F465781

General Info

Members Datasets Scaffolds Average Seq Length
578 277 1156 212

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_36077_c1|nmdc:mga0rr50_36077_c1_2791_3519
Length 242
Sequence LRRALEKGSSATADSLAWGTIMAVPEANEFFVDPSRCIGCNGCVQACTECDTHKGYSMIQLDYIDRAASPQTVPVVCMHCESPTCAEVCPADAIKRSDDGVVQSARKPRCIACNNCVLACPFGVPKMNTAMHLMMKCDMCYDRTSVGKKPMCASVCPSQALFFGTRDEIERLRPQSRALNSFKFGAQIIKTKVNMMVPARSTVEHLDVVAALYEPTVGNQLEDSLSLDEIDIAEMESESGKP

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
198 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 1.9
Rhizosphere 95.85
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_36077_c1 3300050513 Bacteria 3557
2 Ga0065715_10114824 3300005293 Bacteria 2429
3 Ga0070676_10017571 3300005328 Bacteria 3957
4 Ga0070676_10059788 3300005328 Bacteria 2261
5 Ga0070683_100023544 3300005329 Bacteria 5509
6 Ga0070690_100003758 3300005330 Bacteria 8365
7 Ga0070690_100053417 3300005330 Bacteria 2585
8 Ga0070670_100000109 3300005331 Bacteria 77122
9 Ga0070670_100248465 3300005331 Bacteria 1549
10 Ga0070677_10000960 3300005333 Bacteria 9309
11 Ga0070677_10009264 3300005333 Bacteria 3335
12 Ga0070677_10160880 3300005333 Bacteria 1053
13 Ga0068869_100005849 3300005334 Bacteria 7764
14 Ga0070666_10217313 3300005335 Bacteria 1347
15 Ga0070680_100004149 3300005336 Bacteria 10852
16 Ga0070680_100083868 3300005336 Bacteria 2632
17 Ga0070680_100204060 3300005336 Bacteria 1667
18 Ga0068868_100009133 3300005338 Bacteria 7118
19 Ga0070660_100006929 3300005339 Bacteria 7860
20 Ga0070660_100024628 3300005339 Bacteria 4465
21 Ga0070689_100000064 3300005340 Bacteria 65382
22 Ga0070689_100053225 3300005340 Bacteria 3132
23 Ga0070687_100085161 3300005343 Bacteria 1734
24 Ga0070661_100026352 3300005344 Unclassified 4181
25 Ga0070668_100022865 3300005347 Bacteria 4726
26 Ga0070668_100058643 3300005347 Bacteria 2979
27 Ga0070669_100031554 3300005353 Bacteria 3827
28 Ga0070669_100086902 3300005353 Bacteria 2337
29 Ga0070669_100242777 3300005353 Unclassified 1432
30 Ga0070669_100343125 3300005353 Bacteria 1211
31 Ga0070675_100000026 3300005354 Bacteria 113553
32 Ga0070675_100041052 3300005354 Bacteria 3779
33 Ga0070675_100048987 3300005354 Bacteria 3466
34 Ga0070671_100016123 3300005355 Bacteria 6041
35 Ga0070671_100324454 3300005355 Bacteria 1312
36 Ga0070674_100014151 3300005356 Bacteria 4954
37 Ga0070674_100302766 3300005356 Bacteria 1275
38 Ga0070673_100099165 3300005364 Bacteria 2396
39 Ga0070673_100170469 3300005364 Bacteria 1857
40 Ga0070673_100199626 3300005364 Bacteria 1722
41 Ga0070673_100565178 3300005364 Bacteria 1034
42 Ga0070688_100699758 3300005365 Bacteria 785
43 Ga0070659_100010438 3300005366 Bacteria 6830
44 Ga0070659_100032680 3300005366 Bacteria 4037
45 Ga0070659_100082569 3300005366 Bacteria 2567
46 Ga0070659_100166151 3300005366 Bacteria 1806
47 Ga0070659_100218907 3300005366 Bacteria 1571
48 Ga0070659_100514890 3300005366 Bacteria 1021
49 Ga0070659_101061184 3300005366 Bacteria 713
50 Ga0070667_100008855 3300005367 Bacteria 8330
51 Ga0070667_100087830 3300005367 Bacteria 2669
52 Ga0070703_10000339 3300005406 Bacteria 20813
53 Ga0070701_10278811 3300005438 Bacteria 1020
54 Ga0070711_100000013 3300005439 Bacteria 161148
55 Ga0070705_100021229 3300005440 Bacteria 3451
56 Ga0070705_100314739 3300005440 Bacteria 1127
57 Ga0070705_100612286 3300005440 Bacteria 844
58 Ga0070700_100000020 3300005441 Bacteria 135275
59 Ga0070700_100247577 3300005441 Bacteria 1277
60 Ga0070700_100481422 3300005441 Bacteria 951
61 Ga0070694_100000585 3300005444 Bacteria 20123
62 Ga0070694_100445261 3300005444 Bacteria 1022
63 Ga0070694_100609381 3300005444 Bacteria 880
64 Ga0070663_100012331 3300005455 Bacteria 5404
65 Ga0070663_100760663 3300005455 Bacteria 828
66 Ga0070663_101009016 3300005455 Unclassified 724
67 Ga0070678_100013497 3300005456 Bacteria 5125
68 Ga0070678_100095098 3300005456 Bacteria 2295
69 Ga0070678_100257143 3300005456 Bacteria 1467
70 Ga0070678_100919816 3300005456 Bacteria 800
71 Ga0070662_100077663 3300005457 Bacteria 2464
72 Ga0070662_100120126 3300005457 Bacteria 2013
73 Ga0070662_100157343 3300005457 Bacteria 1775
74 Ga0070662_100313060 3300005457 Bacteria 1278
75 Ga0070662_100779676 3300005457 Unclassified 812
76 Ga0070681_10017158 3300005458 Bacteria 7239
77 Ga0070681_10033760 3300005458 Bacteria 5136
78 Ga0070681_10039458 3300005458 Bacteria 4733
79 Ga0068867_100010636 3300005459 Bacteria 6492
80 Ga0070685_10130650 3300005466 Bacteria 1570
81 Ga0070685_10394622 3300005466 Bacteria 957
82 Ga0070706_100004927 3300005467 Bacteria 12777
83 Ga0070707_100076330 3300005468 Bacteria 3232
84 Ga0070698_100012336 3300005471 Bacteria 9049
85 Ga0070698_100492851 3300005471 Bacteria 1163
86 Ga0070699_100001427 3300005518 Bacteria 21970
87 Ga0070679_100052585 3300005530 Bacteria 4056
88 Ga0070684_100012157 3300005535 Bacteria 6885
89 Ga0070697_100032588 3300005536 Bacteria 4194
90 Ga0070697_100048302 3300005536 Unclassified 3450
91 Ga0068853_100098330 3300005539 Bacteria 2584
92 Ga0070672_100016201 3300005543 Bacteria 5331
93 Ga0070672_100025147 3300005543 Bacteria 4413
94 Ga0070672_100042517 3300005543 Bacteria 3499
95 Ga0070672_100142135 3300005543 Bacteria 1980
96 Ga0070686_100089778 3300005544 Bacteria 2053
97 Ga0070695_100177436 3300005545 Bacteria 1507
98 Ga0070695_100581346 3300005545 Unclassified 877
99 Ga0070696_100103948 3300005546 Unclassified 2039
100 Ga0070696_100364775 3300005546 Bacteria 1122
101 Ga0070693_100193352 3300005547 Bacteria 1317
