F465699

General Info

Members Datasets Scaffolds Average Seq Length
578 256 1156 369

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100253214|Ga0070714_1002532142
Length 396
Sequence MRRSPVSSSPLVAEPAGSPSESRREHAVVRHVVVFGRVLREGGLEIGPRRIADALRGLDAIDLARQEDVYWTLRQTLVARHEELETFDRAFNAWFLRAPAPPRPREIDRPSPVGQRRKGGAPGPGPELDGGEIEVGAWSYDELLRTRDFASMTPEEFARARILIRQIAIGRPRRRTHRLRPDRRGDVLDVRALVRASLATGGDPVTRAYRSRAYGPRKLVLLLDISGSMDAYARALLLYLHAARGSGRGVETFAFGTRLSRLTPELGVRDPEAALAAAAKRVTDWSGGTRIGESLKAYNGEWGRRALTRGAVVVVLSDGCERGDPGLVASQMERLARQAFAIVWVNPLKGHPEYEPLTGGMRAAYTHVDRLVSGHDLASLETLGTVLAGIERRHAA

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.01
Rhizosphere 85.81
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100253214 3300005435 Bacteria 1629
2 JGI24738J21930_10002519 3300002075 Bacteria 4758
3 JGI25406J46586_10001030 3300003203 Bacteria 13013
4 Ga0070658_10006813 3300005327 Bacteria 9240
5 Ga0070676_10045014 3300005328 Bacteria 2570
6 Ga0070683_100211433 3300005329 Bacteria 1843
7 Ga0070670_100003940 3300005331 Bacteria 12386
8 Ga0070670_100012525 3300005331 Bacteria 7258
9 Ga0070666_10184052 3300005335 Bacteria 1466
10 Ga0070682_100021271 3300005337 Bacteria 3825
11 Ga0070682_100035078 3300005337 Bacteria 3060
12 Ga0070682_100172216 3300005337 Bacteria 1505
13 Ga0070660_100005447 3300005339 Bacteria 8813
14 Ga0070660_100091243 3300005339 Bacteria 2403
15 Ga0070660_100190986 3300005339 Bacteria 1659
16 Ga0070689_100026468 3300005340 Bacteria 4368
17 Ga0070691_10008208 3300005341 Bacteria 4784
18 Ga0070661_100011372 3300005344 Bacteria 6200
19 Ga0070661_100079208 3300005344 Bacteria 2424
20 Ga0070692_10093752 3300005345 Bacteria 1635
21 Ga0070668_100015420 3300005347 Bacteria 5710
22 Ga0070675_100024105 3300005354 Bacteria 4872
23 Ga0070674_100002472 3300005356 Bacteria 10228
24 Ga0070674_100010330 3300005356 Bacteria 5639
25 Ga0070674_100048278 3300005356 Bacteria 2921
26 Ga0070674_100107084 3300005356 Bacteria 2046
27 Ga0070674_100123399 3300005356 Bacteria 1921
28 Ga0070673_100001497 3300005364 Bacteria 13712
29 Ga0070673_100273119 3300005364 Bacteria 1480
30 Ga0070688_100002344 3300005365 Bacteria 9552
31 Ga0070659_100068853 3300005366 Bacteria 2808
32 Ga0070659_100111989 3300005366 Bacteria 2204
33 Ga0070667_100002802 3300005367 Bacteria 15045
34 Ga0070667_100210460 3300005367 Bacteria 1728
35 Ga0070703_10006766 3300005406 Bacteria 3216
36 Ga0070714_100011860 3300005435 Bacteria 6927
37 Ga0070714_100015242 3300005435 Bacteria 6183
38 Ga0070714_100102277 3300005435 Bacteria 2526
39 Ga0070714_100121003 3300005435 Bacteria 2329
40 Ga0070713_100059721 3300005436 Bacteria 3185
41 Ga0070710_10047012 3300005437 Bacteria 2406
42 Ga0070701_10005851 3300005438 Bacteria 5126
43 Ga0070701_10069236 3300005438 Bacteria 1882
44 Ga0070711_100033223 3300005439 Bacteria 3435
45 Ga0070705_100061414 3300005440 Bacteria 2233
46 Ga0070700_100031357 3300005441 Bacteria 3184
47 Ga0070700_100197538 3300005441 Unclassified 1411
48 Ga0070694_100076994 3300005444 Bacteria 2310
