599
461 Ga0496101_0042128 3300048904 Bacteria 3259
462 Ga0496101_0077198 3300048904 Bacteria 2455
463 Ga0496102_0012458 3300048905 Bacteria 7360
464 Ga0496102_0028420 3300048905 Bacteria 4994
465 Ga0496102_0105150 3300048905 Bacteria 2626
466 Ga0496102_0163062 3300048905 Bacteria 2097
467 Ga0496103_0008947 3300048906 Bacteria 5936
468 Ga0496103_0021723 3300048906 Bacteria 3862
469 Ga0496103_0021981 3300048906 Bacteria 3839
470 Ga0496104_0000134 3300048907 Bacteria 68737
471 Ga0496104_0000381 3300048907 Bacteria 38927
472 Ga0496104_0004306 3300048907 Bacteria 12376
473 Ga0496104_0043634 3300048907 Bacteria 4211
474 Ga0496104_0071080 3300048907 Bacteria 3309
475 Ga0496104_0097064 3300048907 Bacteria 2820
476 Ga0496104_0103190 3300048907 Bacteria 2732
477 Ga0496104_0205764 3300048907 Bacteria 1880
478 Ga0496105_0000484 3300048908 Bacteria 26155
479 Ga0496105_0001378 3300048908 Bacteria 17065
480 Ga0496105_0001956 3300048908 Bacteria 14786
481 Ga0496105_0035603 3300048908 Bacteria 4097
482 Ga0496105_0108054 3300048908 Bacteria 2297
483 Ga0496105_0135922 3300048908 Bacteria 2025
484 Ga0496106_0007242 3300048909 Bacteria 8195
485 Ga0496106_0034994 3300048909 Bacteria 3754
486 Ga0496106_0097949 3300048909 Bacteria 2271
487 Ga0496106_0119222 3300048909 Bacteria 2061
488 Ga0496107_0003801 3300048910 Bacteria 10137
489 Ga0496107_0009143 3300048910 Bacteria 6869
490 Ga0496107_0053790 3300048910 Bacteria 2904
491 Ga0496107_0063687 3300048910 Bacteria 2672
492 Ga0496107_0082042 3300048910 Bacteria 2351
493 Ga0496107_0165979 3300048910 Bacteria 1637
494 Ga0496107_0182196 3300048910 Bacteria 1560
495 Ga0496108_0001238 3300048911 Bacteria 20020
496 Ga0496108_0001352 3300048911 Bacteria 19278
497 Ga0496108_0002726 3300048911 Bacteria 14130
498 Ga0496108_0013849 3300048911 Bacteria 6578
499 Ga0496108_0081489 3300048911 Bacteria 2742
500 Ga0496108_0082219 3300048911 Bacteria 2730
501 Ga0496108_0094053 3300048911 Bacteria 2551
502 Ga0496109_0000533 3300048912 Bacteria 32234
503 Ga0496109_0000806 3300048912 Bacteria 26126
504 Ga0496109_0000898 3300048912 Bacteria 24813
505 Ga0496109_0001686 3300048912 Bacteria 18402
506 Ga0496109_0026172 3300048912 Bacteria 5200
507 Ga0496109_0032903 3300048912 Bacteria 4664
508 Ga0496110_0000164 3300048913 Bacteria 40268
509 Ga0496110_0000905 3300048913 Bacteria 20843
510 Ga0496110_0005794 3300048913 Bacteria 9714
511 Ga0496110_0006347 3300048913 Bacteria 9346
512 Ga0496110_0077512 3300048913 Bacteria 2957
513 Ga0496110_0088930 3300048913 Bacteria 2759
514 Ga0496110_0089428 3300048913 Bacteria 2752
515 Ga0496110_0167923 3300048913 Bacteria 1990
516 Ga0496110_0187760 3300048913 Bacteria 1877
517 Ga0496110_0196612 3300048913 Bacteria 1831
518 Ga0496110_0250314 3300048913 Bacteria 1612
519 Ga0496111_0000043 3300048914 Bacteria 49176
520 Ga0496111_0000083 3300048914 Bacteria 39397
521 Ga0496111_0000295 3300048914 Bacteria 24339