102 Ga0070665_100004609 3300005548 Bacteria 14413
103 Ga0070665_100015992 3300005548 Bacteria 7532
104 Ga0070665_100293458 3300005548 Bacteria 1628
105 Ga0070704_100215304 3300005549 Bacteria 1559
106 Ga0070704_100919941 3300005549 Bacteria 787
107 Ga0068855_100029993 3300005563 Bacteria 6505
108 Ga0068855_100374004 3300005563 Bacteria 1565
109 Ga0070664_100000498 3300005564 Bacteria 29740
110 Ga0070664_100001782 3300005564 Bacteria 17272
111 Ga0070664_100017364 3300005564 Bacteria 5909
112 Ga0070664_100788337 3300005564 Bacteria 888
113 Ga0068857_100000091 3300005577 Bacteria 52422
114 Ga0068857_100030959 3300005577 Bacteria 4728
115 Ga0068854_100003331 3300005578 Bacteria 10011
116 Ga0068854_100092240 3300005578 Bacteria 2256
117 Ga0068856_100015077 3300005614 Bacteria 7467
118 Ga0068856_100042006 3300005614 Bacteria 4496
119 Ga0070702_100019667 3300005615 Bacteria 3527
120 Ga0070702_100238487 3300005615 Bacteria 1226
121 Ga0068852_100184289 3300005616 Bacteria 1965
122 Ga0068852_100442515 3300005616 Bacteria 1285
123 Ga0068859_100000005 3300005617 Bacteria 430800
124 Ga0068859_100014404 3300005617 Bacteria 7934
125 Ga0068859_100014722 3300005617 Bacteria 7861
126 Ga0068859_100101859 3300005617 Bacteria 2929
127 Ga0068859_100139034 3300005617 Bacteria 2502
128 Ga0068864_100000013 3300005618 Bacteria 326235
129 Ga0068864_100009859 3300005618 Bacteria 7877
130 Ga0068864_100021629 3300005618 Bacteria 5386
131 Ga0068864_100061853 3300005618 Bacteria 3243
132 Ga0068864_100065403 3300005618 Bacteria 3155
133 Ga0068866_10001692 3300005718 Bacteria 9287
134 Ga0068866_10005895 3300005718 Archaea 5090
135 Ga0068866_10013391 3300005718 Bacteria 3598
136 Ga0068861_100023346 3300005719 Bacteria 4460
137 Ga0068861_100024837 3300005719 Bacteria 4338
138 Ga0068861_100153684 3300005719 Bacteria 1891
139 Ga0068861_100532504 3300005719 Bacteria 1067
140 Ga0068861_100939521 3300005719 Unclassified 821
141 Ga0068861_101039753 3300005719 Bacteria 784
142 Ga0068863_100022313 3300005841 Bacteria 6044
143 Ga0068863_100053360 3300005841 Bacteria 3832
144 Ga0068863_100127028 3300005841 Bacteria 2433
145 Ga0068858_100000090 3300005842 Bacteria 94699
146 Ga0068858_100002571 3300005842 Bacteria 18283
147 Ga0068858_100015443 3300005842 Bacteria 7181
148 Ga0068860_100001977 3300005843 Bacteria 21671
149 Ga0068860_100095283 3300005843 Bacteria 2837
150 Ga0068860_100491159 3300005843 Bacteria 1225
151 Ga0068862_100009196 3300005844 Bacteria 8183
152 Ga0068862_100024038 3300005844 Bacteria 5109
153 Ga0068862_100109487 3300005844 Bacteria 2423
154 Ga0068862_100324282 3300005844 Bacteria 1422
155 Ga0081455_10020761 3300005937 Bacteria 6175
156 Ga0081538_10012338 3300005981 Bacteria 6852
157 Ga0075364_10064337 3300006051 Bacteria 2407
158 Ga0070716_100144494 3300006173 Bacteria 1522
159 Ga0070716_100280931 3300006173 Bacteria 1149
160 Ga0070716_100380519 3300006173 Bacteria 1009
161 Ga0070712_100176830 3300006175 Bacteria 1660
162 Ga0070712_100419127 3300006175 Bacteria 1109
163 Ga0075367_10010192 3300006178 Bacteria 4927
164 Ga0075366_10000100 3300006195 Bacteria 34958
165 Ga0097621_100018610 3300006237 Bacteria 5311
166 Ga0097621_100034947 3300006237 Bacteria 4012
167 Ga0097621_100423056 3300006237 Bacteria 1196
168 Ga0075370_10009355 3300006353 Bacteria 5085
169 Ga0068871_100008962 3300006358 Bacteria 7221
170 Ga0068871_100133175 3300006358 Bacteria 2109
171 Ga0068871_100256441 3300006358 Bacteria 1525
172 Ga0075428_100086169 3300006844 Bacteria 3426
173 Ga0075428_100410569 3300006844 Bacteria 1451
174 Ga0075430_100020048 3300006846 Bacteria 5692
175 Ga0075430_100142448 3300006846 Bacteria 1996
176 Ga0075431_100770132 3300006847 Bacteria 937
177 Ga0075431_100986216 3300006847 Bacteria 810
178 Ga0075433_10042775 3300006852 Bacteria 3932
179 Ga0075433_10453188 3300006852 Unclassified 1131
180 Ga0075433_10808500 3300006852 Bacteria 819
181 Ga0075434_100003616 3300006871 Bacteria 13797
182 Ga0075429_100027975 3300006880 Bacteria 4894
183 Ga0075429_100036403 3300006880 Bacteria 4281
184 Ga0068865_100012584 3300006881 Bacteria 5331
185 Ga0068865_100225459 3300006881 Bacteria 1467
186 Ga0075436_100000283 3300006914 Bacteria 32200
187 Ga0075436_100007790 3300006914 Bacteria 7325
188 Ga0075436_100021259 3300006914 Bacteria 4453
189 Ga0097620_100000005 3300006931 Bacteria 430800
190 Ga0097620_100014405 3300006931 Bacteria 7934
191 Ga0097620_100014722 3300006931 Bacteria 7861
192 Ga0097620_100101859 3300006931 Bacteria 2929
193 Ga0097620_100139033 3300006931 Bacteria 2502
194 Ga0097620_100775340 3300006931 Unclassified 1047
195 Ga0075435_100000056 3300007076 Bacteria 58362
196 Ga0075435_100071599 3300007076 Bacteria 2831
197 Ga0075435_100077363 3300007076 Bacteria 2728
198 Ga0075435_100304944 3300007076 Unclassified 1362
199 Ga0105244_10007812 3300009036 Bacteria 6760
200 Ga0105240_10026966 3300009093 Bacteria 7531
201 Ga0111539_10000004 3300009094 Bacteria 751278
202 Ga0111539_10000732 3300009094 Bacteria 42670
203 Ga0111539_10009651 3300009094 Bacteria 12182
204 Ga0111539_10053990 3300009094 Bacteria 4783
205 Ga0111539_10247286 3300009094 Bacteria 2076
206 Ga0111539_10726407 3300009094 Bacteria 1156
207 Ga0105245_10000186 3300009098 Bacteria 58710
208 Ga0105245_10003612 3300009098 Bacteria 13804
209 Ga0105245_10152051 3300009098 Bacteria 2189
210 Ga0105245_10388059 3300009098 Bacteria 1392
211 Ga0105247_10196152 3300009101 Bacteria 1354
212 Ga0114129_10036063 3300009147 Bacteria 6985