49 Ga0070678_100015109 3300005456 Bacteria 4896
50 Ga0070678_100017668 3300005456 Bacteria 4600
51 Ga0070678_100018200 3300005456 Bacteria 4550
52 Ga0070662_100017102 3300005457 Bacteria 4881
53 Ga0070681_10011153 3300005458 Bacteria 8891
54 Ga0068867_100085453 3300005459 Bacteria 2385
55 Ga0068867_100137612 3300005459 Bacteria 1905
56 Ga0068867_100180153 3300005459 Bacteria 1679
57 Ga0070685_10002424 3300005466 Bacteria 9594
58 Ga0070706_100021289 3300005467 Bacteria 5972
59 Ga0070706_100029075 3300005467 Bacteria 5091
60 Ga0070706_100194912 3300005467 Bacteria 1893
61 Ga0070707_100092416 3300005468 Bacteria 2929
62 Ga0070707_100191247 3300005468 Bacteria 1995
63 Ga0070698_100002289 3300005471 Bacteria 21205
64 Ga0070698_100020650 3300005471 Bacteria 6906
65 Ga0070698_100036620 3300005471 Bacteria 5066
66 Ga0070698_100108958 3300005471 Bacteria 2736
67 Ga0070699_100052017 3300005518 Bacteria 3546
68 Ga0070699_100069896 3300005518 Bacteria 3052
69 Ga0070699_100081094 3300005518 Bacteria 2828
70 Ga0070679_100003293 3300005530 Bacteria 14787
71 Ga0070679_100022999 3300005530 Bacteria 6097
72 Ga0070679_100067517 3300005530 Bacteria 3566
73 Ga0070679_100113136 3300005530 Bacteria 2700
74 Ga0070684_100018044 3300005535 Bacteria 5803
75 Ga0070684_100047272 3300005535 Bacteria 3729
76 Ga0068853_100009961 3300005539 Bacteria 7675
77 Ga0068853_100280882 3300005539 Bacteria 1535
78 Ga0070686_100110225 3300005544 Bacteria 1874
79 Ga0070695_100040387 3300005545 Bacteria 2954
80 Ga0070696_100035730 3300005546 Bacteria 3423
81 Ga0070693_100027761 3300005547 Bacteria 3071
82 Ga0070693_100053594 3300005547 Bacteria 2316
83 Ga0070704_100008702 3300005549 Bacteria 6104
84 Ga0070704_100134954 3300005549 Bacteria 1918
85 Ga0070664_100014252 3300005564 Bacteria 6484
86 Ga0070664_100052366 3300005564 Bacteria 3457
87 Ga0068857_100026574 3300005577 Bacteria 5102
88 Ga0068857_100080043 3300005577 Bacteria 2917
89 Ga0068856_100019762 3300005614 Bacteria 6537
90 Ga0068856_100022850 3300005614 Bacteria 6082
91 Ga0070702_100027284 3300005615 Bacteria 3079
92 Ga0070702_100064946 3300005615 Bacteria 2136
93 Ga0068852_100007859 3300005616 Bacteria 7809
94 Ga0068852_100028658 3300005616 Bacteria 4562
95 Ga0068859_100039017 3300005617 Bacteria 4763
96 Ga0068859_100274602 3300005617 Bacteria 1778
97 Ga0068864_100162584 3300005618 Bacteria 2030
98 Ga0068864_100212347 3300005618 Bacteria 1783
99 Ga0068861_100154603 3300005719 Bacteria 1885
100 Ga0068870_10010648 3300005840 Bacteria 4232
101 Ga0068870_10063398 3300005840 Bacteria 1993
102 Ga0068870_10099521 3300005840 Bacteria 1640
103 Ga0068863_100044143 3300005841 Bacteria 4231
104 Ga0068858_100024703 3300005842 Bacteria 5596
105 Ga0068858_100183178 3300005842 Bacteria 1978
106 Ga0068860_100024714 3300005843 Bacteria 5802
107 Ga0081455_10009289 3300005937 Bacteria 10125
108 Ga0081455_10019628 3300005937 Bacteria 6386
109 Ga0081455_10034188 3300005937 Bacteria 4557
110 Ga0081455_10035432 3300005937 Bacteria 4459
111 Ga0081455_10071332 3300005937 Bacteria 2880
