F465764

General Info

Members Datasets Scaffolds Average Seq Length
578 278 1156 122

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_063454|Ga0495687_063454_516_953
Length 138
Sequence VIRLRCRVTGAAGRRCGLATVAGMEIWINPACSKCRTAIGLLDAEGADYTVRRYLEDVPSEGEIRAVLERLGLEPWDITRTQEAVAKARDASARDRWITALAEHPRLIQRPIITADDGTAVIARTDEAVQEALARGKS

Samples

Sample ID Description Type Environment
1 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
46 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
49 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
64 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
65 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
66 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
67 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
70 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
71 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
79 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
82 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
83 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
84 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
87 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
88 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
89 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
90 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
91 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
92 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
93 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
94 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
215 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
216 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
217 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
234 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
235 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
236 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
237 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
238 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
239 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
240 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
241 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
242 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
246 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
247 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
248 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
249 2643221647 Streptomyces sp. Root369 Isolate Unclassified
250 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
251 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
252 2643221714 Streptomyces sp. Root264 Isolate Unclassified
253 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
254 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
255 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
256 2808606448 Streptomyces sp. 193411 Isolate Unclassified
257 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
258 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
259 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
260 2867428634 Streptomyces sp. RP5T Isolate Unclassified
261 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
262 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
263 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
264 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
265 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
266 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
267 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
268 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
269 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
270 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
271 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
272 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
273 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
274 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
275 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
276 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
277 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
278 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 0.17
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 0.52
Rhizoplane 2.6
Rhizosphere 81.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495687_063454 3300047443 Bacteria 1512
2 JGI24735J21928_10047382 3300002067 Bacteria 1246
3 rootH1_10007390 3300003316 Bacteria 7002
4 rootH2_10003602 3300003320 Bacteria 6474
5 rootL2_10064976 3300003322 Bacteria 1772
6 rootH1_10037813 3300003323 Bacteria 3074
7 rootH1_10100213 3300003323 Bacteria 3554
8 Ga0006562J51391_1070184 3300003578 Bacteria 1447
9 Ga0068853_100022013 3300005539 Bacteria 5318
10 Ga0070672_100266326 3300005543 Bacteria 1446
11 Ga0068855_100234672 3300005563 Bacteria 2052
12 Ga0068855_100880499 3300005563 Bacteria 947
13 Ga0068854_100937232 3300005578 Bacteria 763
14 Ga0068856_100064545 3300005614 Bacteria 3618
15 Ga0068856_102066975 3300005614 Bacteria 579
16 Ga0068852_100240236 3300005616 Bacteria 1731
17 Ga0068859_102900693 3300005617 Bacteria 525
18 Ga0081455_10010127 3300005937 Bacteria 9607
19 Ga0081455_10100463 3300005937 Bacteria 2324
20 Ga0081455_10489732 3300005937 Bacteria 829
21 Ga0075365_10234793 3300006038 Bacteria 1288
22 Ga0075368_10001904 3300006042 Bacteria 6709
23 Ga0075363_100021490 3300006048 Bacteria 3251
24 Ga0075363_100620913 3300006048 Bacteria 649
25 Ga0075367_10028754 3300006178 Bacteria 3173
26 Ga0075369_10153166 3300006186 Bacteria 1054
27 Ga0075370_10593233 3300006353 Bacteria 671
28 Ga0097620_102900962 3300006931 Bacteria 525
29 Ga0099826_10392922 3300006948 Bacteria 676