213 Ga0105243_10000629 3300009148 Bacteria 35046
214 Ga0105243_10032584 3300009148 Bacteria 4027
215 Ga0105243_10069436 3300009148 Bacteria 2842
216 Ga0105243_10100407 3300009148 Unclassified 2401
217 Ga0105243_10146400 3300009148 Bacteria 2021
218 Ga0105243_10395462 3300009148 Bacteria 1282
219 Ga0105243_10641185 3300009148 Bacteria 1028
220 Ga0105241_10010249 3300009174 Bacteria 6884
221 Ga0105241_10074597 3300009174 Bacteria 2641
222 Ga0105241_10268112 3300009174 Unclassified 1453
223 Ga0105242_10000849 3300009176 Bacteria 23661
224 Ga0105242_10012748 3300009176 Bacteria 6474
225 Ga0105242_10514579 3300009176 Unclassified 1141
226 Ga0105248_10281588 3300009177 Bacteria 1872
227 Ga0105248_10358266 3300009177 Bacteria 1642
228 Ga0105248_10487292 3300009177 Bacteria 1390
229 Ga0105249_10024557 3300009553 Bacteria 5418
230 Ga0105249_10055707 3300009553 Bacteria 3618
231 Ga0105249_10123301 3300009553 Bacteria 2465
232 Ga0105249_10307282 3300009553 Bacteria 1593
233 Ga0105249_11284537 3300009553 Unclassified 803
234 Ga0105246_10420186 3300011119 Bacteria 1116
235 Ga0157373_10029773 3300013100 Bacteria 3930
236 Ga0157374_10002650 3300013296 Bacteria 15076
237 Ga0157374_10091254 3300013296 Bacteria 2905
238 Ga0157374_10863453 3300013296 Bacteria 922
239 Ga0157374_11119244 3300013296 Bacteria 808
240 Ga0157378_10000107 3300013297 Bacteria 79357
241 Ga0157378_10001357 3300013297 Bacteria 22011
242 Ga0157378_10221790 3300013297 Bacteria 1798
243 Ga0157378_10235833 3300013297 Unclassified 1746
244 Ga0157378_10619829 3300013297 Bacteria 1095
245 Ga0163162_10002844 3300013306 Bacteria 16478
246 Ga0163162_10012824 3300013306 Bacteria 8186
247 Ga0163162_10292780 3300013306 Unclassified 1760
248 Ga0157372_10002333 3300013307 Bacteria 20558
249 Ga0157375_10000030 3300013308 Bacteria 199141
250 Ga0157375_10011728 3300013308 Bacteria 7747
251 Ga0157375_10045536 3300013308 Bacteria 4270
252 Ga0157375_10065275 3300013308 Bacteria 3628
253 Ga0157375_10401453 3300013308 Bacteria 1537
254 Ga0163163_10037108 3300014325 Bacteria 4739
255 Ga0163163_10065760 3300014325 Bacteria 3600
256 Ga0163163_10085238 3300014325 Bacteria 3167
257 Ga0163163_10235618 3300014325 Bacteria 1880
258 Ga0163163_10616654 3300014325 Bacteria 1148
259 Ga0163163_10882804 3300014325 Bacteria 958
260 Ga0163163_11197344 3300014325 Bacteria 822
261 Ga0157380_10006400 3300014326 Bacteria 8290
262 Ga0157380_10086828 3300014326 Bacteria 2571
263 Ga0157380_10161554 3300014326 Bacteria 1948
264 Ga0157377_10017628 3300014745 Bacteria 3696
265 Ga0157379_10000818 3300014968 Bacteria 25219
266 Ga0157379_10315110 3300014968 Unclassified 1428
267 Ga0157376_10573484 3300014969 Unclassified 1120
268 Ga0163161_10171949 3300017792 Bacteria 1657
269 Ga0207697_10035053 3300025315 Bacteria 2054
270 Ga0207653_10000371 3300025885 Bacteria 21042
271 Ga0207682_10015081 3300025893 Bacteria 3009
272 Ga0207682_10065885 3300025893 Bacteria 1525
273 Ga0207642_10174456 3300025899 Bacteria 1166
274 Ga0207688_10221853 3300025901 Bacteria 1139
275 Ga0207680_10079178 3300025903 Bacteria 2060
276 Ga0207647_10144995 3300025904 Bacteria 1390
277 Ga0207699_10039465 3300025906 Bacteria 2713
278 Ga0207645_10005491 3300025907 Bacteria 9179
279 Ga0207645_10507402 3300025907 Bacteria 817
280 Ga0207643_10028227 3300025908 Bacteria 3116
281 Ga0207684_10029016 3300025910 Unclassified 4712
282 Ga0207654_10061072 3300025911 Bacteria 2204
283 Ga0207707_10004554 3300025912 Bacteria 12184
284 Ga0207707_10004764 3300025912 Bacteria 11894
285 Ga0207707_10026279 3300025912 Bacteria 5089
286 Ga0207707_10062726 3300025912 Bacteria 3234
287 Ga0207695_10034786 3300025913 Bacteria 5473
288 Ga0207693_10180628 3300025915 Bacteria 1660
289 Ga0207663_10000020 3300025916 Bacteria 137200
290 Ga0207660_10133865 3300025917 Bacteria 1889
291 Ga0207660_10301478 3300025917 Bacteria 1276
292 Ga0207660_10351212 3300025917 Unclassified 1182
293 Ga0207662_10086454 3300025918 Bacteria 1922
294 Ga0207657_10004233 3300025919 Bacteria 15205
295 Ga0207657_10035549 3300025919 Bacteria 4466
296 Ga0207649_10015523 3300025920 Unclassified 4279
297 Ga0207652_10051415 3300025921 Bacteria 3533
298 Ga0207646_10018787 3300025922 Bacteria 6440
299 Ga0207646_10157315 3300025922 Unclassified 2050
300 Ga0207681_10006464 3300025923 Bacteria 7197
301 Ga0207681_10008189 3300025923 Bacteria 6393
302 Ga0207681_10034639 3300025923 Bacteria 3321
303 Ga0207681_10050334 3300025923 Bacteria 2819
304 Ga0207681_10232105 3300025923 Unclassified 1432
305 Ga0207650_10000026 3300025925 Bacteria 264152
306 Ga0207650_10001501 3300025925 Bacteria 16699
307 Ga0207650_10003933 3300025925 Bacteria 10168
308 Ga0207650_10072475 3300025925 Bacteria 2592
309 Ga0207659_10000002 3300025926 Bacteria 619441
310 Ga0207659_10254698 3300025926 Bacteria 1425
311 Ga0207659_10874389 3300025926 Bacteria 773
312 Ga0207687_10000725 3300025927 Bacteria 22382
313 Ga0207687_10006243 3300025927 Bacteria 7884
314 Ga0207687_10206210 3300025927 Bacteria 1539
315 Ga0207687_10684240 3300025927 Bacteria 869
316 Ga0207700_10006628 3300025928 Bacteria 7017
317 Ga0207700_10051879 3300025928 Bacteria 3064
318 Ga0207644_10239350 3300025931 Bacteria 1444
319 Ga0207690_10049576 3300025932 Bacteria 2800
320 Ga0207690_10134774 3300025932 Bacteria 1812
321 Ga0207690_10159979 3300025932 Bacteria 1678
322 Ga0207690_10381755 3300025932 Bacteria 1120
323 Ga0207706_10001986 3300025933 Bacteria 20063
324 Ga0207706_10003922 3300025933 Bacteria 14115
325 Ga0207706_10444622 3300025933 Bacteria 1122