112 Ga0081539_10000216 3300005985 Bacteria 134976
113 Ga0070717_10018957 3300006028 Bacteria 5386
114 Ga0070717_10046764 3300006028 Bacteria 3542
115 Ga0075432_10001526 3300006058 Bacteria 7584
116 Ga0075432_10053092 3300006058 Bacteria 1432
117 Ga0070716_100016688 3300006173 Bacteria 3795
118 Ga0070712_100099443 3300006175 Bacteria 2147
119 Ga0097621_100063032 3300006237 Bacteria 3045
120 Ga0068871_100147753 3300006358 Bacteria 2003
121 Ga0075428_100008186 3300006844 Bacteria 11600
122 Ga0075428_100435519 3300006844 Bacteria 1405
123 Ga0075430_100010663 3300006846 Bacteria 7787
124 Ga0075431_100037810 3300006847 Bacteria 4970
125 Ga0075433_10116142 3300006852 Bacteria 2374
126 Ga0075434_100058689 3300006871 Bacteria 3824
127 Ga0075429_100187406 3300006880 Bacteria 1813
128 Ga0068865_100003053 3300006881 Bacteria 10011
129 Ga0068865_100045919 3300006881 Bacteria 2995
130 Ga0097620_100039017 3300006931 Bacteria 4763
131 Ga0097620_100274618 3300006931 Bacteria 1778
132 Ga0075435_100106250 3300007076 Bacteria 2331
133 Ga0111539_10005600 3300009094 Bacteria 16249
134 Ga0111539_10063259 3300009094 Bacteria 4379
135 Ga0111539_10064054 3300009094 Bacteria 4350
136 Ga0111539_10074740 3300009094 Bacteria 3993
137 Ga0105245_10009018 3300009098 Bacteria 8696
138 Ga0105245_10112968 3300009098 Bacteria 2529
139 Ga0105245_10343439 3300009098 Bacteria 1477
140 Ga0105245_10364944 3300009098 Bacteria 1434
141 Ga0114129_10002317 3300009147 Bacteria 26428
142 Ga0114129_10190717 3300009147 Bacteria 2783
143 Ga0114129_10453789 3300009147 Bacteria 1681
144 Ga0105243_10007847 3300009148 Bacteria 8204
145 Ga0105243_10014078 3300009148 Bacteria 6053
146 Ga0105243_10108401 3300009148 Bacteria 2318
147 Ga0105243_10137731 3300009148 Bacteria 2079
148 Ga0105243_10202339 3300009148 Bacteria 1742
149 Ga0105241_10197367 3300009174 Bacteria 1679
150 Ga0105242_10093583 3300009176 Bacteria 2534
151 Ga0105248_10018496 3300009177 Bacteria 7701
152 Ga0105248_10133286 3300009177 Bacteria 2803
153 Ga0105238_10039167 3300009551 Bacteria 4807
154 Ga0105249_10173138 3300009553 Bacteria 2095
155 Ga0105249_10288343 3300009553 Bacteria 1642
156 Ga0105239_10026053 3300010375 Bacteria 6437
157 Ga0105239_10153508 3300010375 Bacteria 2571
158 Ga0105239_10333608 3300010375 Bacteria 1711
159 Ga0105246_10071889 3300011119 Bacteria 2437
160 Ga0157371_10008817 3300013102 Bacteria 7987
161 Ga0157370_10212217 3300013104 Bacteria 1794
162 Ga0157369_10005947 3300013105 Bacteria 14167
163 Ga0157374_10065986 3300013296 Bacteria 3400
164 Ga0157378_10152787 3300013297 Bacteria 2152
165 Ga0163162_10169167 3300013306 Bacteria 2310
166 Ga0163162_10605650 3300013306 Bacteria 1221
167 Ga0157372_10027412 3300013307 Bacteria 6203
168 Ga0157375_10097969 3300013308 Bacteria 3008
169 Ga0157375_10142742 3300013308 Bacteria 2523
170 Ga0157375_10157757 3300013308 Bacteria 2409
171 Ga0157375_10320571 3300013308 Bacteria 1714
172 Ga0163163_10057351 3300014325 Bacteria 3851
173 Ga0163163_10082744 3300014325 Bacteria 3214