30 Ga0105244_10218829 3300009036 Bacteria 893
31 Ga0105243_10424837 3300009148 Bacteria 1241
32 Ga0105241_10171486 3300009174 Bacteria 1792
33 Ga0105248_11967783 3300009177 Bacteria 664
34 Ga0105237_10275938 3300009545 Bacteria 1684
35 Ga0105237_10753039 3300009545 Bacteria 980
36 Ga0105237_10922490 3300009545 Bacteria 880
37 Ga0105238_10325965 3300009551 Bacteria 1522
38 Ga0105238_10429851 3300009551 Bacteria 1316
39 Ga0105239_10619360 3300010375 Bacteria 1235
40 Ga0105239_13424362 3300010375 Bacteria 516
41 Ga0105246_10011816 3300011119 Bacteria 5427
42 Ga0157369_12424140 3300013105 Bacteria 531
43 Ga0157375_11642022 3300013308 Bacteria 760
44 Ga0182007_10002380 3300015262 Bacteria 9401
45 Ga0182005_1081001 3300015265 Bacteria 896
46 Ga0183367_1009 3300015688 Bacteria 484598
47 Ga0209758_1023199 3300025297 Bacteria 2814
48 Ga0207426_1003154 3300025302 Bacteria 9351
49 Ga0207426_1072723 3300025302 Bacteria 954
50 Ga0207426_1105591 3300025302 Bacteria 719
51 Ga0207647_10607690 3300025904 Bacteria 603
52 Ga0207711_11242599 3300025941 Bacteria 687
53 Ga0207667_12003233 3300025949 Bacteria 539
54 Ga0207702_11907396 3300026078 Bacteria 585
55 Ga0207674_10351176 3300026116 Bacteria 1426
56 Ga0209371_1010524 3300027312 Bacteria 2834
57 Ga0209813_10014304 3300027866 Bacteria 2135
58 Ga0307517_10008284 3300028786 Bacteria 14939
59 Ga0307515_10002305 3300028794 Bacteria 41711
60 Ga0307515_10167620 3300028794 Bacteria 2206
61 Ga0268256_1021892 3300030500 Bacteria 1690
62 Ga0307511_10002481 3300030521 Bacteria 19295
63 Ga0307511_10034181 3300030521 Bacteria 4469
64 Ga0307513_10218921 3300031456 Bacteria 1727
65 Ga0307513_10668261 3300031456 Bacteria 745
66 Ga0307509_10406016 3300031507 Bacteria 1067
67 Ga0307509_10440638 3300031507 Bacteria 998
68 Ga0307508_10008468 3300031616 Bacteria 9505
69 Ga0307508_10024236 3300031616 Bacteria 5506
70 Ga0307508_10185544 3300031616 Bacteria 1682
71 Ga0307514_10012028 3300031649 Bacteria 7201
72 Ga0307514_10200164 3300031649 Bacteria 1256
73 Ga0307514_10241849 3300031649 Bacteria 1080
74 Ga0307516_10075713 3300031730 Bacteria 3219
75 Ga0307516_10229829 3300031730 Bacteria 1559
76 Ga0307516_10349679 3300031730 Bacteria 1144
77 Ga0307413_10366933 3300031824 Bacteria 1117
78 Ga0307518_10052167 3300031838 Bacteria 2971
79 Ga0307518_10108297 3300031838 Bacteria 1982
80 Ga0307518_10378038 3300031838 Bacteria 805
81 Ga0307416_100894410 3300032002 Bacteria 988
82 Ga0307416_101761786 3300032002 Bacteria 724
83 Ga0307415_102266449 3300032126 Bacteria 532
84 Ga0307507_10057538 3300033179 Bacteria 3661
85 Ga0307510_10016735 3300033180 Bacteria 8653
86 Ga0307510_10046169 3300033180 Bacteria 4688
87 Ga0307510_10102029 3300033180 Bacteria 2653
88 Ga0307510_10176511 3300033180 Bacteria 1706
89 Ga0395900_0027257 3300037418 Bacteria 5851
90 Ga0395900_0352205 3300037418 Bacteria 1446
91 Ga0395898_0003346 3300037466 Bacteria 17988
92 Ga0395898_0015430 3300037466 Bacteria 7834
93 Ga0395898_0206600 3300037466 Bacteria 1874
94 Ga0439439_0084363 3300041406 Bacteria 862
95 Ga0451789_0047678 3300041443 Bacteria 1271
96 Ga0451791_0519801 3300041451 Bacteria 734
97 Ga0451795_1573937 3300041456 Bacteria 560
98 Ga0451802_0483940 3300041460 Bacteria 930
99 Ga0451802_1829622 3300041460 Bacteria 1015
100 Ga0451807_1522772 3300041486 Bacteria 724
101 Ga0451807_1745624 3300041486 Bacteria 500
102 Ga0451807_2304820 3300041486 Bacteria 783
103 Ga0451835_0204678 3300041492 Bacteria 523
104 Ga0451835_0643829 3300041492 Bacteria 682
105 Ga0451837_0060735 3300041494 Bacteria 1005
106 Ga0451839_0930258 3300041496 Bacteria 808
107 Ga0451841_1015362 3300041498 Bacteria 1508
108 Ga0451849_0071057 3300041505 Bacteria 2811
109 Ga0451843_1009106 3300041509 Bacteria 939
110 Ga0451855_1284941 3300041511 Bacteria 553
111 Ga0451853_1264913 3300041512 Bacteria 3855
112 Ga0451853_2310261 3300041512 Bacteria 3550
113 Ga0451853_2579848 3300041512 Bacteria 1813
114 Ga0439431_0104659 3300041997 Bacteria 780
115 Ga0439433_0005741 3300041999 Bacteria 2668
116 Ga0439433_0018548 3300041999 Bacteria 1549
117 Ga0439448_0008495 3300042005 Bacteria 3008
118 Ga0439448_0060089 3300042005 Bacteria 1255
119 Ga0439449_0000259 3300042007 Bacteria 19011
120 Ga0439449_0340786 3300042007 Bacteria 567
121 Ga0439450_027967 3300042008 Bacteria 1251
122 Ga0439454_022462 3300042011 Bacteria 940
123 Ga0439455_0000923 3300042012 Bacteria 4574
124 Ga0439455_0082265 3300042012 Bacteria 876
125 Ga0439457_000324 3300042014 Bacteria 13222
126 Ga0439457_001584 3300042014 Bacteria 6797
127 Ga0439462_0012882 3300042015 Bacteria 2140
128 Ga0439462_0135501 3300042015 Bacteria 689
129 Ga0450894_000333 3300042131 Bacteria 8301
130 Ga0450894_053450 3300042131 Bacteria 598
131 Ga0450895_001962 3300042132 Bacteria 1489
132 Ga0450896_018436 3300042133 Bacteria 1012
133 Ga0450898_000766 3300042134 Bacteria 3931
134 Ga0450900_005022 3300042136 Bacteria 1547
135 Ga0450902_016615 3300042137 Bacteria 1200
136 Ga0450903_000164 3300042138 Bacteria 14582
137 Ga0450906_002167 3300042145 Bacteria 4290
138 Ga0450907_045609 3300042146 Bacteria 752
139 Ga0439458_0000645 3300042157 Bacteria 9004
140 Ga0466969_0071942 3300044656 Bacteria 1662
141 Ga0466972_0006892 3300044658 Bacteria 5701
142 Ga0466972_0017274 3300044658 Bacteria 3610
143 Ga0466972_0050271 3300044658 Bacteria 2012
144 Ga0466972_0139256 3300044658 Bacteria 1142
145 Ga0466972_0202922 3300044658 Bacteria 929
146 Ga0466965_0002288 3300044683 Bacteria 8071
147 Ga0466965_0033005 3300044683 Bacteria 2529
148 Ga0466965_0097051 3300044683 Bacteria 1504
149 Ga0466965_0272752 3300044683 Bacteria 912
150 Ga0466965_0482776 3300044683 Bacteria 693
151 Ga0466965_0756012 3300044683 Bacteria 560
152 Ga0466966_0026614 3300044684 Bacteria 3776