326 Ga0207706_10554452 3300025933 Bacteria 989
327 Ga0207686_10000039 3300025934 Bacteria 126792
328 Ga0207686_10033277 3300025934 Bacteria 3076
329 Ga0207686_10086912 3300025934 Bacteria 2055
330 Ga0207709_10000192 3300025935 Bacteria 81277
331 Ga0207709_10068781 3300025935 Bacteria 2239
332 Ga0207709_10189652 3300025935 Bacteria 1459
333 Ga0207670_10000137 3300025936 Bacteria 48112
334 Ga0207670_10018094 3300025936 Bacteria 4273
335 Ga0207669_10017811 3300025937 Bacteria 3654
336 Ga0207669_10140868 3300025937 Bacteria 1674
337 Ga0207669_10288731 3300025937 Unclassified 1241
338 Ga0207704_10040022 3300025938 Bacteria 2735
339 Ga0207704_10165991 3300025938 Bacteria 1577
340 Ga0207704_10307882 3300025938 Bacteria 1216
341 Ga0207665_10119846 3300025939 Bacteria 1858
342 Ga0207665_10340842 3300025939 Bacteria 1129
343 Ga0207691_10002151 3300025940 Bacteria 19301
344 Ga0207691_10014452 3300025940 Bacteria 7528
345 Ga0207691_10099577 3300025940 Bacteria 2595
346 Ga0207711_10001447 3300025941 Bacteria 22191
347 Ga0207711_10051954 3300025941 Bacteria 3511
348 Ga0207711_10213361 3300025941 Bacteria 1764
349 Ga0207711_10916380 3300025941 Bacteria 815
350 Ga0207689_10011463 3300025942 Bacteria 7597
351 Ga0207689_10019524 3300025942 Bacteria 5711
352 Ga0207689_10454387 3300025942 Bacteria 1071
353 Ga0207661_10034159 3300025944 Unclassified 3953
354 Ga0207661_10510428 3300025944 Bacteria 1099
355 Ga0207679_10004158 3300025945 Bacteria 8993
356 Ga0207679_10007969 3300025945 Bacteria 6736
357 Ga0207679_10254745 3300025945 Bacteria 1494
358 Ga0207679_10279238 3300025945 Bacteria 1432
359 Ga0207667_10002482 3300025949 Bacteria 22988
360 Ga0207667_10020408 3300025949 Bacteria 7369
361 Ga0207667_10325397 3300025949 Bacteria 1570
362 Ga0207651_10041725 3300025960 Bacteria 3048
363 Ga0207651_10370571 3300025960 Bacteria 1211
364 Ga0207651_10486850 3300025960 Bacteria 1064
365 Ga0207651_10530403 3300025960 Bacteria 1021
366 Ga0207712_10392708 3300025961 Unclassified 1164
367 Ga0207712_10595285 3300025961 Bacteria 956
368 Ga0207668_10041824 3300025972 Bacteria 3099
369 Ga0207640_10022481 3300025981 Bacteria 3775
370 Ga0207640_10028376 3300025981 Unclassified 3421
371 Ga0207658_10030192 3300025986 Bacteria 3835
372 Ga0207658_10166706 3300025986 Bacteria 1810
373 Ga0207677_10016899 3300026023 Unclassified 4334
374 Ga0207677_10263665 3300026023 Bacteria 1406
375 Ga0207703_10000242 3300026035 Bacteria 61824
376 Ga0207703_10012658 3300026035 Bacteria 6579
377 Ga0207703_10073954 3300026035 Bacteria 2820
378 Ga0207703_10076448 3300026035 Bacteria 2777
379 Ga0207703_10215310 3300026035 Bacteria 1715
380 Ga0207703_10355491 3300026035 Bacteria 1350
381 Ga0207639_10000020 3300026041 Bacteria 236698
382 Ga0207678_10022249 3300026067 Bacteria 5553
383 Ga0207678_10182687 3300026067 Bacteria 1791
384 Ga0207678_10725333 3300026067 Bacteria 876
385 Ga0207708_10000021 3300026075 Bacteria 186005
386 Ga0207708_10051415 3300026075 Unclassified 3137
387 Ga0207708_10149140 3300026075 Bacteria 1840
388 Ga0207708_10162370 3300026075 Bacteria 1765
389 Ga0207708_10195689 3300026075 Bacteria 1611
390 Ga0207708_10219155 3300026075 Bacteria 1524
391 Ga0207708_10244032 3300026075 Bacteria 1445
392 Ga0207708_10252639 3300026075 Bacteria 1421
393 Ga0207702_10004782 3300026078 Bacteria 11935
394 Ga0207641_10071973 3300026088 Bacteria 2976
395 Ga0207641_10109132 3300026088 Bacteria 2450
396 Ga0207641_10126037 3300026088 Bacteria 2292
397 Ga0207648_10007886 3300026089 Bacteria 10388
398 Ga0207648_10011960 3300026089 Bacteria 8148
399 Ga0207648_10038303 3300026089 Bacteria 4220
400 Ga0207676_10000014 3300026095 Bacteria 339896
401 Ga0207676_10009384 3300026095 Bacteria 6964
402 Ga0207676_10043806 3300026095 Bacteria 3448
403 Ga0207676_10044694 3300026095 Bacteria 3419
404 Ga0207676_10146067 3300026095 Bacteria 2031
405 Ga0207676_10238309 3300026095 Bacteria 1630
406 Ga0207674_10000126 3300026116 Bacteria 88965
407 Ga0207674_10000452 3300026116 Bacteria 53623
408 Ga0207674_10082050 3300026116 Unclassified 3226
409 Ga0207674_10282424 3300026116 Bacteria 1608
410 Ga0207675_100004532 3300026118 Bacteria 13406
411 Ga0207675_100017061 3300026118 Bacteria 6784
412 Ga0207675_100035997 3300026118 Bacteria 4616
413 Ga0207675_100063078 3300026118 Bacteria 3462
414 Ga0207675_100112901 3300026118 Unclassified 2565
415 Ga0207675_100205057 3300026118 Bacteria 1895
416 Ga0207675_100591918 3300026118 Bacteria 1111
417 Ga0207683_10023381 3300026121 Bacteria 5316
418 Ga0207683_10527328 3300026121 Bacteria 1091
419 Ga0207683_10693736 3300026121 Bacteria 944
420 Ga0207698_10490233 3300026142 Bacteria 1194
421 Ga0207698_10649199 3300026142 Bacteria 1045
422 Ga0209971_1084227 3300027682 Unclassified 775
423 Ga0207428_10000601 3300027907 Bacteria 42555
424 Ga0207428_10009594 3300027907 Bacteria 8670
425 Ga0207428_10147649 3300027907 Bacteria 1791
426 Ga0268266_10010540 3300028379 Bacteria 8070
427 Ga0268265_10007072 3300028380 Bacteria 7585
428 Ga0268265_10035634 3300028380 Bacteria 3638
429 Ga0268264_10001270 3300028381 Bacteria 23952
430 Ga0268264_10079595 3300028381 Bacteria 2796
431 Ga0307413_10104249 3300031824 Bacteria 1882
432 Ga0307410_10006807 3300031852 Bacteria 6205
433 Ga0307406_10015500 3300031901 Bacteria 4413
434 Ga0307406_10361641 3300031901 Bacteria 1138
435 Ga0307407_10204324 3300031903 Bacteria 1326
436 Ga0307412_10015116 3300031911 Bacteria 4568
437 Ga0307412_10572316 3300031911 Bacteria 952
438 Ga0307409_100015571 3300031995 Bacteria 4996