522 Ga0496111_0002679 3300048914 Bacteria 10821
523 Ga0496111_0013798 3300048914 Bacteria 5507
524 Ga0496111_0014302 3300048914 Bacteria 5418
525 Ga0496112_0000145 3300048915 Bacteria 44395
526 Ga0496112_0099991 3300048915 Bacteria 2870
527 Ga0496112_0165380 3300048915 Bacteria 2178
528 Ga0496113_0000298 3300048916 Bacteria 23527
529 Ga0496113_0160777 3300048916 Bacteria 1775
530 Ga0496114_0002188 3300048917 Bacteria 14888
531 Ga0496114_0005906 3300048917 Bacteria 9620
532 Ga0496114_0015924 3300048917 Bacteria 6051
533 Ga0496114_0019055 3300048917 Bacteria 5560
534 Ga0496114_0026001 3300048917 Bacteria 4789
535 Ga0496114_0049136 3300048917 Bacteria 3509
536 Ga0496114_0059109 3300048917 Bacteria 3202
537 Ga0496114_0168928 3300048917 Bacteria 1905
538 Ga0496114_0183963 3300048917 Bacteria 1825
539 Ga0496114_0359730 3300048917 Bacteria 1287
540 Ga0496115_0020235 3300048918 Bacteria 5131
541 Ga0496115_0039977 3300048918 Bacteria 3727
542 Ga0496115_0042663 3300048918 Bacteria 3615
543 Ga0496115_0042670 3300048918 Bacteria 3614
544 Ga0496115_0220655 3300048918 Bacteria 1564
545 Ga0501041_0059640 3300049577 Bacteria 2336
546 Ga0501047_0020148 3300049581 Bacteria 6403
547 Ga0501047_0089071 3300049581 Bacteria 2963
548 Ga0501067_0095635 3300049583 Bacteria 1649
549 Ga0501068_0101565 3300049584 Bacteria 1783
550 Ga0501069_0123922 3300049585 Bacteria 1477
551 Ga0501072_0263120 3300049588 Bacteria 1373
552 Ga0501074_0095402 3300049590 Bacteria 2130
553 Ga0501076_0057695 3300049592 Bacteria 3084
554 Ga0501077_0023853 3300049593 Bacteria 3880
555 Ga0501079_0046754 3300049741 Bacteria 3340
556 Ga0501079_0334893 3300049741 Bacteria 1185
557 Ga0501080_0205560 3300049742 Bacteria 1806
558 Ga0501080_0209588 3300049742 Bacteria 1786
559 Ga0501080_0408174 3300049742 Bacteria 1221
560 Ga0501081_0016057 3300049743 Bacteria 4946
561 Ga0501044_0201226 3300049823 Bacteria 1950
562 nmdc:mga0yw44_76390_c1 3300050492 Bacteria 2090
563 nmdc:mga05p37_145515_c1 3300050507 Bacteria 2902
564 nmdc:mga05p37_385482_c1 3300050507 Bacteria 1641
565 nmdc:mga05p37_76808_c1 3300050507 Bacteria 4111
566 nmdc:mga0qj67_38395_c1 3300050509 Bacteria 3756
567 nmdc:mga08y16_13293_c1 3300050511 Bacteria 8657
568 nmdc:mga08y16_23207_c1 3300050511 Bacteria 6549
569 nmdc:mga0n895_35628_c1 3300050512 Bacteria 4800
570 nmdc:mga0rr50_101369_c1 3300050513 Bacteria 2263
571 nmdc:mga0a205_117345_c1 3300050515 Bacteria 2559
572 Ga0495595_0009825 3300053084 Bacteria 3967
573 Ga0495595_0024877 3300053084 Bacteria 2647
574 Ga0495595_0028064 3300053084 Bacteria 2512
575 Ga0501084_0098377 3300054114 Bacteria 2457
576 Ga0501082_0046802 3300060353 Bacteria 3728
577 Ga0501082_0088266 3300060353 Bacteria 2676
578 Ga0501082_0342634 3300060353 Bacteria 1303
579 Ga0530510_0018158 3300061734 Bacteria 4987
580 Ga0070711_100040872
581 JGI24738J21930_10005909
582 JGI25406J46586_10003236
583 Ga0070658_10040351
584 Ga0070683_100007449