174 Ga0163163_10186430 3300014325 Bacteria 2122
175 Ga0157380_10020727 3300014326 Bacteria 4918
176 Ga0157380_10039984 3300014326 Bacteria 3650
177 Ga0157380_10069743 3300014326 Bacteria 2838
178 Ga0157377_10012852 3300014745 Bacteria 4221
179 Ga0157379_10019699 3300014968 Bacteria 5961
180 Ga0157379_10046824 3300014968 Bacteria 3859
181 Ga0157379_10214694 3300014968 Bacteria 1742
182 Ga0157376_10177910 3300014969 Bacteria 1942
183 Ga0157376_10226247 3300014969 Bacteria 1735
184 Ga0157376_10393508 3300014969 Bacteria 1338
185 Ga0206353_10740778 3300020082 Bacteria 1971
186 Ga0213871_10001245 3300021441 Bacteria 4151
187 Ga0224712_10021077 3300022467 Bacteria 2224
188 Ga0207656_10082693 3300025321 Bacteria 1446
189 Ga0207653_10007683 3300025885 Bacteria 3362
190 Ga0207642_10017070 3300025899 Bacteria 2752
191 Ga0207642_10056991 3300025899 Bacteria 1795
192 Ga0207688_10022838 3300025901 Bacteria 3426
193 Ga0207647_10070752 3300025904 Bacteria 2106
194 Ga0207699_10159610 3300025906 Bacteria 1500
195 Ga0207645_10042305 3300025907 Bacteria 2915
196 Ga0207645_10069487 3300025907 Bacteria 2253
197 Ga0207643_10001366 3300025908 Bacteria 14073
198 Ga0207643_10107084 3300025908 Bacteria 1644
199 Ga0207705_10161066 3300025909 Bacteria 1686
200 Ga0207684_10056415 3300025910 Bacteria 3332
201 Ga0207707_10009939 3300025912 Bacteria 8249
202 Ga0207693_10001920 3300025915 Bacteria 18192
203 Ga0207693_10126236 3300025915 Bacteria 2011
204 Ga0207693_10215423 3300025915 Bacteria 1509
205 Ga0207657_10007917 3300025919 Bacteria 10838
206 Ga0207657_10027418 3300025919 Bacteria 5217
207 Ga0207657_10079537 3300025919 Bacteria 2758
208 Ga0207657_10134519 3300025919 Bacteria 2024
209 Ga0207657_10150510 3300025919 Bacteria 1896
210 Ga0207649_10048446 3300025920 Bacteria 2621
211 Ga0207652_10002716 3300025921 Bacteria 14840
212 Ga0207652_10052728 3300025921 Bacteria 3492
213 Ga0207652_10134175 3300025921 Bacteria 2210
214 Ga0207652_10264295 3300025921 Bacteria 1552
215 Ga0207650_10013901 3300025925 Bacteria 5584
216 Ga0207650_10024739 3300025925 Bacteria 4273
217 Ga0207659_10017888 3300025926 Bacteria 4637
218 Ga0207659_10053729 3300025926 Bacteria 2874
219 Ga0207687_10014490 3300025927 Bacteria 5159
220 Ga0207687_10019300 3300025927 Bacteria 4516
221 Ga0207687_10020223 3300025927 Bacteria 4415
222 Ga0207687_10042693 3300025927 Bacteria 3121
223 Ga0207687_10048161 3300025927 Bacteria 2958
224 Ga0207687_10052839 3300025927 Bacteria 2836
225 Ga0207687_10119855 3300025927 Bacteria 1966
226 Ga0207687_10134433 3300025927 Bacteria 1869
227 Ga0207687_10204658 3300025927 Bacteria 1545
228 Ga0207700_10043334 3300025928 Bacteria 3305
229 Ga0207664_10104870 3300025929 Bacteria 2342
230 Ga0207644_10081627 3300025931 Bacteria 2390
231 Ga0207690_10060285 3300025932 Bacteria 2574
232 Ga0207706_10021078 3300025933 Bacteria 5854
233 Ga0207706_10089695 3300025933 Bacteria 2703
234 Ga0207706_10262789 3300025933 Bacteria 1506
235 Ga0207686_10004271 3300025934 Bacteria 7659