439 Ga0307416_100055982 3300032002 Bacteria 3179
440 Ga0307414_10047573 3300032004 Bacteria 2953
441 Ga0307411_10039926 3300032005 Bacteria 2973
442 Ga0307411_10157891 3300032005 Bacteria 1694
443 Ga0307411_10284701 3300032005 Bacteria 1317
444 Ga0307415_100064577 3300032126 Bacteria 2548
445 Ga0307415_100302673 3300032126 Bacteria 1325
446 Ga0373923_0024613 3300035111 Bacteria 2377
447 Ga0373941_0182943 3300035115 Bacteria 787
448 Ga0373953_0058778 3300035117 Bacteria 1568
449 Ga0373954_0043779 3300035118 Bacteria 2088
450 Ga0373957_0050273 3300035120 Bacteria 1593
451 Ga0373955_0026315 3300035172 Bacteria 2996
452 Ga0373927_0117301 3300035695 Bacteria 1736
453 Ga0373933_0173589 3300035724 Bacteria 1372
454 Ga0373937_0079664 3300036401 Bacteria 3027
455 Ga0451802_0126461 3300041460 Bacteria 1874
456 Ga0451807_0145248 3300041486 Bacteria 1106
457 Ga0451807_0330119 3300041486 Bacteria 3291
458 Ga0451837_0087476 3300041494 Bacteria 1330
459 Ga0451851_0652856 3300041507 Bacteria 1667
460 Ga0451843_0500394 3300041509 Bacteria 1114
461 Ga0451853_1806885 3300041512 Bacteria 1833
462 Ga0453684_0627137 3300044712 Bacteria 1175
463 Ga0451576_0203804 3300045051 Bacteria 2066
464 Ga0495629_0005323 3300046459 Bacteria 9619
465 Ga0495653_0183484 3300046463 Bacteria 1434
466 Ga0495580_0013083 3300046472 Bacteria 6353
467 Ga0495580_0029069 3300046472 Bacteria 4014
468 Ga0495580_0151181 3300046472 Bacteria 1608
469 Ga0495639_0006185 3300046475 Bacteria 5140
470 Ga0495594_0000180 3300046499 Bacteria 30488
471 Ga0495616_0264784 3300046513 Unclassified 734
472 Ga0495618_0019464 3300046514 Bacteria 4178
473 Ga0495644_0000825 3300046523 Bacteria 12772
474 Ga0495642_0008595 3300046528 Bacteria 3906
475 Ga0495640_0060366 3300046533 Bacteria 2579
476 Ga0495609_0035103 3300046538 Bacteria 2271
477 Ga0495645_0046565 3300046543 Bacteria 3161
478 Ga0495622_0135482 3300046557 Bacteria 1120
479 Ga0495625_0119456 3300046660 Bacteria 1795
480 Ga0495635_0315988 3300046663 Bacteria 1046
481 Ga0495599_0218158 3300046678 Unclassified 1168
482 Ga0495623_0131532 3300046679 Bacteria 1498
483 Ga0495647_0008189 3300046681 Bacteria 3513
484 Ga0495658_0197928 3300046683 Bacteria 1251
485 Ga0495669_0002013 3300046684 Bacteria 8340
486 Ga0495613_0116085 3300046689 Unclassified 1926
487 Ga0495676_0093872 3300047321 Bacteria 2237
488 Ga0496102_0005972 3300048905 Bacteria 10371
489 Ga0496104_0110206 3300048907 Bacteria 2639
490 Ga0496104_0117114 3300048907 Bacteria 2557
491 Ga0496107_0110742 3300048910 Bacteria 2018
492 Ga0496108_0506920 3300048911 Bacteria 1054
493 Ga0496110_0637333 3300048913 Bacteria 965
494 Ga0496111_0112252 3300048914 Bacteria 2008
495 Ga0496113_0073641 3300048916 Bacteria 2603
496 Ga0501298_043823 3300049521 Bacteria 912
497 Ga0501032_0102564 3300049569 Bacteria 1896
498 Ga0501033_0051374 3300049570 Bacteria 3056
499 Ga0501033_0250734 3300049570 Bacteria 1255
500 Ga0501034_0051677 3300049571 Bacteria 4144
501 Ga0501034_0147667 3300049571 Bacteria 2328
502 Ga0501034_0296538 3300049571 Bacteria 1554
503 Ga0501036_0015384 3300049572 Bacteria 6390
504 Ga0501037_0050428 3300049573 Bacteria 3046
505 Ga0501038_0050329 3300049574 Bacteria 3600
506 Ga0501038_0139321 3300049574 Bacteria 1986
507 Ga0501039_0037083 3300049575 Bacteria 3763
508 Ga0501040_0109427 3300049576 Bacteria 1932
509 Ga0501041_0006482 3300049577 Bacteria 6851
510 Ga0501042_0013181 3300049578 Bacteria 5627
511 Ga0501043_0094442 3300049579 Bacteria 2351
512 Ga0501046_0579574 3300049580 Bacteria 798
513 Ga0501047_0000567 3300049581 Bacteria 39527
514 Ga0501047_0049487 3300049581 Bacteria 4059
515 Ga0501047_0251388 3300049581 Bacteria 1616
516 Ga0501048_0015973 3300049582 Bacteria 5538
517 Ga0501048_0226772 3300049582 Bacteria 1326
518 Ga0501068_0174120 3300049584 Bacteria 1359
519 Ga0501070_0360227 3300049586 Bacteria 1180
520 Ga0501070_0378201 3300049586 Bacteria 1147
521 Ga0501071_0001776 3300049587 Bacteria 12712
522 Ga0501071_0248497 3300049587 Bacteria 1342
523 Ga0501072_0019986 3300049588 Bacteria 5185
524 Ga0501072_0170626 3300049588 Bacteria 1736
525 Ga0501072_0235873 3300049588 Bacteria 1457
526 Ga0501072_0430939 3300049588 Bacteria 1045
527 Ga0501072_0641476 3300049588 Bacteria 836
528 Ga0501073_0000870 3300049589 Bacteria 21549
529 Ga0501075_0185095 3300049591 Bacteria 1589
530 Ga0501075_0274136 3300049591 Bacteria 1286
531 Ga0501076_0001769 3300049592 Bacteria 14625
532 Ga0501076_0108069 3300049592 Bacteria 2247
533 Ga0501077_0036682 3300049593 Bacteria 3124
534 Ga0501198_017000 3300049649 Bacteria 1129
535 Ga0501235_048354 3300049669 Bacteria 982
536 Ga0501079_0018599 3300049741 Bacteria 5308
537 Ga0501079_0141061 3300049741 Bacteria 1877
538 Ga0501079_0270374 3300049741 Bacteria 1329
539 Ga0501081_0012983 3300049743 Bacteria 5480
540 Ga0501083_0009440 3300049744 Bacteria 6892
541 Ga0501083_0184561 3300049744 Bacteria 1361
542 Ga0501035_0018916 3300049822 Bacteria 6345
543 Ga0501044_0010374 3300049823 Bacteria 10110
544 Ga0501044_0127236 3300049823 Bacteria 2544
545 Ga0501044_0468124 3300049823 Bacteria 1165
546 nmdc:mga03683_40870_c1 3300050489 Bacteria 1904
547 nmdc:mga00v17_53894_c1 3300050491 Bacteria 2453
548 nmdc:mga0k408_644_c1 3300050493 Bacteria 19205
549 nmdc:mga06z11_2728_c1 3300050494 Bacteria 6770
550 nmdc:mga07m45_9191_c1 3300050496 Bacteria 5112
551 nmdc:mga05p37_53235_c1 3300050507 Bacteria 4977
552 nmdc:mga09592_49117_c1 3300050508 Bacteria 3557
553 nmdc:mga0qj67_11122_c1 3300050509 Bacteria 6740