585 Ga0070683_100083613
586 Ga0070683_100230525
587 Ga0070670_100003392
588 Ga0070670_100041146
589 Ga0068869_100206557
590 Ga0070682_100019948
591 Ga0070682_100033749
592 Ga0070682_100054632
593 Ga0070682_100181781
594 Ga0070682_100214905
595 Ga0068868_100048582
596 Ga0068868_100064503
597 Ga0068868_100136220
598 Ga0070660_100003055
599 Ga0070660_100071474
600 Ga0070689_100017164
601 Ga0070689_100060011
602 Ga0070691_10053162
603 Ga0070687_100074015
604 Ga0070661_100079415
605 Ga0070692_10010240
606 Ga0070668_100142386
607 Ga0070669_100216069
608 Ga0070675_100001435
609 Ga0070675_100165160
610 Ga0070671_100016937
611 Ga0070671_100147993
612 Ga0070674_100001639
613 Ga0070674_100004240
614 Ga0070674_100010175
615 Ga0070674_100057665
616 Ga0070674_100097286
617 Ga0070674_100106503
618 Ga0070673_100004042
619 Ga0070673_100011881
620 Ga0070673_100209754
621 Ga0070688_100003618
622 Ga0070688_100022193
623 Ga0070659_100014935
624 Ga0070703_10025805
625 Ga0070714_100015959
626 Ga0070714_100035496
627 Ga0070713_100019632
628 Ga0070713_100060206
629 Ga0070710_10009872
630 Ga0070701_10006948
631 Ga0070701_10036751
632 Ga0070701_10082803
633 Ga0070711_100008489
634 Ga0070705_100028434
635 Ga0070705_100038467
636 Ga0070700_100009253
637 Ga0070700_100012443
638 Ga0070700_100054191
639 Ga0070708_100057529
640 Ga0070678_100002181
641 Ga0070678_100003522
642 Ga0070678_100004543
643 Ga0070678_100013281
644 Ga0070678_100031406
645 Ga0070678_100117391
646 Ga0070678_100206123
647 Ga0070678_100248412
648 Ga0070681_10054990
649 Ga0068867_100029114
650 Ga0068867_100113995
651 Ga0068867_100165518
652 Ga0070685_10015833
653 Ga0070685_10019835
654 Ga0070685_10239014
655 Ga0070706_100017676
656 Ga0070706_100092737
657 Ga0070707_100004690
658 Ga0070707_100015887
659 Ga0070698_100012752
660 Ga0070698_100033813
661 Ga0070699_100008247
662 Ga0070699_100025063
663 Ga0070699_100071941
664 Ga0070699_100201077
665 Ga0070684_100007182
666 Ga0070684_100022555
667 Ga0070684_100085419
668 Ga0070684_100300122
669 Ga0070697_100054651
670 Ga0068853_100048708
671 Ga0070672_100024072
672 Ga0070686_100026338
673 Ga0070686_100031872
674 Ga0070686_100096631
675 Ga0070695_100101547
676 Ga0070696_100019741
677 Ga0070696_100252175
678 Ga0070693_100004438
679 Ga0070693_100008448
680 Ga0070665_100009097
681 Ga0070664_100052128
682 Ga0070664_100086043
683 Ga0068854_100021965
684 Ga0068856_100010772
685 Ga0068856_100059976
686 Ga0068856_100155036
687 Ga0070702_100005529
688 Ga0070702_100007316
689 Ga0070702_100015432
690 Ga0068852_100016506
691 Ga0068859_100052861
692 Ga0068864_100005717
693 Ga0068866_10007133
694 Ga0068866_10007987
695 Ga0068866_10038043
696 Ga0068870_10016018
697 Ga0068860_100056183
698 Ga0068860_100129770
699 Ga0068862_100065538
700 Ga0068862_100120988
701 Ga0081455_10011450
702 Ga0081455_10113247
703 Ga0081539_10000244
704 Ga0070717_10006208
705 Ga0070717_10267500