236 Ga0207686_10085157 3300025934 Bacteria 2073
237 Ga0207709_10006169 3300025935 Bacteria 6751
238 Ga0207709_10063848 3300025935 Bacteria 2309
239 Ga0207670_10052589 3300025936 Bacteria 2739
240 Ga0207669_10026751 3300025937 Bacteria 3145
241 Ga0207669_10144950 3300025937 Bacteria 1654
242 Ga0207704_10015730 3300025938 Bacteria 3866
243 Ga0207704_10037474 3300025938 Bacteria 2801
244 Ga0207704_10113699 3300025938 Bacteria 1836
245 Ga0207665_10011309 3300025939 Bacteria 5859
246 Ga0207691_10021858 3300025940 Bacteria 6038
247 Ga0207691_10028733 3300025940 Bacteria 5204
248 Ga0207691_10035027 3300025940 Bacteria 4665
249 Ga0207711_10197971 3300025941 Bacteria 1833
250 Ga0207689_10153648 3300025942 Bacteria 1897
251 Ga0207689_10179028 3300025942 Bacteria 1748
252 Ga0207661_10012443 3300025944 Bacteria 6183
253 Ga0207661_10068899 3300025944 Bacteria 2882
254 Ga0207661_10265056 3300025944 Bacteria 1531
255 Ga0207679_10157833 3300025945 Bacteria 1854
256 Ga0207679_10254174 3300025945 Bacteria 1495
257 Ga0207668_10267866 3300025972 Bacteria 1395
258 Ga0207640_10074408 3300025981 Bacteria 2299
259 Ga0207640_10166145 3300025981 Bacteria 1639
260 Ga0207677_10011319 3300026023 Bacteria 5082
261 Ga0207639_10057106 3300026041 Bacteria 2995
262 Ga0207678_10024010 3300026067 Bacteria 5329
263 Ga0207708_10011773 3300026075 Bacteria 6517
264 Ga0207708_10016363 3300026075 Bacteria 5575
265 Ga0207708_10142580 3300026075 Bacteria 1881
266 Ga0207708_10201342 3300026075 Bacteria 1588
267 Ga0207708_10272964 3300026075 Bacteria 1368
268 Ga0207702_10003255 3300026078 Bacteria 15002
269 Ga0207702_10014040 3300026078 Bacteria 6650
270 Ga0207702_10172278 3300026078 Bacteria 1986
271 Ga0207648_10024975 3300026089 Bacteria 5327
272 Ga0207648_10076117 3300026089 Bacteria 2925
273 Ga0207648_10124696 3300026089 Bacteria 2265
274 Ga0207648_10240489 3300026089 Bacteria 1612
275 Ga0207674_10014525 3300026116 Bacteria 8694
276 Ga0207674_10018936 3300026116 Bacteria 7464
277 Ga0207675_100035383 3300026118 Bacteria 4658
278 Ga0207675_100035433 3300026118 Bacteria 4655
279 Ga0207683_10008250 3300026121 Bacteria 8908
280 Ga0207683_10020687 3300026121 Bacteria 5630
281 Ga0207683_10112498 3300026121 Bacteria 2438
282 Ga0207698_10007276 3300026142 Bacteria 6936
283 Ga0207698_10040198 3300026142 Bacteria 3472
284 Ga0207428_10000277 3300027907 Bacteria 69011
285 Ga0207428_10013248 3300027907 Bacteria 7211
286 Ga0207428_10106074 3300027907 Bacteria 2166
287 Ga0207428_10127412 3300027907 Bacteria 1949
288 Ga0268266_10115026 3300028379 Bacteria 2388
289 Ga0268264_10147314 3300028381 Bacteria 2107
290 Ga0265319_1016255 3300028563 Bacteria 2855
291 Ga0265334_10012186 3300028573 Bacteria 3613
292 Ga0265318_10003613 3300028577 Bacteria 7729
293 Ga0265322_10020385 3300028654 Bacteria 1901
294 Ga0265320_10025032 3300031240 Bacteria 3145
295 Ga0265320_10033007 3300031240 Bacteria 2646
296 Ga0265325_10046973 3300031241 Bacteria 2237
297 Ga0265340_10024401 3300031247 Bacteria 3072
298 Ga0265327_10046387 3300031251 Bacteria 2300