554 nmdc:mga0qj67_117212_c1 3300050509 Bacteria 2152
555 nmdc:mga08y16_19620_c1 3300050511 Bacteria 7129
556 nmdc:mga08y16_2259_c1 3300050511 Bacteria 19746
557 nmdc:mga08y16_342069_c1 3300050511 Bacteria 1538
558 nmdc:mga0n895_15084_c1 3300050512 Bacteria 7042
559 nmdc:mga0n895_198289_c1 3300050512 Bacteria 2039
560 nmdc:mga0n895_63790_c1 3300050512 Bacteria 2117
561 nmdc:mga0rr50_176080_c1 3300050513 Bacteria 1746
562 nmdc:mga0rr50_40_c1 3300050513 Bacteria 83054
563 nmdc:mga08x19_10_c1 3300050514 Bacteria 404490
564 nmdc:mga08x19_39851_c1 3300050514 Bacteria 2987
565 nmdc:mga08x19_5735_c1 3300050514 Bacteria 7341
566 nmdc:mga0a205_1788_c2 3300050515 Bacteria 13101
567 nmdc:mga0a205_415474_c1 3300050515 Unclassified 1208
568 nmdc:mga0a205_4983_c1 3300050515 Bacteria 11945
569 Ga0501084_0003991 3300054114 Bacteria 12021
570 Ga0501084_0038332 3300054114 Bacteria 4007
571 Ga0501084_0223563 3300054114 Bacteria 1589
572 Ga0501084_0901417 3300054114 Bacteria 744
573 Ga0590075_007613 3300059424 Bacteria 2578
574 Ga0501082_0092454 3300060353 Bacteria 2613
575 Ga0501082_0336735 3300060353 Bacteria 1315
576 Ga0530510_0007602 3300061734 Bacteria 7549
577 Ga0530510_0111514 3300061734 Bacteria 2004
578 Ga0530510_0243933 3300061734 Bacteria 1338
579 nmdc:mga0rr50_36077_c1
580 Ga0065715_10114824
581 Ga0070676_10017571
582 Ga0070676_10059788
583 Ga0070683_100023544
584 Ga0070690_100003758
585 Ga0070690_100053417
586 Ga0070670_100000109
587 Ga0070670_100248465
588 Ga0070677_10000960
589 Ga0070677_10009264
590 Ga0070677_10160880
591 Ga0068869_100005849
592 Ga0070666_10217313
593 Ga0070680_100004149
594 Ga0070680_100083868
595 Ga0070680_100204060
596 Ga0068868_100009133
597 Ga0070660_100006929
598 Ga0070660_100024628
599 Ga0070689_100000064
600 Ga0070689_100053225
601 Ga0070687_100085161
602 Ga0070661_100026352
603 Ga0070668_100022865
604 Ga0070668_100058643
605 Ga0070669_100031554
606 Ga0070669_100086902
607 Ga0070669_100242777
608 Ga0070669_100343125
609 Ga0070675_100000026
610 Ga0070675_100041052
611 Ga0070675_100048987
612 Ga0070671_100016123
613 Ga0070671_100324454
614 Ga0070674_100014151
615 Ga0070674_100302766
616 Ga0070673_100099165
617 Ga0070673_100170469
618 Ga0070673_100199626
619 Ga0070673_100565178
620 Ga0070688_100699758
621 Ga0070659_100010438
622 Ga0070659_100032680
623 Ga0070659_100082569
624 Ga0070659_100166151
625 Ga0070659_100218907
626 Ga0070659_100514890
627 Ga0070659_101061184
628 Ga0070667_100008855
629 Ga0070667_100087830
630 Ga0070703_10000339
631 Ga0070701_10278811
632 Ga0070711_100000013
633 Ga0070705_100021229
634 Ga0070705_100314739
635 Ga0070705_100612286
636 Ga0070700_100000020
637 Ga0070700_100247577
638 Ga0070700_100481422
639 Ga0070694_100000585
640 Ga0070694_100445261
641 Ga0070694_100609381
642 Ga0070663_100012331
643 Ga0070663_100760663
644 Ga0070663_101009016
645 Ga0070678_100013497
646 Ga0070678_100095098
647 Ga0070678_100257143
648 Ga0070678_100919816
649 Ga0070662_100077663
650 Ga0070662_100120126
651 Ga0070662_100157343
652 Ga0070662_100313060
653 Ga0070662_100779676
654 Ga0070681_10017158
655 Ga0070681_10033760
656 Ga0070681_10039458
657 Ga0068867_100010636
658 Ga0070685_10130650
659 Ga0070685_10394622
660 Ga0070706_100004927
661 Ga0070707_100076330
662 Ga0070698_100012336
663 Ga0070698_100492851
664 Ga0070699_100001427
665 Ga0070679_100052585
666 Ga0070684_100012157
667 Ga0070697_100032588
668 Ga0070697_100048302
669 Ga0068853_100098330
670 Ga0070672_100016201
671 Ga0070672_100025147
672 Ga0070672_100042517
673 Ga0070672_100142135
674 Ga0070686_100089778
675 Ga0070695_100177436
676 Ga0070695_100581346
677 Ga0070696_100103948
678 Ga0070696_100364775
679 Ga0070693_100193352
680 Ga0070665_100004609
681 Ga0070665_100015992
682 Ga0070665_100293458
683 Ga0070704_100215304
684 Ga0070704_100919941
685 Ga0068855_100029993
686 Ga0068855_100374004
687 Ga0070664_100000498
688 Ga0070664_100001782
689 Ga0070664_100017364
690 Ga0070664_100788337
691 Ga0068857_100000091
692 Ga0068857_100030959
693 Ga0068854_100003331
694 Ga0068854_100092240
695 Ga0068856_100015077
696 Ga0068856_100042006
697 Ga0070702_100019667
698 Ga0070702_100238487
699 Ga0068852_100184289
700 Ga0068852_100442515
701 Ga0068859_100000005
702 Ga0068859_100014404
703 Ga0068859_100014722
704 Ga0068859_100101859
705 Ga0068859_100139034
706 Ga0068864_100000013
707 Ga0068864_100009859
708 Ga0068864_100021629
709 Ga0068864_100061853
710 Ga0068864_100065403
711 Ga0068866_10001692
712 Ga0068866_10005895
713 Ga0068866_10013391
714 Ga0068861_100023346
715 Ga0068861_100024837
716 Ga0068861_100153684
717 Ga0068861_100532504
718 Ga0068861_100939521
719 Ga0068861_101039753
720 Ga0068863_100022313
721 Ga0068863_100053360
722 Ga0068863_100127028
723 Ga0068858_100000090
724 Ga0068858_100002571
725 Ga0068858_100015443
726 Ga0068860_100001977
727 Ga0068860_100095283
728 Ga0068860_100491159
729 Ga0068862_100009196
730 Ga0068862_100024038
731 Ga0068862_100109487
732 Ga0068862_100324282
733 Ga0081455_10020761
734 Ga0081538_10012338
735 Ga0075364_10064337
736 Ga0070716_100144494
737 Ga0070716_100280931
738 Ga0070716_100380519
739 Ga0070712_100176830
740 Ga0070712_100419127
741 Ga0075367_10010192
742 Ga0075366_10000100
743 Ga0097621_100018610
744 Ga0097621_100034947
745 Ga0097621_100423056
746 Ga0075370_10009355
747 Ga0068871_100008962
748 Ga0068871_100133175
749 Ga0068871_100256441
750 Ga0075428_100086169
751 Ga0075428_100410569
752 Ga0075430_100020048
753 Ga0075430_100142448
754 Ga0075431_100770132