706 Ga0070717_10320644
707 Ga0075432_10008593
708 Ga0070715_10023158
709 Ga0070715_10023619
710 Ga0070716_100047375
711 Ga0070712_100118444
712 Ga0097621_100004896
713 Ga0097621_100011611
714 Ga0097621_100032298
715 Ga0097621_100040339
716 Ga0097621_100155274
717 Ga0068871_100003811
718 Ga0068871_100010425
719 Ga0068871_100234496
720 Ga0075428_100263456
721 Ga0075434_100032010
722 Ga0075429_100261323
723 Ga0068865_100006678
724 Ga0068865_100034333
725 Ga0068865_100049439
726 Ga0068865_100050958
727 Ga0068865_100198658
728 Ga0097620_100052863
729 Ga0075435_100020038
730 Ga0111539_10076215
731 Ga0111539_10128599
732 Ga0111539_10185350
733 Ga0111539_10462038
734 Ga0105245_10018015
735 Ga0105245_10020922
736 Ga0105245_10079939
737 Ga0105245_10094226
738 Ga0105245_10194839
739 Ga0105245_10224775
740 Ga0105247_10005276
741 Ga0114129_10085611
742 Ga0114129_10110921
743 Ga0114129_10123135
744 Ga0114129_10695665
745 Ga0105243_10001545
746 Ga0105243_10013203
747 Ga0105243_10044613
748 Ga0105241_10195302
749 Ga0105242_10006264
750 Ga0105242_10039931
751 Ga0105242_10085131
752 Ga0105242_10099795
753 Ga0105248_10127714
754 Ga0105248_10162292
755 Ga0105248_10249400
756 Ga0105238_10241859
757 Ga0105239_10027277
758 Ga0105239_10122181
759 Ga0105246_10133618
760 Ga0157371_10039631
761 Ga0157371_10072766
762 Ga0157370_10103330
763 Ga0157369_10012637
764 Ga0157369_10029750
765 Ga0157374_10142254
766 Ga0157374_10173775
767 Ga0157378_10024182
768 Ga0157378_10027833
769 Ga0157372_10047104
770 Ga0157375_10005283
771 Ga0157375_10143218
772 Ga0157375_10447094
773 Ga0163163_10021065
774 Ga0163163_10517017
775 Ga0157380_10050537
776 Ga0157377_10003742
777 Ga0157377_10027790
778 Ga0157377_10057477
779 Ga0157379_10014425
780 Ga0157379_10107644
781 Ga0157379_10153353
782 Ga0157376_10001626
783 Ga0157376_10022656
784 Ga0157376_10131713
785 Ga0157376_10263720
786 Ga0207692_10004733
787 Ga0207642_10029367
788 Ga0207642_10056010
789 Ga0207642_10098824
790 Ga0207710_10003335
791 Ga0207688_10002806
792 Ga0207680_10084316
793 Ga0207699_10074354
794 Ga0207645_10028925
795 Ga0207643_10049309
796 Ga0207684_10160472
797 Ga0207693_10003565
798 Ga0207693_10034806
799 Ga0207693_10075473
800 Ga0207663_10025943
801 Ga0207663_10079863
802 Ga0207660_10039205
803 Ga0207660_10089832
804 Ga0207662_10011313
805 Ga0207662_10108533
806 Ga0207662_10198890
807 Ga0207657_10002463
808 Ga0207657_10032997
809 Ga0207649_10039196
810 Ga0207652_10014627
811 Ga0207652_10192877
812 Ga0207646_10001592
813 Ga0207646_10085894
814 Ga0207646_10112127
815 Ga0207681_10131069
816 Ga0207694_10214402
817 Ga0207650_10013924
818 Ga0207650_10026761
819 Ga0207659_10194208
820 Ga0207659_10276598
821 Ga0207687_10053696
822 Ga0207687_10055241
823 Ga0207687_10083266
824 Ga0207687_10116403
825 Ga0207664_10004972
826 Ga0207664_10107020
827 Ga0207644_10129725
828 Ga0207690_10018040
829 Ga0207686_10101679
830 Ga0207709_10006975