153 Ga0466966_0086473 3300044684 Bacteria 1949
154 Ga0466966_0110114 3300044684 Bacteria 1698
155 Ga0466966_0199854 3300044684 Bacteria 1210
156 Ga0466961_0011575 3300044693 Bacteria 5639
157 Ga0466961_0172496 3300044693 Bacteria 1345
158 Ga0466961_0249124 3300044693 Bacteria 1091
159 Ga0466961_0310111 3300044693 Bacteria 963
160 Ga0466961_0320416 3300044693 Bacteria 945
161 Ga0466961_0677088 3300044693 Bacteria 618
162 Ga0466963_0000906 3300044694 Bacteria 15060
163 Ga0466963_0020165 3300044694 Bacteria 4190
164 Ga0466963_0024129 3300044694 Bacteria 3870
165 Ga0466963_0041195 3300044694 Bacteria 3028
166 Ga0466963_0062675 3300044694 Bacteria 2487
167 Ga0466963_0119386 3300044694 Bacteria 1813
168 Ga0466963_0830021 3300044694 Bacteria 652
169 Ga0466964_0063321 3300044706 Bacteria 1544
170 Ga0466971_0005411 3300044719 Bacteria 5537
171 Ga0466971_0011863 3300044719 Bacteria 3818
172 Ga0466971_0067750 3300044719 Bacteria 1618
173 Ga0466971_0151200 3300044719 Bacteria 1084
174 Ga0466971_0416953 3300044719 Bacteria 656
175 Ga0466970_0002188 3300044765 Bacteria 9445
176 Ga0466970_0040552 3300044765 Bacteria 2472
177 Ga0466970_0042470 3300044765 Bacteria 2418
178 Ga0466970_0095529 3300044765 Bacteria 1616
179 Ga0466970_0341780 3300044765 Bacteria 848
180 Ga0466970_0534025 3300044765 Bacteria 677
181 Ga0466957_0004300 3300044842 Bacteria 7905
182 Ga0466957_0017816 3300044842 Bacteria 4166
183 Ga0466957_0027994 3300044842 Bacteria 3352
184 Ga0466957_0045792 3300044842 Bacteria 2653
185 Ga0466960_0011382 3300044901 Bacteria 3721
186 Ga0466960_0039761 3300044901 Bacteria 2220
187 Ga0466960_0049313 3300044901 Bacteria 2026
188 Ga0466960_0139073 3300044901 Bacteria 1288
189 Ga0466960_0160151 3300044901 Bacteria 1208
190 Ga0466959_0046659 3300045049 Bacteria 3187
191 Ga0466959_0475361 3300045049 Bacteria 846
192 Ga0466958_0012336 3300045836 Bacteria 4839
193 Ga0466958_0111693 3300045836 Bacteria 1706
194 Ga0466967_0030005 3300045976 Bacteria 4558
195 Ga0466967_0064840 3300045976 Bacteria 3250
196 Ga0466967_0065558 3300045976 Bacteria 3233
197 Ga0466967_0070996 3300045976 Bacteria 3117
198 Ga0466967_0175825 3300045976 Bacteria 2017
199 Ga0466967_0586956 3300045976 Bacteria 1099
200 Ga0466967_1193987 3300045976 Bacteria 758
201 Ga0495617_034958 3300046452 Bacteria 1687
202 Ga0495617_124556 3300046452 Bacteria 829
203 Ga0495627_067361 3300046453 Bacteria 1050
204 Ga0495627_121917 3300046453 Bacteria 736
205 Ga0495592_0024587 3300046454 Bacteria 4579
206 Ga0495592_0083274 3300046454 Bacteria 2310
207 Ga0495603_0005942 3300046455 Bacteria 7298
208 Ga0495603_0013980 3300046455 Bacteria 4854
209 Ga0495603_0018960 3300046455 Bacteria 4164
210 Ga0495603_0021545 3300046455 Bacteria 3903
211 Ga0495603_0061976 3300046455 Bacteria 2208
212 Ga0495603_0156524 3300046455 Bacteria 1322
213 Ga0495603_0217491 3300046455 Bacteria 1102
214 Ga0495603_0267276 3300046455 Bacteria 984
215 Ga0495590_0033704 3300046457 Bacteria 1790
216 Ga0495590_0051572 3300046457 Bacteria 1437
217 Ga0495590_0084281 3300046457 Bacteria 1121
218 Ga0495629_0002131 3300046459 Bacteria 15349
219 Ga0495629_0005670 3300046459 Bacteria 9325
220 Ga0495629_0022041 3300046459 Bacteria 4542
221 Ga0495629_0031921 3300046459 Bacteria 3729
222 Ga0495629_0053480 3300046459 Bacteria 2825
223 Ga0495629_0056420 3300046459 Bacteria 2746
224 Ga0495629_0084455 3300046459 Bacteria 2215
225 Ga0495629_0145062 3300046459 Bacteria 1651
226 Ga0495629_0168495 3300046459 Bacteria 1521
227 Ga0495629_0937813 3300046459 Bacteria 566
228 Ga0495638_0101119 3300046460 Bacteria 1724
229 Ga0495638_0227108 3300046460 Bacteria 1040
230 Ga0495638_0395506 3300046460 Bacteria 718
231 Ga0495580_0387540 3300046472 Bacteria 943
232 Ga0495580_0491755 3300046472 Bacteria 820
233 Ga0495605_0008767 3300046474 Bacteria 5706
234 Ga0495605_0142342 3300046474 Bacteria 1075
235 Ga0495639_0029347 3300046475 Bacteria 2441
236 Ga0495662_0259454 3300046476 Bacteria 855
237 Ga0495662_0407191 3300046476 Bacteria 668
238 Ga0495664_0068493 3300046477 Bacteria 2117
239 Ga0495664_0200409 3300046477 Bacteria 1209
240 Ga0495585_0135918 3300046492 Bacteria 1291
241 Ga0495585_0399865 3300046492 Bacteria 661
242 Ga0495594_0003935 3300046499 Bacteria 7642
243 Ga0495594_0101627 3300046499 Bacteria 1617
244 Ga0495607_0016982 3300046501 Bacteria 4685
245 Ga0495607_0066758 3300046501 Bacteria 2023
246 Ga0495583_0055218 3300046506 Bacteria 1795
247 Ga0495583_0056780 3300046506 Bacteria 1763
248 Ga0495583_0226951 3300046506 Bacteria 753
249 Ga0495606_0011559 3300046507 Bacteria 7185
250 Ga0495606_0225024 3300046507 Bacteria 1055
251 Ga0495608_0359377 3300046511 Bacteria 895
252 Ga0495610_0080872 3300046512 Bacteria 1493
253 Ga0495616_0001697 3300046513 Bacteria 15026
254 Ga0495618_0113938 3300046514 Bacteria 1731
255 Ga0495618_0242897 3300046514 Bacteria 1131
256 Ga0495620_0028623 3300046515 Bacteria 2588
257 Ga0495620_0048858 3300046515 Bacteria 1813
258 Ga0495620_0093140 3300046515 Bacteria 1207
259 Ga0495628_0079385 3300046516 Bacteria 2551
260 Ga0495628_0110187 3300046516 Bacteria 2118
261 Ga0495628_0247615 3300046516 Bacteria 1331
262 Ga0495630_0078964 3300046517 Bacteria 2482
263 Ga0495631_0087296 3300046518 Bacteria 1343
264 Ga0495631_0093083 3300046518 Bacteria 1297
265 Ga0495643_0002933 3300046522 Bacteria 12926
266 Ga0495648_0059669 3300046524 Bacteria 2274
267 Ga0495648_0095663 3300046524 Bacteria 1652
268 Ga0495648_0459873 3300046524 Bacteria 554
269 Ga0495666_0031422 3300046526 Bacteria 2601
270 Ga0495666_0128025 3300046526 Bacteria 1187
271 Ga0495652_0094639 3300046529 Bacteria 2436
272 Ga0495652_0130410 3300046529 Bacteria 1991
273 Ga0495654_0146555 3300046530 Bacteria 1047