755 Ga0075431_100986216
756 Ga0075433_10042775
757 Ga0075433_10453188
758 Ga0075433_10808500
759 Ga0075434_100003616
760 Ga0075429_100027975
761 Ga0075429_100036403
762 Ga0068865_100012584
763 Ga0068865_100225459
764 Ga0075436_100000283
765 Ga0075436_100007790
766 Ga0075436_100021259
767 Ga0097620_100000005
768 Ga0097620_100014405
769 Ga0097620_100014722
770 Ga0097620_100101859
771 Ga0097620_100139033
772 Ga0097620_100775340
773 Ga0075435_100000056
774 Ga0075435_100071599
775 Ga0075435_100077363
776 Ga0075435_100304944
777 Ga0105244_10007812
778 Ga0105240_10026966
779 Ga0111539_10000004
780 Ga0111539_10000732
781 Ga0111539_10009651
782 Ga0111539_10053990
783 Ga0111539_10247286
784 Ga0111539_10726407
785 Ga0105245_10000186
786 Ga0105245_10003612
787 Ga0105245_10152051
788 Ga0105245_10388059
789 Ga0105247_10196152
790 Ga0114129_10036063
791 Ga0105243_10000629
792 Ga0105243_10032584
793 Ga0105243_10069436
794 Ga0105243_10100407
795 Ga0105243_10146400
796 Ga0105243_10395462
797 Ga0105243_10641185
798 Ga0105241_10010249
799 Ga0105241_10074597
800 Ga0105241_10268112
801 Ga0105242_10000849
802 Ga0105242_10012748
803 Ga0105242_10514579
804 Ga0105248_10281588
805 Ga0105248_10358266
806 Ga0105248_10487292
807 Ga0105249_10024557
808 Ga0105249_10055707
809 Ga0105249_10123301
810 Ga0105249_10307282
811 Ga0105249_11284537
812 Ga0105246_10420186
813 Ga0157373_10029773
814 Ga0157374_10002650
815 Ga0157374_10091254
816 Ga0157374_10863453
817 Ga0157374_11119244
818 Ga0157378_10000107
819 Ga0157378_10001357
820 Ga0157378_10221790
821 Ga0157378_10235833
822 Ga0157378_10619829
823 Ga0163162_10002844
824 Ga0163162_10012824
825 Ga0163162_10292780
826 Ga0157372_10002333
827 Ga0157375_10000030
828 Ga0157375_10011728
829 Ga0157375_10045536
830 Ga0157375_10065275
831 Ga0157375_10401453
832 Ga0163163_10037108
833 Ga0163163_10065760
834 Ga0163163_10085238
835 Ga0163163_10235618
836 Ga0163163_10616654
837 Ga0163163_10882804
838 Ga0163163_11197344
839 Ga0157380_10006400
840 Ga0157380_10086828
841 Ga0157380_10161554
842 Ga0157377_10017628
843 Ga0157379_10000818
844 Ga0157379_10315110
845 Ga0157376_10573484
846 Ga0163161_10171949
847 Ga0207697_10035053
848 Ga0207653_10000371
849 Ga0207682_10015081
850 Ga0207682_10065885
851 Ga0207642_10174456
852 Ga0207688_10221853
853 Ga0207680_10079178
854 Ga0207647_10144995
855 Ga0207699_10039465
856 Ga0207645_10005491
857 Ga0207645_10507402
858 Ga0207643_10028227
859 Ga0207684_10029016
860 Ga0207654_10061072
861 Ga0207707_10004554
862 Ga0207707_10004764
863 Ga0207707_10026279
864 Ga0207707_10062726
865 Ga0207695_10034786
866 Ga0207693_10180628
867 Ga0207663_10000020
868 Ga0207660_10133865
869 Ga0207660_10301478
870 Ga0207660_10351212
871 Ga0207662_10086454
872 Ga0207657_10004233
873 Ga0207657_10035549
874 Ga0207649_10015523
875 Ga0207652_10051415
876 Ga0207646_10018787
877 Ga0207646_10157315
878 Ga0207681_10006464
879 Ga0207681_10008189
880 Ga0207681_10034639
881 Ga0207681_10050334
882 Ga0207681_10232105
883 Ga0207650_10000026
884 Ga0207650_10001501
885 Ga0207650_10003933
886 Ga0207650_10072475
887 Ga0207659_10000002
888 Ga0207659_10254698
889 Ga0207659_10874389
890 Ga0207687_10000725
891 Ga0207687_10006243
892 Ga0207687_10206210
893 Ga0207687_10684240
894 Ga0207700_10006628
895 Ga0207700_10051879
896 Ga0207644_10239350
897 Ga0207690_10049576
898 Ga0207690_10134774
899 Ga0207690_10159979
900 Ga0207690_10381755
901 Ga0207706_10001986
902 Ga0207706_10003922
903 Ga0207706_10444622
904 Ga0207706_10554452
905 Ga0207686_10000039
906 Ga0207686_10033277
907 Ga0207686_10086912
908 Ga0207709_10000192
909 Ga0207709_10068781
910 Ga0207709_10189652
911 Ga0207670_10000137
912 Ga0207670_10018094
913 Ga0207669_10017811
914 Ga0207669_10140868
915 Ga0207669_10288731
916 Ga0207704_10040022
917 Ga0207704_10165991
918 Ga0207704_10307882
919 Ga0207665_10119846
920 Ga0207665_10340842
921 Ga0207691_10002151
922 Ga0207691_10014452
923 Ga0207691_10099577
924 Ga0207711_10001447
925 Ga0207711_10051954
926 Ga0207711_10213361
927 Ga0207711_10916380
928 Ga0207689_10011463
929 Ga0207689_10019524
930 Ga0207689_10454387
931 Ga0207661_10034159
932 Ga0207661_10510428
933 Ga0207679_10004158
934 Ga0207679_10007969
935 Ga0207679_10254745
936 Ga0207679_10279238
937 Ga0207667_10002482
938 Ga0207667_10020408
939 Ga0207667_10325397
940 Ga0207651_10041725
941 Ga0207651_10370571
942 Ga0207651_10486850
943 Ga0207651_10530403
944 Ga0207712_10392708
945 Ga0207712_10595285
946 Ga0207668_10041824
947 Ga0207640_10022481
948 Ga0207640_10028376
949 Ga0207658_10030192
950 Ga0207658_10166706
951 Ga0207677_10016899
952 Ga0207677_10263665
953 Ga0207703_10000242
954 Ga0207703_10012658
955 Ga0207703_10073954
956 Ga0207703_10076448
957 Ga0207703_10215310
958 Ga0207703_10355491
959 Ga0207639_10000020
960 Ga0207678_10022249
961 Ga0207678_10182687
962 Ga0207678_10725333
963 Ga0207708_10000021
964 Ga0207708_10051415
965 Ga0207708_10149140
966 Ga0207708_10162370
967 Ga0207708_10195689
968 Ga0207708_10219155
969 Ga0207708_10244032
970 Ga0207708_10252639
971 Ga0207702_10004782
972 Ga0207641_10071973
973 Ga0207641_10109132
974 Ga0207641_10126037
975 Ga0207648_10007886
976 Ga0207648_10011960
977 Ga0207648_10038303
978 Ga0207676_10000014
979 Ga0207676_10009384
980 Ga0207676_10043806
981 Ga0207676_10044694
982 Ga0207676_10146067
983 Ga0207676_10238309
984 Ga0207674_10000126
985 Ga0207674_10000452
986 Ga0207674_10082050
987 Ga0207674_10282424
988 Ga0207675_100004532
989 Ga0207675_100017061
990 Ga0207675_100035997
991 Ga0207675_100063078