831 Ga0207709_10033140
832 Ga0207670_10089796
833 Ga0207669_10016708
834 Ga0207669_10028287
835 Ga0207669_10036913
836 Ga0207669_10150106
837 Ga0207704_10015232
838 Ga0207704_10051375
839 Ga0207704_10081363
840 Ga0207665_10007966
841 Ga0207665_10071709
842 Ga0207691_10243766
843 Ga0207711_10209470
844 Ga0207689_10279230
845 Ga0207661_10062363
846 Ga0207661_10071162
847 Ga0207661_10168637
848 Ga0207679_10130778
849 Ga0207667_10123102
850 Ga0207651_10109723
851 Ga0207712_10031946
852 Ga0207668_10121729
853 Ga0207677_10154768
854 Ga0207677_10186037
855 Ga0207703_10081534
856 Ga0207703_10296502
857 Ga0207703_10440347
858 Ga0207639_10323203
859 Ga0207708_10008151
860 Ga0207708_10019851
861 Ga0207708_10035303
862 Ga0207708_10066345
863 Ga0207702_10019815
864 Ga0207702_10065478
865 Ga0207702_10088076
866 Ga0207648_10004050
867 Ga0207648_10224567
868 Ga0207648_10396178
869 Ga0207676_10193084
870 Ga0207674_10118356
871 Ga0207675_100057063
872 Ga0207675_100145108
873 Ga0207683_10000903
874 Ga0207683_10002338
875 Ga0207683_10004835
876 Ga0207683_10010245
877 Ga0207683_10015871
878 Ga0207683_10023675
879 Ga0207683_10030797
880 Ga0207683_10151843
881 Ga0207428_10024199
882 Ga0207428_10036157
883 Ga0268264_10140921
884 Ga0265337_1023838
885 Ga0265319_1002293
886 Ga0265334_10001486
887 Ga0265318_10001895
888 Ga0265318_10003972
889 Ga0265318_10022292
890 Ga0265318_10028578
891 Ga0265322_10003782
892 Ga0265322_10005149
893 Ga0265322_10011993
894 Ga0265336_10024021
895 Ga0265338_10010376
896 Ga0265338_10014603
897 Ga0265338_10017277
898 Ga0265338_10018370
899 Ga0265338_10026869
900 Ga0265330_10002675
901 Ga0265330_10017895
902 Ga0265330_10059647
903 Ga0265332_10011290
904 Ga0265332_10050842
905 Ga0265320_10005814
906 Ga0265320_10024586
907 Ga0265325_10000549
908 Ga0265329_10019300
909 Ga0265340_10017013
910 Ga0265339_10006675
911 Ga0265339_10029032
912 Ga0265339_10066577
913 Ga0265327_10015488
914 Ga0265327_10020934
915 Ga0265327_10026890
916 Ga0265327_10029431
917 Ga0265316_10009735
918 Ga0265316_10015484
919 Ga0265316_10021838
920 Ga0265316_10031870
921 Ga0265316_10089615
922 Ga0265313_10002613
923 Ga0265313_10019104
924 Ga0265314_10006396
925 Ga0265314_10011505
926 Ga0265314_10028685
927 Ga0265314_10148509
928 Ga0265342_10005464
929 Ga0265342_10072425
930 Ga0373951_0017991
931 Ga0373952_0013134
932 Ga0373952_0016069
933 Ga0373942_0005116
934 Ga0373961_0021324
935 Ga0373931_0015781
936 Ga0373931_0084214
937 Ga0373947_0017158
938 Ga0373937_0006259
939 Ga0373937_0120078
940 Ga0395899_0031739
941 Ga0395899_0038777
942 Ga0395899_0147269
943 Ga0395900_0002584
944 Ga0395900_0002845
945 Ga0395900_0004700
946 Ga0395900_0028796
947 Ga0395900_0030697
948 Ga0395900_0127924
949 Ga0395900_0149916
950 Ga0395898_0004894
951 Ga0395898_0005978
952 Ga0395898_0009809
953 Ga0395898_0021501
954 Ga0395905_0012888
955 Ga0395905_0053853
956 Ga0395905_0102666
957 Ga0395905_0110634