274 Ga0495640_0048489 3300046533 Bacteria 2935
275 Ga0495640_0179369 3300046533 Bacteria 1350
276 Ga0495586_0201957 3300046535 Bacteria 1127
277 Ga0495587_0048476 3300046536 Bacteria 2515
278 Ga0495609_0353442 3300046538 Bacteria 592
279 Ga0495597_0041174 3300046542 Bacteria 2064
280 Ga0495597_0158604 3300046542 Bacteria 924
281 Ga0495645_0166220 3300046543 Bacteria 1521
282 Ga0495622_0001908 3300046557 Bacteria 10253
283 Ga0495622_0002936 3300046557 Bacteria 8123
284 Ga0495622_0216657 3300046557 Bacteria 849
285 Ga0495622_0278913 3300046557 Bacteria 731
286 Ga0495633_0158165 3300046558 Bacteria 1045
287 Ga0495656_0256988 3300046615 Bacteria 884
288 Ga0495668_0095041 3300046616 Bacteria 1631
289 Ga0495668_0470815 3300046616 Bacteria 692
290 Ga0495634_0001444 3300046642 Bacteria 21145
291 Ga0495634_0154459 3300046642 Bacteria 1449
292 Ga0495634_0398351 3300046642 Bacteria 818
293 Ga0495611_0049426 3300046648 Bacteria 1892
294 Ga0495611_0070060 3300046648 Bacteria 1602
295 Ga0495611_0155890 3300046648 Bacteria 1066
296 Ga0495625_0011990 3300046660 Bacteria 7036
297 Ga0495625_0066191 3300046660 Bacteria 2546
298 Ga0495625_0157293 3300046660 Bacteria 1524
299 Ga0495625_0260784 3300046660 Bacteria 1121
300 Ga0495625_0337384 3300046660 Bacteria 956
301 Ga0495635_0000778 3300046663 Bacteria 20772
302 Ga0495635_0017855 3300046663 Bacteria 4955
303 Ga0495635_0073072 3300046663 Bacteria 2349
304 Ga0495661_0150904 3300046665 Bacteria 1255
305 Ga0495588_0003340 3300046674 Bacteria 6969
306 Ga0495588_0030458 3300046674 Bacteria 2712
307 Ga0495588_0059034 3300046674 Bacteria 1983
308 Ga0495588_0205278 3300046674 Bacteria 1041
309 Ga0495657_0006812 3300046675 Bacteria 8894
310 Ga0495657_0058369 3300046675 Bacteria 2562
311 Ga0495657_0147722 3300046675 Bacteria 1461
312 Ga0495657_0377409 3300046675 Bacteria 837
313 Ga0495623_0251531 3300046679 Bacteria 993
314 Ga0495646_0708901 3300046680 Bacteria 506
315 Ga0495613_0001196 3300046689 Bacteria 19807
316 Ga0495613_0087059 3300046689 Bacteria 2264
317 Ga0495613_0126830 3300046689 Bacteria 1829
318 Ga0495613_0128734 3300046689 Bacteria 1813
319 Ga0495613_0174683 3300046689 Bacteria 1523
320 Ga0495613_0210436 3300046689 Bacteria 1368
321 Ga0495613_0379732 3300046689 Bacteria 966
322 Ga0495613_0704346 3300046689 Bacteria 664
323 Ga0495624_0151784 3300046690 Bacteria 1417
324 Ga0495670_0103936 3300046691 Bacteria 1465
325 Ga0495671_0009989 3300046692 Bacteria 5281
326 Ga0495671_0070221 3300046692 Bacteria 1721
327 Ga0495649_0010701 3300046694 Bacteria 5402
328 Ga0495649_0124220 3300046694 Bacteria 1363
329 Ga0495649_0155261 3300046694 Bacteria 1201
330 Ga0495649_0170048 3300046694 Bacteria 1141
331 Ga0495649_0302717 3300046694 Bacteria 814
332 Ga0495589_0025249 3300046794 Bacteria 3016
333 Ga0495589_0049531 3300046794 Bacteria 2079
334 Ga0495589_0068260 3300046794 Bacteria 1739
335 Ga0495589_0086091 3300046794 Bacteria 1526
336 Ga0495589_0119758 3300046794 Bacteria 1268
337 Ga0495589_0181363 3300046794 Bacteria 998
338 Ga0495600_0004971 3300046809 Bacteria 7984
339 Ga0495600_0062535 3300046809 Bacteria 2432
340 Ga0495600_0165992 3300046809 Bacteria 1426
341 Ga0495660_0049160 3300046810 Bacteria 2304
342 Ga0495660_0113448 3300046810 Bacteria 1380
343 Ga0495581_0008978 3300047315 Bacteria 5784
344 Ga0495604_0000574 3300047317 Bacteria 32248
345 Ga0495604_0128670 3300047317 Bacteria 1822
346 Ga0495604_0135698 3300047317 Bacteria 1763
347 Ga0495636_0024705 3300047318 Bacteria 2438
348 Ga0495636_0063577 3300047318 Bacteria 1564
349 Ga0495636_0114961 3300047318 Bacteria 1186
350 Ga0495636_0163323 3300047318 Bacteria 1004
351 Ga0495636_0387315 3300047318 Bacteria 664
352 Ga0495674_0078911 3300047319 Bacteria 2828
353 Ga0495674_0189847 3300047319 Bacteria 1708
354 Ga0495676_0008294 3300047321 Bacteria 9524
355 Ga0495676_0015728 3300047321 Bacteria 6725
356 Ga0495676_0018149 3300047321 Bacteria 6205
357 Ga0495676_0083304 3300047321 Bacteria 2417
358 Ga0495676_0247172 3300047321 Bacteria 1218
359 Ga0495676_0329428 3300047321 Bacteria 1024
360 Ga0495676_1040063 3300047321 Bacteria 522
361 Ga0495680_0040878 3300047322 Bacteria 3691
362 Ga0495683_0013278 3300047323 Bacteria 4311
363 Ga0495683_0180223 3300047323 Bacteria 965
364 Ga0495687_003611 3300047443 Bacteria 11057
365 Ga0495687_053503 3300047443 Bacteria 1699
366 Ga0495687_064112 3300047443 Bacteria 1501
367 Ga0495675_0003708 3300047444 Bacteria 9233
368 Ga0495675_0043140 3300047444 Bacteria 2874
369 Ga0495675_0069799 3300047444 Bacteria 2218
370 Ga0495677_0059645 3300047445 Bacteria 1413
371 Ga0495677_0206748 3300047445 Bacteria 764
372 Ga0495679_072519 3300047446 Bacteria 990
373 Ga0495685_002433 3300047447 Bacteria 5831
374 Ga0495685_015018 3300047447 Bacteria 2637
375 Ga0495685_029971 3300047447 Bacteria 1871
376 Ga0495685_054849 3300047447 Bacteria 1348
377 Ga0495685_089404 3300047447 Bacteria 1021
378 Ga0495681_0000943 3300047470 Bacteria 22360
379 Ga0495684_0216847 3300047471 Bacteria 1405
380 Ga0495686_0194761 3300047472 Bacteria 1166
381 Ga0495686_0205070 3300047472 Bacteria 1129
382 Ga0495593_0002367 3300047673 Bacteria 11325
383 Ga0495593_0110808 3300047673 Bacteria 1402
384 Ga0495593_0117226 3300047673 Bacteria 1356
385 Ga0495593_0127325 3300047673 Bacteria 1294
386 Ga0495602_0264731 3300048088 Bacteria 1273
387 Ga0495602_0335068 3300048088 Bacteria 1096
388 Ga0495614_0000234 3300048089 Bacteria 21605
389 Ga0495614_0002005 3300048089 Bacteria 8957
390 Ga0495614_0026875 3300048089 Bacteria 2481
391 Ga0495614_0117005 3300048089 Bacteria 1173
392 Ga0495614_0220200 3300048089 Bacteria 862
393 Ga0495615_0136753 3300048090 Bacteria 720
394 Ga0495626_0084234 3300048091 Bacteria 1407
395 Ga0495626_0418565 3300048091 Bacteria 517