299 Ga0265316_10008980 3300031344 Bacteria 9218
300 Ga0373948_0001553 3300034817 Bacteria 3214
301 Ga0373960_0012571 3300035121 Bacteria 2106
302 Ga0373931_0025122 3300035691 Bacteria 3025
303 Ga0373947_0022800 3300035725 Bacteria 3634
304 Ga0373925_0011766 3300037068 Bacteria 6332
305 Ga0395899_0004083 3300037312 Bacteria 11494
306 Ga0395899_0014905 3300037312 Bacteria 5930
307 Ga0395899_0062184 3300037312 Bacteria 2749
308 Ga0395899_0099282 3300037312 Bacteria 2103
309 Ga0395900_0006024 3300037418 Bacteria 12647
310 Ga0395900_0015244 3300037418 Bacteria 7838
311 Ga0395900_0141402 3300037418 Bacteria 2464
312 Ga0395900_0216680 3300037418 Bacteria 1931
313 Ga0395898_0051149 3300037466 Bacteria 4041
314 Ga0395898_0117922 3300037466 Bacteria 2543
315 Ga0395898_0168535 3300037466 Bacteria 2093
316 Ga0395905_0006295 3300037471 Bacteria 11971
317 Ga0395905_0032760 3300037471 Bacteria 4885
318 Ga0395905_0034957 3300037471 Bacteria 4717
319 Ga0395905_0063392 3300037471 Bacteria 3458
320 Ga0395905_0169501 3300037471 Bacteria 2051
321 Ga0395905_0333083 3300037471 Bacteria 1408
322 Ga0395901_0049330 3300038443 Bacteria 4373
323 Ga0395901_0056863 3300038443 Bacteria 4069
324 Ga0395901_0173657 3300038443 Bacteria 2261
325 Ga0436365_1339243 3300039437 Bacteria 7314
326 Ga0436360_0429986 3300039438 Bacteria 25649
327 Ga0439462_0009691 3300042015 Bacteria 2435
328 Ga0450907_001568 3300042146 Bacteria 4859
329 Ga0466963_0281086 3300044694 Bacteria 1170
330 Ga0466964_0025756 3300044706 Bacteria 2299
331 Ga0466957_0003689 3300044842 Bacteria 8455
332 Ga0466959_0020678 3300045049 Bacteria 4850
333 Ga0466967_0031677 3300045976 Bacteria 4455
334 Ga0466967_0037140 3300045976 Bacteria 4165
335 Ga0466967_0224141 3300045976 Bacteria 1788
336 Ga0495603_0002507 3300046455 Bacteria 10800
337 Ga0495603_0124465 3300046455 Bacteria 1502
338 Ga0495629_0037686 3300046459 Bacteria 3407
339 Ga0495582_0100915 3300046473 Bacteria 1616
340 Ga0495605_0041052 3300046474 Bacteria 2306
341 Ga0495639_0071443 3300046475 Bacteria 1604
342 Ga0495630_0059609 3300046517 Bacteria 2864
343 Ga0495630_0070343 3300046517 Bacteria 2633
344 Ga0495630_0103246 3300046517 Bacteria 2157
345 Ga0495631_0070067 3300046518 Bacteria 1516
346 Ga0495663_0022533 3300046525 Bacteria 1820
347 Ga0495645_0065923 3300046543 Bacteria 2619
348 Ga0495667_0030214 3300046559 Bacteria 3643
349 Ga0495634_0041341 3300046642 Bacteria 3131
350 Ga0495588_0105017 3300046674 Bacteria 1486
351 Ga0495599_0069522 3300046678 Bacteria 2197
352 Ga0495646_0023236 3300046680 Bacteria 3904
353 Ga0495613_0023170 3300046689 Bacteria 4626
354 Ga0495600_0071106 3300046809 Bacteria 2274
355 Ga0495636_0040054 3300047318 Bacteria 1942
356 Ga0495636_0069977 3300047318 Bacteria 1496
357 Ga0495676_0051827 3300047321 Bacteria 3280
358 Ga0495680_0050871 3300047322 Bacteria 3238
359 Ga0495680_0150958 3300047322 Bacteria 1694
360 Ga0496100_0010952 3300048903 Bacteria 5145
361 Ga0496100_0023311 3300048903 Bacteria 3759
362 Ga0496100_0079476 3300048903 Bacteria 2210