992 Ga0207675_100112901
993 Ga0207675_100205057
994 Ga0207675_100591918
995 Ga0207683_10023381
996 Ga0207683_10527328
997 Ga0207683_10693736
998 Ga0207698_10490233
999 Ga0207698_10649199
1000 Ga0209971_1084227
1001 Ga0207428_10000601
1002 Ga0207428_10009594
1003 Ga0207428_10147649
1004 Ga0268266_10010540
1005 Ga0268265_10007072
1006 Ga0268265_10035634
1007 Ga0268264_10001270
1008 Ga0268264_10079595
1009 Ga0307413_10104249
1010 Ga0307410_10006807
1011 Ga0307406_10015500
1012 Ga0307406_10361641
1013 Ga0307407_10204324
1014 Ga0307412_10015116
1015 Ga0307412_10572316
1016 Ga0307409_100015571
1017 Ga0307416_100055982
1018 Ga0307414_10047573
1019 Ga0307411_10039926
1020 Ga0307411_10157891
1021 Ga0307411_10284701
1022 Ga0307415_100064577
1023 Ga0307415_100302673
1024 Ga0373923_0024613
1025 Ga0373941_0182943
1026 Ga0373953_0058778
1027 Ga0373954_0043779
1028 Ga0373957_0050273
1029 Ga0373955_0026315
1030 Ga0373927_0117301
1031 Ga0373933_0173589
1032 Ga0373937_0079664
1033 Ga0451802_0126461
1034 Ga0451807_0145248
1035 Ga0451807_0330119
1036 Ga0451837_0087476
1037 Ga0451851_0652856
1038 Ga0451843_0500394
1039 Ga0451853_1806885
1040 Ga0453684_0627137
1041 Ga0451576_0203804
1042 Ga0495629_0005323
1043 Ga0495653_0183484
1044 Ga0495580_0013083
1045 Ga0495580_0029069
1046 Ga0495580_0151181
1047 Ga0495639_0006185
1048 Ga0495594_0000180
1049 Ga0495616_0264784
1050 Ga0495618_0019464
1051 Ga0495644_0000825
1052 Ga0495642_0008595
1053 Ga0495640_0060366
1054 Ga0495609_0035103
1055 Ga0495645_0046565
1056 Ga0495622_0135482
1057 Ga0495625_0119456
1058 Ga0495635_0315988
1059 Ga0495599_0218158
1060 Ga0495623_0131532
1061 Ga0495647_0008189
1062 Ga0495658_0197928
1063 Ga0495669_0002013
1064 Ga0495613_0116085
1065 Ga0495676_0093872
1066 Ga0496102_0005972
1067 Ga0496104_0110206
1068 Ga0496104_0117114
1069 Ga0496107_0110742
1070 Ga0496108_0506920
1071 Ga0496110_0637333
1072 Ga0496111_0112252
1073 Ga0496113_0073641
1074 Ga0501298_043823
1075 Ga0501032_0102564
1076 Ga0501033_0051374
1077 Ga0501033_0250734
1078 Ga0501034_0051677
1079 Ga0501034_0147667
1080 Ga0501034_0296538
1081 Ga0501036_0015384
1082 Ga0501037_0050428
1083 Ga0501038_0050329
1084 Ga0501038_0139321
1085 Ga0501039_0037083
1086 Ga0501040_0109427
1087 Ga0501041_0006482
1088 Ga0501042_0013181
1089 Ga0501043_0094442
1090 Ga0501046_0579574
1091 Ga0501047_0000567
1092 Ga0501047_0049487
1093 Ga0501047_0251388
1094 Ga0501048_0015973
1095 Ga0501048_0226772
1096 Ga0501068_0174120
1097 Ga0501070_0360227
1098 Ga0501070_0378201
1099 Ga0501071_0001776
1100 Ga0501071_0248497
1101 Ga0501072_0019986
1102 Ga0501072_0170626
1103 Ga0501072_0235873
1104 Ga0501072_0430939
1105 Ga0501072_0641476
1106 Ga0501073_0000870
1107 Ga0501075_0185095
1108 Ga0501075_0274136
1109 Ga0501076_0001769
1110 Ga0501076_0108069
1111 Ga0501077_0036682
1112 Ga0501198_017000
1113 Ga0501235_048354
1114 Ga0501079_0018599
1115 Ga0501079_0141061
1116 Ga0501079_0270374
1117 Ga0501081_0012983
1118 Ga0501083_0009440
1119 Ga0501083_0184561
1120 Ga0501035_0018916
1121 Ga0501044_0010374
1122 Ga0501044_0127236
1123 Ga0501044_0468124
1124 nmdc:mga03683_40870_c1
1125 nmdc:mga00v17_53894_c1
1126 nmdc:mga0k408_644_c1
1127 nmdc:mga06z11_2728_c1
1128 nmdc:mga07m45_9191_c1
1129 nmdc:mga05p37_53235_c1
1130 nmdc:mga09592_49117_c1
1131 nmdc:mga0qj67_11122_c1
1132 nmdc:mga0qj67_117212_c1
1133 nmdc:mga08y16_19620_c1
1134 nmdc:mga08y16_2259_c1
1135 nmdc:mga08y16_342069_c1
1136 nmdc:mga0n895_15084_c1
1137 nmdc:mga0n895_198289_c1
1138 nmdc:mga0n895_63790_c1
1139 nmdc:mga0rr50_176080_c1
1140 nmdc:mga0rr50_40_c1
1141 nmdc:mga08x19_10_c1
1142 nmdc:mga08x19_39851_c1
1143 nmdc:mga08x19_5735_c1
1144 nmdc:mga0a205_1788_c2
1145 nmdc:mga0a205_415474_c1
1146 nmdc:mga0a205_4983_c1
1147 Ga0501084_0003991
1148 Ga0501084_0038332
1149 Ga0501084_0223563
1150 Ga0501084_0901417
1151 Ga0590075_007613
1152 Ga0501082_0092454
1153 Ga0501082_0336735
1154 Ga0530510_0007602
1155 Ga0530510_0111514
1156 Ga0530510_0243933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

30

48

0.95

PF13247

Fer4_11

4Fe-4S dicluster domain

69

166

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x1o-assembly1.cif.gz_D wor5 from pyrococcus furiosus, as crystallized 0.7253 6 144
8c0z-assembly1.cif.gz_F cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum 0.6749 7 154
8c0z-assembly1.cif.gz_F cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum 0.621 7 154
1r27-assembly1.cif.gz_B crystal structure of nargh complex 0.6103 49 143
6x1o-assembly1.cif.gz_D wor5 from pyrococcus furiosus, as crystallized 0.6092 6 144
ID Description Score Start End Superfamily
af_Q57710_217_416_3.10.28.10 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.7026 38 53 3.10.28.10
af_Q8IHT3_226_284_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6326 64 103 3.30.70.20
af_Q20325_17_352_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6074 37 53 1.20.1070.10
1x0gD01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.5903 38 53 2.60.300.12
af_A0A0R0IZW5_665_906_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.507 37 63 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3A0DL79-F1-model_v4 4Fe-4S ferredoxin 0.8153 131 203
AF-A0A0Q4S4G6-F1-model_v4 4Fe-4S ferredoxin 0.8101 4 186 GO:0046872
GO:0051539
AF-A0A843SJH4-F1-model_v4 4Fe-4S ferredoxin 0.8069 1 186 GO:0046872
GO:0051539
AF-A0A143PFW7-F1-model_v4 DMSO reductase iron-sulfur subunit 0.8063 1 193 GO:0046872
GO:0051539
AF-A0A1Q3MH67-F1-model_v4 4Fe-4S ferredoxin 0.7956 1 186 GO:0046872
GO:0051539

Map