396 Ga0496104_0519149 3300048907 Bacteria 1102
397 Ga0496104_1168891 3300048907 Bacteria 673
398 Ga0496108_0608624 3300048911 Bacteria 952
399 Ga0496109_0024158 3300048912 Bacteria 5400
400 Ga0496110_0865556 3300048913 Bacteria 809
401 Ga0496110_1743010 3300048913 Bacteria 533
402 Ga0496113_0500355 3300048916 Bacteria 976
403 Ga0496126_1362844 3300048929 Bacteria 514
404 Ga0495678_266833 3300049459 Bacteria 504
405 Ga0495682_0038865 3300049460 Bacteria 1748
406 Ga0501031_0032926 3300049568 Bacteria 3379
407 Ga0501031_0095727 3300049568 Bacteria 1937
408 Ga0501031_1039937 3300049568 Bacteria 523
409 Ga0501032_0012190 3300049569 Bacteria 6155
410 Ga0501032_0055527 3300049569 Bacteria 2664
411 Ga0501032_0116810 3300049569 Bacteria 1764
412 Ga0501033_0001008 3300049570 Bacteria 25590
413 Ga0501033_0019145 3300049570 Bacteria 5176
414 Ga0501033_0030166 3300049570 Bacteria 4074
415 Ga0501033_0083261 3300049570 Bacteria 2345
416 Ga0501033_0107547 3300049570 Bacteria 2031
417 Ga0501033_0685245 3300049570 Bacteria 698
418 Ga0501033_0722631 3300049570 Bacteria 677
419 Ga0501033_0878658 3300049570 Bacteria 603
420 Ga0501033_0890634 3300049570 Bacteria 598
421 Ga0501034_0002464 3300049571 Bacteria 22311
422 Ga0501034_0040630 3300049571 Bacteria 4708
423 Ga0501034_0066318 3300049571 Bacteria 3622
424 Ga0501034_0071537 3300049571 Bacteria 3478
425 Ga0501034_0162099 3300049571 Bacteria 2207
426 Ga0501034_0366934 3300049571 Bacteria 1366
427 Ga0501036_0000728 3300049572 Bacteria 24326
428 Ga0501036_0003759 3300049572 Bacteria 12164
429 Ga0501036_0008399 3300049572 Bacteria 8461
430 Ga0501036_0042153 3300049572 Bacteria 3864
431 Ga0501036_0076811 3300049572 Bacteria 2825
432 Ga0501036_0147310 3300049572 Bacteria 1986
433 Ga0501036_0349648 3300049572 Bacteria 1234
434 Ga0501037_0023684 3300049573 Bacteria 4539
435 Ga0501037_0026821 3300049573 Bacteria 4256
436 Ga0501037_0056218 3300049573 Bacteria 2875
437 Ga0501037_0064340 3300049573 Bacteria 2673
438 Ga0501037_0301559 3300049573 Bacteria 1112
439 Ga0501038_0003665 3300049574 Bacteria 14311
440 Ga0501038_0030997 3300049574 Bacteria 4727
441 Ga0501038_0099463 3300049574 Bacteria 2424
442 Ga0501038_0147298 3300049574 Bacteria 1921
443 Ga0501038_0251615 3300049574 Bacteria 1399
444 Ga0501038_0420630 3300049574 Bacteria 1031
445 Ga0501038_0452953 3300049574 Bacteria 986
446 Ga0501039_0001589 3300049575 Bacteria 16715
447 Ga0501039_0021703 3300049575 Bacteria 4927
448 Ga0501039_0213916 3300049575 Bacteria 1516
449 Ga0501039_0320487 3300049575 Bacteria 1218
450 Ga0501039_0399076 3300049575 Bacteria 1080
451 Ga0501040_0187314 3300049576 Bacteria 1468
452 Ga0501042_0012968 3300049578 Bacteria 5662
453 Ga0501042_0070059 3300049578 Bacteria 2508
454 Ga0501042_0115550 3300049578 Bacteria 1932
455 Ga0501043_0005776 3300049579 Bacteria 9961
456 Ga0501043_0019381 3300049579 Bacteria 5341
457 Ga0501043_0022239 3300049579 Bacteria 4974
458 Ga0501043_0170597 3300049579 Bacteria 1697
459 Ga0501043_0196594 3300049579 Bacteria 1566
460 Ga0501043_0227402 3300049579 Bacteria 1441
461 Ga0501043_0490921 3300049579 Bacteria 918
462 Ga0501046_0000154 3300049580 Bacteria 71052
463 Ga0501046_0041046 3300049580 Bacteria 3693
464 Ga0501046_0077643 3300049580 Bacteria 2570
465 Ga0501046_0091254 3300049580 Bacteria 2343
466 Ga0501046_0159970 3300049580 Bacteria 1694
467 Ga0501047_0005012 3300049581 Bacteria 12431
468 Ga0501047_0018403 3300049581 Bacteria 6697
469 Ga0501047_0068551 3300049581 Bacteria 3416
470 Ga0501047_0074170 3300049581 Bacteria 3275
471 Ga0501047_0248955 3300049581 Bacteria 1625
472 Ga0501047_0354881 3300049581 Bacteria 1302
473 Ga0501048_0020154 3300049582 Bacteria 4890
474 Ga0501048_0028557 3300049582 Bacteria 4049
475 Ga0501048_0049567 3300049582 Bacteria 2992
476 Ga0501048_1175877 3300049582 Bacteria 552
477 Ga0501068_0210418 3300049584 Bacteria 1235
478 Ga0501069_0653067 3300049585 Bacteria 633
479 Ga0501069_0842745 3300049585 Bacteria 556
480 Ga0501070_0022382 3300049586 Bacteria 5294
481 Ga0501070_0050877 3300049586 Bacteria 3438
482 Ga0501070_0150987 3300049586 Bacteria 1917
483 Ga0501072_0433028 3300049588 Bacteria 1042
484 Ga0501073_0226867 3300049589 Bacteria 1290
485 Ga0501073_0595221 3300049589 Bacteria 764
486 Ga0501074_0009992 3300049590 Bacteria 6889
487 Ga0501074_0262117 3300049590 Bacteria 1229
488 Ga0501202_071224 3300049652 Bacteria 802
489 Ga0501222_050341 3300049662 Bacteria 610
490 Ga0501257_143271 3300049686 Bacteria 654
491 Ga0501234_068977 3300049707 Bacteria 609
492 Ga0501079_0924493 3300049741 Bacteria 687
493 Ga0501080_0091250 3300049742 Bacteria 2830
494 Ga0501080_0432433 3300049742 Bacteria 1181
495 Ga0501080_0793872 3300049742 Bacteria 831
496 Ga0501081_0060710 3300049743 Bacteria 2620
497 Ga0501035_0004155 3300049822 Bacteria 13764
498 Ga0501035_0032973 3300049822 Bacteria 4710
499 Ga0501035_0083966 3300049822 Bacteria 2809
500 Ga0501035_0090414 3300049822 Bacteria 2695
501 Ga0501035_0194300 3300049822 Bacteria 1743
502 Ga0501035_0214592 3300049822 Bacteria 1645
503 Ga0501035_0562077 3300049822 Bacteria 933
504 Ga0501035_1344566 3300049822 Bacteria 549
505 Ga0501044_0000886 3300049823 Bacteria 36088
506 Ga0501044_0009569 3300049823 Bacteria 10551
507 Ga0501044_0025554 3300049823 Bacteria 6260
508 Ga0501044_0093334 3300049823 Bacteria 3034
509 Ga0501044_0101342 3300049823 Bacteria 2897
510 Ga0501044_0106880 3300049823 Bacteria 2810
511 Ga0501044_0189121 3300049823 Bacteria 2022
512 Ga0501044_1068308 3300049823 Bacteria 677
513 Ga0501045_0359988 3300049824 Bacteria 1083
514 nmdc:mga03n38_199094_c1 3300050490 Bacteria 1036
515 nmdc:mga03n38_31365_c1 3300050490 Bacteria 2242
516 nmdc:mga03n38_837899_c1 3300050490 Bacteria 537