958 Ga0395905_0149471
959 Ga0395905_0216636
960 Ga0395905_0251367
961 Ga0395905_0300755
962 Ga0395901_0002794
963 Ga0395901_0003307
964 Ga0395901_0020352
965 Ga0395901_0028729
966 Ga0395901_0034134
967 Ga0395901_0047358
968 Ga0395901_0202536
969 Ga0400483_224466
970 Ga0451807_0876225
971 Ga0466966_0053869
972 Ga0466961_0028493
973 Ga0466961_0168799
974 Ga0466963_0008555
975 Ga0466968_0011737
976 Ga0466970_0096872
977 Ga0466957_0047707
978 Ga0466957_0064062
979 Ga0466957_0216226
980 Ga0466959_0022424
981 Ga0451576_0205552
982 Ga0466958_0022890
983 Ga0466958_0026781
984 Ga0466967_0000761
985 Ga0466967_0062770
986 Ga0466967_0071588
987 Ga0466967_0222498
988 Ga0466967_0239044
989 Ga0495603_0001198
990 Ga0495603_0017766
991 Ga0495603_0049476
992 Ga0495603_0059682
993 Ga0495641_0001460
994 Ga0495653_0118686
995 Ga0495580_0094317
996 Ga0495582_0025878
997 Ga0495582_0077959
998 Ga0495605_0027945
999 Ga0495605_0095411
1000 Ga0495662_0051531
1001 Ga0495664_0106198
1002 Ga0495584_0080506
1003 Ga0495594_0005945
1004 Ga0495594_0065844
1005 Ga0495608_0137227
1006 Ga0495618_0030614
1007 Ga0495628_0131258
1008 Ga0495630_0060432
1009 Ga0495666_0004989
1010 Ga0495587_0048075
1011 Ga0495587_0053100
1012 Ga0495587_0132801
1013 Ga0495645_0152027
1014 Ga0495667_0015982
1015 Ga0495656_0047931
1016 Ga0495634_0102599
1017 Ga0495635_0031651
1018 Ga0495635_0103825
1019 Ga0495659_0030350
1020 Ga0495657_0014202
1021 Ga0495623_0017665
1022 Ga0495658_0102542
1023 Ga0495613_0137489
1024 Ga0495600_0047315
1025 Ga0495581_0001035
1026 Ga0495604_0030126
1027 Ga0495674_0085135
1028 Ga0495674_0158740
1029 Ga0495676_0088396
1030 Ga0495675_0085538
1031 Ga0495684_0022774
1032 Ga0495684_0037967
1033 Ga0495602_0151293
1034 Ga0495602_0256383
1035 Ga0496100_0045971
1036 Ga0496100_0063521
1037 Ga0496101_0003097
1038 Ga0496101_0024210
1039 Ga0496101_0034004
1040 Ga0496101_0042128
1041 Ga0496101_0077198
1042 Ga0496102_0012458
1043 Ga0496102_0028420
1044 Ga0496102_0105150
1045 Ga0496102_0163062
1046 Ga0496103_0008947
1047 Ga0496103_0021723
1048 Ga0496103_0021981
1049 Ga0496104_0000134
1050 Ga0496104_0000381
1051 Ga0496104_0004306
1052 Ga0496104_0043634
1053 Ga0496104_0071080
1054 Ga0496104_0097064
1055 Ga0496104_0103190
1056 Ga0496104_0205764
1057 Ga0496105_0000484
1058 Ga0496105_0001378
1059 Ga0496105_0001956
1060 Ga0496105_0035603
1061 Ga0496105_0108054
1062 Ga0496105_0135922
1063 Ga0496106_0007242
1064 Ga0496106_0034994
1065 Ga0496106_0097949
1066 Ga0496106_0119222
1067 Ga0496107_0003801
1068 Ga0496107_0009143
1069 Ga0496107_0053790
1070 Ga0496107_0063687
1071 Ga0496107_0082042
1072 Ga0496107_0165979
1073 Ga0496107_0182196
1074 Ga0496108_0001238
1075 Ga0496108_0001352
1076 Ga0496108_0002726
1077 Ga0496108_0013849
1078 Ga0496108_0081489
1079 Ga0496108_0082219
1080 Ga0496108_0094053
1081 Ga0496109_0000533
1082 Ga0496109_0000806
1083 Ga0496109_0000898
1084 Ga0496109_0001686
1085 Ga0496109_0026172