517 nmdc:mga0yw44_1003176_c1 3300050492 Bacteria 565
518 nmdc:mga0yw44_202419_c1 3300050492 Bacteria 1311
519 nmdc:mga0yw44_210755_c1 3300050492 Bacteria 1285
520 nmdc:mga06z11_110956_c1 3300050494 Bacteria 1519
521 nmdc:mga04h51_13621_c1 3300050495 Bacteria 2306
522 nmdc:mga07m45_262460_c1 3300050496 Bacteria 1005
523 nmdc:mga0sz30_209345_c1 3300050516 Bacteria 866
524 Ga0500610_0198742 3300053079 Bacteria 968
525 Ga0495655_0070541 3300053083 Bacteria 976
526 Ga0495619_0286531 3300053085 Bacteria 1141
527 Ga0500644_0027576 3300053088 Bacteria 1768
528 Ga0500640_071637 3300053095 Bacteria 1485
529 Ga0500654_097319 3300053099 Bacteria 1275
530 Ga0500660_154033 3300053100 Bacteria 885
531 Ga0500558_194156 3300053106 Bacteria 713
532 Ga0500560_004510 3300053107 Bacteria 2973
533 Ga0500560_005520 3300053107 Bacteria 2808
534 Ga0500628_249770 3300053129 Bacteria 521
535 Ga0500574_216552 3300053141 Bacteria 532
536 Ga0500600_0169954 3300053149 Bacteria 1061
537 Ga0500624_003517 3300053157 Bacteria 2054
538 Ga0501084_1432794 3300054114 Bacteria 578
539 Ga0466962_0002436 3300061719 Bacteria 8824
540 Ga0466962_0012945 3300061719 Bacteria 4012
541 Ga0466962_0032501 3300061719 Bacteria 2498
542 Ga0466962_0119653 3300061719 Bacteria 1270
543 Ga0466962_0139041 3300061719 Bacteria 1176
544 Ga0466962_0162191 3300061719 Bacteria 1087
545 2585306919 2582581313 Bacteria 10042643
546 2585320897 2582581314 Bacteria 11452267
547 2616694377 2616644814 Bacteria 11555299
548 2643945064 2643221587 Bacteria 7586415
549 2644265444 2643221647 Bacteria 10741251
550 2644431963 2643221677 Bacteria 7584031
551 2644435874 2643221678 Bacteria 9540101
552 2644632240 2643221714 Bacteria 9015452
553 2676489691 2675903060 Bacteria 10051191
554 2804844510 2802429296 Bacteria 7227771
555 2808840685 2808606359 Bacteria 9866990
556 2809231046 2808606448 Bacteria 8656184
557 2812359494 2811994879 Bacteria 9313447
558 2862182851 2862178590 Bacteria 8583590
559 2862389185 2862382967 Bacteria 10317375
560 2867437861 2867428634 Bacteria 9590268
561 2895438610 2895427314 Bacteria 13147766
562 2946066424 2946064051 Bacteria 8957905
563 2947230953 2947224130 Bacteria 9938529
564 2954675383 2954673503 Bacteria 9685905
565 2954688749 2954682443 Bacteria 9862841
566 2954703701 2954701450 Bacteria 10834262
567 2954717496 2954711539 Bacteria 10867210
568 2954734341 2954731030 Bacteria 10243860
569 2954746356 2954740390 Bacteria 10229294
570 2954753224 2954749733 Bacteria 10366972
571 2954765469 2954759201 Bacteria 9358192
572 2997602736 2997600082 Bacteria 9896405
573 3006491845 3006486233 Bacteria 8157040
574 8008562203 8008558824 Bacteria 10610750
575 8008579982 8008574985 Bacteria 7815457
576 8025417100 8025413630 Bacteria 7014048
577 8055174534 8055172936 Bacteria 9305943
578 8056836532 8056829672 Bacteria 9045328
579 Ga0495687_063454
580 JGI24735J21928_10047382
581 rootH1_10007390
582 rootH2_10003602
583 rootL2_10064976
584 rootH1_10037813
585 rootH1_10100213
586 Ga0006562J51391_1070184
587 Ga0068853_100022013
588 Ga0070672_100266326
589 Ga0068855_100234672
590 Ga0068855_100880499
591 Ga0068854_100937232
592 Ga0068856_100064545
593 Ga0068856_102066975
594 Ga0068852_100240236
595 Ga0068859_102900693
596 Ga0081455_10010127
597 Ga0081455_10100463
598 Ga0081455_10489732
599 Ga0075365_10234793
600 Ga0075368_10001904
601 Ga0075363_100021490
602 Ga0075363_100620913
603 Ga0075367_10028754
604 Ga0075369_10153166
605 Ga0075370_10593233
606 Ga0097620_102900962
607 Ga0099826_10392922
608 Ga0105244_10218829
609 Ga0105243_10424837
610 Ga0105241_10171486
611 Ga0105248_11967783
612 Ga0105237_10275938
613 Ga0105237_10753039
614 Ga0105237_10922490
615 Ga0105238_10325965
616 Ga0105238_10429851
617 Ga0105239_10619360
618 Ga0105239_13424362
619 Ga0105246_10011816
620 Ga0157369_12424140
621 Ga0157375_11642022
622 Ga0182007_10002380
623 Ga0182005_1081001
624 Ga0183367_1009
625 Ga0209758_1023199
626 Ga0207426_1003154
627 Ga0207426_1072723
628 Ga0207426_1105591
629 Ga0207647_10607690
630 Ga0207711_11242599
631 Ga0207667_12003233
632 Ga0207702_11907396
633 Ga0207674_10351176
634 Ga0209371_1010524
635 Ga0209813_10014304
636 Ga0307517_10008284
637 Ga0307515_10002305
638 Ga0307515_10167620
639 Ga0268256_1021892
640 Ga0307511_10002481
641 Ga0307511_10034181
642 Ga0307513_10218921
643 Ga0307513_10668261
644 Ga0307509_10406016
645 Ga0307509_10440638
646 Ga0307508_10008468
647 Ga0307508_10024236
648 Ga0307508_10185544
649 Ga0307514_10012028
650 Ga0307514_10200164
651 Ga0307514_10241849
652 Ga0307516_10075713
653 Ga0307516_10229829
654 Ga0307516_10349679
655 Ga0307413_10366933
656 Ga0307518_10052167
657 Ga0307518_10108297
658 Ga0307518_10378038
659 Ga0307416_100894410
660 Ga0307416_101761786
661 Ga0307415_102266449
662 Ga0307507_10057538
663 Ga0307510_10016735
664 Ga0307510_10046169
665 Ga0307510_10102029
666 Ga0307510_10176511
667 Ga0395900_0027257
668 Ga0395900_0352205
669 Ga0395898_0003346
670 Ga0395898_0015430
671 Ga0395898_0206600
672 Ga0439439_0084363
673 Ga0451789_0047678
674 Ga0451791_0519801
675 Ga0451795_1573937
676 Ga0451802_0483940
677 Ga0451802_1829622
678 Ga0451807_1522772
679 Ga0451807_1745624
680 Ga0451807_2304820
681 Ga0451835_0204678
682 Ga0451835_0643829
683 Ga0451837_0060735
684 Ga0451839_0930258
685 Ga0451841_1015362
686 Ga0451849_0071057
687 Ga0451843_1009106
688 Ga0451855_1284941
689 Ga0451853_1264913
690 Ga0451853_2310261
691 Ga0451853_2579848
692 Ga0439431_0104659
693 Ga0439433_0005741
694 Ga0439433_0018548
695 Ga0439448_0008495
696 Ga0439448_0060089
697 Ga0439449_0000259
698 Ga0439449_0340786
699 Ga0439450_027967
700 Ga0439454_022462
701 Ga0439455_0000923
702 Ga0439455_0082265
703 Ga0439457_000324
704 Ga0439457_001584
705 Ga0439462_0012882
706 Ga0439462_0135501
707 Ga0450894_000333
708 Ga0450894_053450
709 Ga0450895_001962
710 Ga0450896_018436
711 Ga0450898_000766
712 Ga0450900_005022
713 Ga0450902_016615
714 Ga0450903_000164
715 Ga0450906_002167
716 Ga0450907_045609
717 Ga0439458_0000645
718 Ga0466969_0071942
719 Ga0466972_0006892
720 Ga0466972_0017274
721 Ga0466972_0050271
722 Ga0466972_0139256
723 Ga0466972_0202922
724 Ga0466965_0002288
725 Ga0466965_0033005
726 Ga0466965_0097051
727 Ga0466965_0272752
728 Ga0466965_0482776
729 Ga0466965_0756012
730 Ga0466966_0026614
731 Ga0466966_0086473
732 Ga0466966_0110114
733 Ga0466966_0199854
734 Ga0466961_0011575
735 Ga0466961_0172496
736 Ga0466961_0249124
737 Ga0466961_0310111
738 Ga0466961_0320416
739 Ga0466961_0677088
740 Ga0466963_0000906
741 Ga0466963_0020165
742 Ga0466963_0024129
743 Ga0466963_0041195
744 Ga0466963_0062675
745 Ga0466963_0119386
746 Ga0466963_0830021
747 Ga0466964_0063321
748 Ga0466971_0005411
749 Ga0466971_0011863
750 Ga0466971_0067750
751 Ga0466971_0151200
752 Ga0466971_0416953
753 Ga0466970_0002188
754 Ga0466970_0040552
755 Ga0466970_0042470
756 Ga0466970_0095529
757 Ga0466970_0341780
758 Ga0466970_0534025
759 Ga0466957_0004300
760 Ga0466957_0017816
761 Ga0466957_0027994
762 Ga0466957_0045792
763 Ga0466960_0011382
764 Ga0466960_0039761
765 Ga0466960_0049313
766 Ga0466960_0139073
767 Ga0466960_0160151
768 Ga0466959_0046659
769 Ga0466959_0475361
770 Ga0466958_0012336
771 Ga0466958_0111693
772 Ga0466967_0030005
773 Ga0466967_0064840
774 Ga0466967_0065558
775 Ga0466967_0070996
776 Ga0466967_0175825
777 Ga0466967_0586956
778 Ga0466967_1193987
779 Ga0495617_034958
780 Ga0495617_124556
781 Ga0495627_067361
782 Ga0495627_121917
783 Ga0495592_0024587
784 Ga0495592_0083274
785 Ga0495603_0005942
786 Ga0495603_0013980
787 Ga0495603_0018960
788 Ga0495603_0021545
789 Ga0495603_0061976
790 Ga0495603_0156524
791 Ga0495603_0217491
792 Ga0495603_0267276
793 Ga0495590_0033704
794 Ga0495590_0051572
795 Ga0495590_0084281
796 Ga0495629_0002131
797 Ga0495629_0005670
798 Ga0495629_0022041
799 Ga0495629_0031921
800 Ga0495629_0053480
801 Ga0495629_0056420
802 Ga0495629_0084455
803 Ga0495629_0145062
804 Ga0495629_0168495
805 Ga0495629_0937813
806 Ga0495638_0101119
807 Ga0495638_0227108
808 Ga0495638_0395506
809 Ga0495580_0387540
810 Ga0495580_0491755
811 Ga0495605_0008767
812 Ga0495605_0142342
813 Ga0495639_0029347
814 Ga0495662_0259454
815 Ga0495662_0407191
816 Ga0495664_0068493
817 Ga0495664_0200409
818 Ga0495585_0135918
819 Ga0495585_0399865
820 Ga0495594_0003935
821 Ga0495594_0101627
822 Ga0495607_0016982
823 Ga0495607_0066758
824 Ga0495583_0055218
825 Ga0495583_0056780
826 Ga0495583_0226951
827 Ga0495606_0011559
828 Ga0495606_0225024
829 Ga0495608_0359377
830 Ga0495610_0080872
831 Ga0495616_0001697
832 Ga0495618_0113938
833 Ga0495618_0242897
834 Ga0495620_0028623
835 Ga0495620_0048858
836 Ga0495620_0093140
837 Ga0495628_0079385
838 Ga0495628_0110187
839 Ga0495628_0247615
840 Ga0495630_0078964
841 Ga0495631_0087296
842 Ga0495631_0093083
843 Ga0495643_0002933
844 Ga0495648_0059669
845 Ga0495648_0095663
846 Ga0495648_0459873
847 Ga0495666_0031422
848 Ga0495666_0128025
849 Ga0495652_0094639
850 Ga0495652_0130410
851 Ga0495654_0146555
852 Ga0495640_0048489
853 Ga0495640_0179369
854 Ga0495586_0201957
855 Ga0495587_0048476
856 Ga0495609_0353442
857 Ga0495597_0041174
858 Ga0495597_0158604
859 Ga0495645_0166220
860 Ga0495622_0001908
861 Ga0495622_0002936
862 Ga0495622_0216657
863 Ga0495622_0278913
864 Ga0495633_0158165
865 Ga0495656_0256988
866 Ga0495668_0095041
867 Ga0495668_0470815
868 Ga0495634_0001444
869 Ga0495634_0154459
870 Ga0495634_0398351
871 Ga0495611_0049426
872 Ga0495611_0070060
873 Ga0495611_0155890
874 Ga0495625_0011990
875 Ga0495625_0066191
876 Ga0495625_0157293
877 Ga0495625_0260784
878 Ga0495625_0337384
879 Ga0495635_0000778
880 Ga0495635_0017855
881 Ga0495635_0073072
882 Ga0495661_0150904
883 Ga0495588_0003340
884 Ga0495588_0030458
885 Ga0495588_0059034
886 Ga0495588_0205278
887 Ga0495657_0006812
888 Ga0495657_0058369
889 Ga0495657_0147722
890 Ga0495657_0377409
891 Ga0495623_0251531
892 Ga0495646_0708901
893 Ga0495613_0001196
894 Ga0495613_0087059
895 Ga0495613_0126830
896 Ga0495613_0128734
897 Ga0495613_0174683
898 Ga0495613_0210436
899 Ga0495613_0379732
900 Ga0495613_0704346
901 Ga0495624_0151784
902 Ga0495670_0103936
903 Ga0495671_0009989
904 Ga0495671_0070221
905 Ga0495649_0010701
906 Ga0495649_0124220
907 Ga0495649_0155261
908 Ga0495649_0170048
909 Ga0495649_0302717
910 Ga0495589_0025249
911 Ga0495589_0049531
912 Ga0495589_0068260
913 Ga0495589_0086091
914 Ga0495589_0119758
915 Ga0495589_0181363
916 Ga0495600_0004971
917 Ga0495600_0062535
918 Ga0495600_0165992
919 Ga0495660_0049160
920 Ga0495660_0113448
921 Ga0495581_0008978
922 Ga0495604_0000574
923 Ga0495604_0128670
924 Ga0495604_0135698
925 Ga0495636_0024705
926 Ga0495636_0063577
927 Ga0495636_0114961
928 Ga0495636_0163323
929 Ga0495636_0387315
930 Ga0495674_0078911
931 Ga0495674_0189847
932 Ga0495676_0008294
933 Ga0495676_0015728
934 Ga0495676_0018149
935 Ga0495676_0083304
936 Ga0495676_0247172
937 Ga0495676_0329428
938 Ga0495676_1040063
939 Ga0495680_0040878
940 Ga0495683_0013278
941 Ga0495683_0180223
942 Ga0495687_003611
943 Ga0495687_053503
944 Ga0495687_064112
945 Ga0495675_0003708
946 Ga0495675_0043140
947 Ga0495675_0069799
948 Ga0495677_0059645
949 Ga0495677_0206748
950 Ga0495679_072519
951 Ga0495685_002433
952 Ga0495685_015018
953 Ga0495685_029971
954 Ga0495685_054849
955 Ga0495685_089404
956 Ga0495681_0000943
957 Ga0495684_0216847
958 Ga0495686_0194761
959 Ga0495686_0205070
960 Ga0495593_0002367
961 Ga0495593_0110808
962 Ga0495593_0117226
963 Ga0495593_0127325
964 Ga0495602_0264731
965 Ga0495602_0335068