1086 Ga0496109_0032903
1087 Ga0496110_0000164
1088 Ga0496110_0000905
1089 Ga0496110_0005794
1090 Ga0496110_0006347
1091 Ga0496110_0077512
1092 Ga0496110_0088930
1093 Ga0496110_0089428
1094 Ga0496110_0167923
1095 Ga0496110_0187760
1096 Ga0496110_0196612
1097 Ga0496110_0250314
1098 Ga0496111_0000043
1099 Ga0496111_0000083
1100 Ga0496111_0000295
1101 Ga0496111_0002679
1102 Ga0496111_0013798
1103 Ga0496111_0014302
1104 Ga0496112_0000145
1105 Ga0496112_0099991
1106 Ga0496112_0165380
1107 Ga0496113_0000298
1108 Ga0496113_0160777
1109 Ga0496114_0002188
1110 Ga0496114_0005906
1111 Ga0496114_0015924
1112 Ga0496114_0019055
1113 Ga0496114_0026001
1114 Ga0496114_0049136
1115 Ga0496114_0059109
1116 Ga0496114_0168928
1117 Ga0496114_0183963
1118 Ga0496114_0359730
1119 Ga0496115_0020235
1120 Ga0496115_0039977
1121 Ga0496115_0042663
1122 Ga0496115_0042670
1123 Ga0496115_0220655
1124 Ga0501041_0059640
1125 Ga0501047_0020148
1126 Ga0501047_0089071
1127 Ga0501067_0095635
1128 Ga0501068_0101565
1129 Ga0501069_0123922
1130 Ga0501072_0263120
1131 Ga0501074_0095402
1132 Ga0501076_0057695
1133 Ga0501077_0023853
1134 Ga0501079_0046754
1135 Ga0501079_0334893
1136 Ga0501080_0205560
1137 Ga0501080_0209588
1138 Ga0501080_0408174
1139 Ga0501081_0016057
1140 Ga0501044_0201226
1141 nmdc:mga0yw44_76390_c1
1142 nmdc:mga05p37_145515_c1
1143 nmdc:mga05p37_385482_c1
1144 nmdc:mga05p37_76808_c1
1145 nmdc:mga0qj67_38395_c1
1146 nmdc:mga08y16_13293_c1
1147 nmdc:mga08y16_23207_c1
1148 nmdc:mga0n895_35628_c1
1149 nmdc:mga0rr50_101369_c1
1150 nmdc:mga0a205_117345_c1
1151 Ga0495595_0009825
1152 Ga0495595_0024877
1153 Ga0495595_0028064
1154 Ga0501084_0098377
1155 Ga0501082_0046802
1156 Ga0501082_0088266
1157 Ga0501082_0342634
1158 Ga0530510_0018158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

59

353

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5059 49 337
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5005 20 331
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4858 49 337
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4855 19 336
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.4849 20 331
ID Description Score Start End Superfamily
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6993 64 329 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6926 63 330 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6899 64 329 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6857 63 330 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.646 63 326 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A4Y6KYT4-F1-model_v4 ABC transporter permease 0.844 17 336 GO:0005886
GO:0022857
AF-A0A837AL01-F1-model_v4 deleted 0.844 53 336
AF-A0A3S0S6N1-F1-model_v4 ABC transporter permease 0.8398 7 342 GO:0005886
GO:0022857
AF-A0A7C6YSS6-F1-model_v4 ABC transporter permease 0.8393 16 336 GO:0005886
GO:0022857
AF-A0A6F8NS53-F1-model_v4 deleted 0.8386 34 336

Map