966 Ga0495614_0000234
967 Ga0495614_0002005
968 Ga0495614_0026875
969 Ga0495614_0117005
970 Ga0495614_0220200
971 Ga0495615_0136753
972 Ga0495626_0084234
973 Ga0495626_0418565
974 Ga0496104_0519149
975 Ga0496104_1168891
976 Ga0496108_0608624
977 Ga0496109_0024158
978 Ga0496110_0865556
979 Ga0496110_1743010
980 Ga0496113_0500355
981 Ga0496126_1362844
982 Ga0495678_266833
983 Ga0495682_0038865
984 Ga0501031_0032926
985 Ga0501031_0095727
986 Ga0501031_1039937
987 Ga0501032_0012190
988 Ga0501032_0055527
989 Ga0501032_0116810
990 Ga0501033_0001008
991 Ga0501033_0019145
992 Ga0501033_0030166
993 Ga0501033_0083261
994 Ga0501033_0107547
995 Ga0501033_0685245
996 Ga0501033_0722631
997 Ga0501033_0878658
998 Ga0501033_0890634
999 Ga0501034_0002464
1000 Ga0501034_0040630
1001 Ga0501034_0066318
1002 Ga0501034_0071537
1003 Ga0501034_0162099
1004 Ga0501034_0366934
1005 Ga0501036_0000728
1006 Ga0501036_0003759
1007 Ga0501036_0008399
1008 Ga0501036_0042153
1009 Ga0501036_0076811
1010 Ga0501036_0147310
1011 Ga0501036_0349648
1012 Ga0501037_0023684
1013 Ga0501037_0026821
1014 Ga0501037_0056218
1015 Ga0501037_0064340
1016 Ga0501037_0301559
1017 Ga0501038_0003665
1018 Ga0501038_0030997
1019 Ga0501038_0099463
1020 Ga0501038_0147298
1021 Ga0501038_0251615
1022 Ga0501038_0420630
1023 Ga0501038_0452953
1024 Ga0501039_0001589
1025 Ga0501039_0021703
1026 Ga0501039_0213916
1027 Ga0501039_0320487
1028 Ga0501039_0399076
1029 Ga0501040_0187314
1030 Ga0501042_0012968
1031 Ga0501042_0070059
1032 Ga0501042_0115550
1033 Ga0501043_0005776
1034 Ga0501043_0019381
1035 Ga0501043_0022239
1036 Ga0501043_0170597
1037 Ga0501043_0196594
1038 Ga0501043_0227402
1039 Ga0501043_0490921
1040 Ga0501046_0000154
1041 Ga0501046_0041046
1042 Ga0501046_0077643
1043 Ga0501046_0091254
1044 Ga0501046_0159970
1045 Ga0501047_0005012
1046 Ga0501047_0018403
1047 Ga0501047_0068551
1048 Ga0501047_0074170
1049 Ga0501047_0248955
1050 Ga0501047_0354881
1051 Ga0501048_0020154
1052 Ga0501048_0028557
1053 Ga0501048_0049567
1054 Ga0501048_1175877
1055 Ga0501068_0210418
1056 Ga0501069_0653067
1057 Ga0501069_0842745
1058 Ga0501070_0022382
1059 Ga0501070_0050877
1060 Ga0501070_0150987
1061 Ga0501072_0433028
1062 Ga0501073_0226867
1063 Ga0501073_0595221
1064 Ga0501074_0009992
1065 Ga0501074_0262117
1066 Ga0501202_071224
1067 Ga0501222_050341
1068 Ga0501257_143271
1069 Ga0501234_068977
1070 Ga0501079_0924493
1071 Ga0501080_0091250
1072 Ga0501080_0432433
1073 Ga0501080_0793872
1074 Ga0501081_0060710
1075 Ga0501035_0004155
1076 Ga0501035_0032973
1077 Ga0501035_0083966
1078 Ga0501035_0090414
1079 Ga0501035_0194300
1080 Ga0501035_0214592
1081 Ga0501035_0562077
1082 Ga0501035_1344566
1083 Ga0501044_0000886
1084 Ga0501044_0009569
1085 Ga0501044_0025554
1086 Ga0501044_0093334
1087 Ga0501044_0101342
1088 Ga0501044_0106880
1089 Ga0501044_0189121
1090 Ga0501044_1068308
1091 Ga0501045_0359988
1092 nmdc:mga03n38_199094_c1
1093 nmdc:mga03n38_31365_c1
1094 nmdc:mga03n38_837899_c1
1095 nmdc:mga0yw44_1003176_c1
1096 nmdc:mga0yw44_202419_c1
1097 nmdc:mga0yw44_210755_c1
1098 nmdc:mga06z11_110956_c1
1099 nmdc:mga04h51_13621_c1
1100 nmdc:mga07m45_262460_c1
1101 nmdc:mga0sz30_209345_c1
1102 Ga0500610_0198742
1103 Ga0495655_0070541
1104 Ga0495619_0286531
1105 Ga0500644_0027576
1106 Ga0500640_071637
1107 Ga0500654_097319
1108 Ga0500660_154033
1109 Ga0500558_194156
1110 Ga0500560_004510
1111 Ga0500560_005520
1112 Ga0500628_249770
1113 Ga0500574_216552
1114 Ga0500600_0169954
1115 Ga0500624_003517
1116 Ga0501084_1432794
1117 Ga0466962_0002436
1118 Ga0466962_0012945
1119 Ga0466962_0032501
1120 Ga0466962_0119653
1121 Ga0466962_0139041
1122 Ga0466962_0162191
1123 2585306919
1124 2585320897
1125 2616694377
1126 2643945064
1127 2644265444
1128 2644431963
1129 2644435874
1130 2644632240
1131 2676489691
1132 2804844510
1133 2808840685
1134 2809231046
1135 2812359494
1136 2862182851
1137 2862389185
1138 2867437861
1139 2895438610
1140 2946066424
1141 2947230953
1142 2954675383
1143 2954688749
1144 2954703701
1145 2954717496
1146 2954734341
1147 2954746356
1148 2954753224
1149 2954765469
1150 2997602736
1151 3006491845
1152 8008562203
1153 8008579982
1154 8025417100
1155 8055174534
1156 8056836532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

27

132

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6srb-assembly1.cif.gz_A crystal structure of glutathione transferase omega 3c from trametes versicolor 0.9464 2 29
2e7p-assembly5.cif.gz_D crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides 0.934 2 33
6hjs-assembly1.cif.gz_B crystal structure of glutathione transferase omega 1c from trametes versicolor 0.9311 2 29
3msz-assembly1.cif.gz_A crystal structure of glutaredoxin 1 from francisella tularensis complexed with cacodylate 0.9297 2 29
3q19-assembly1.cif.gz_B human glutathione transferase o2 0.9153 2 28
ID Description Score Start End Superfamily
af_A0A1D6IL16_82_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9805 2 29 3.40.30.10
af_A0A1D6QGT9_2_79_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9767 2 29 3.40.30.10
af_A0A0R0INI5_1_70_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.961 2 29 3.40.30.10
af_Q4CWB7_73_169_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9594 2 29 3.40.30.10
af_Q8BWM0_87_178_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9534 2 29 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A559VK17-F1-model_v4 Arsenate reductase 1.006 1 119 GO:0008794
AF-A0A117KD64-F1-model_v4 Arsenate reductase 1.005 1 119 GO:0008794
AF-A0A7X1I1Z4-F1-model_v4 Arsenate reductase family protein 1.005 1 119 GO:0008794
AF-A0A0J8BYG8-F1-model_v4 Arsenate reductase 1.005 1 119
AF-A0A0N1GY55-F1-model_v4 Arsenate reductase like protein 1.005 1 119 GO:0008794

Map