363 Ga0496100_0209912 3300048903 Unclassified 1424
364 Ga0496100_0249415 3300048903 Bacteria 1313
365 Ga0496101_0001218 3300048904 Bacteria 15404
366 Ga0496101_0003277 3300048904 Bacteria 10065
367 Ga0496101_0026666 3300048904 Bacteria 4018
368 Ga0496101_0030393 3300048904 Bacteria 3787
369 Ga0496101_0039250 3300048904 Bacteria 3366
370 Ga0496101_0096459 3300048904 Bacteria 2207
371 Ga0496101_0167028 3300048904 Bacteria 1690
372 Ga0496102_0002587 3300048905 Bacteria 15431
373 Ga0496102_0081639 3300048905 Bacteria 2981
374 Ga0496102_0192252 3300048905 Bacteria 1923
375 Ga0496103_0070877 3300048906 Bacteria 2181
376 Ga0496103_0101042 3300048906 Bacteria 1825
377 Ga0496104_0000151 3300048907 Bacteria 64587
378 Ga0496104_0001596 3300048907 Bacteria 19511
379 Ga0496104_0015597 3300048907 Bacteria 6887
380 Ga0496104_0034174 3300048907 Bacteria 4739
381 Ga0496104_0078100 3300048907 Bacteria 3154
382 Ga0496104_0084577 3300048907 Bacteria 3028
383 Ga0496105_0000049 3300048908 Bacteria 94762
384 Ga0496105_0027849 3300048908 Bacteria 4620
385 Ga0496105_0115690 3300048908 Bacteria 2212
386 Ga0496106_0018253 3300048909 Bacteria 5187
387 Ga0496106_0024263 3300048909 Bacteria 4506
388 Ga0496106_0027219 3300048909 Bacteria 4258
389 Ga0496107_0055995 3300048910 Bacteria 2848
390 Ga0496108_0003788 3300048911 Bacteria 12107
391 Ga0496108_0009393 3300048911 Bacteria 7918
392 Ga0496108_0011851 3300048911 Bacteria 7094
393 Ga0496108_0015219 3300048911 Bacteria 6276
394 Ga0496108_0016513 3300048911 Bacteria 6025
395 Ga0496108_0063741 3300048911 Bacteria 3104
396 Ga0496108_0206131 3300048911 Bacteria 1706
397 Ga0496109_0000205 3300048912 Bacteria 58240
398 Ga0496109_0003147 3300048912 Bacteria 13767
399 Ga0496109_0004319 3300048912 Bacteria 11870
400 Ga0496109_0006019 3300048912 Bacteria 10189
401 Ga0496109_0006161 3300048912 Bacteria 10081
402 Ga0496109_0020182 3300048912 Bacteria 5887
403 Ga0496109_0034577 3300048912 Bacteria 4553
404 Ga0496109_0067019 3300048912 Bacteria 3288
405 Ga0496109_0105820 3300048912 Bacteria 2613
406 Ga0496109_0129343 3300048912 Bacteria 2356
407 Ga0496109_0220301 3300048912 Bacteria 1784
408 Ga0496109_0249357 3300048912 Bacteria 1672
409 Ga0496110_0000227 3300048913 Bacteria 36597
410 Ga0496110_0000363 3300048913 Bacteria 30372
411 Ga0496110_0003678 3300048913 Bacteria 11798
412 Ga0496110_0019451 3300048913 Bacteria 5715
413 Ga0496110_0066834 3300048913 Bacteria 3179
414 Ga0496110_0139099 3300048913 Bacteria 2195
415 Ga0496110_0145262 3300048913 Bacteria 2145
416 Ga0496110_0165387 3300048913 Bacteria 2006
417 Ga0496110_0168746 3300048913 Bacteria 1985
418 Ga0496111_0000514 3300048914 Bacteria 19995
419 Ga0496111_0002721 3300048914 Bacteria 10742
420 Ga0496111_0003418 3300048914 Bacteria 9823
421 Ga0496111_0012817 3300048914 Bacteria 5687
422 Ga0496111_0020527 3300048914 Bacteria 4600
423 Ga0496111_0081814 3300048914 Bacteria 2357
424 Ga0496111_0125362 3300048914 Bacteria 1898
425 Ga0496112_0005810 3300048915 Bacteria 10736
426 Ga0496112_0037326 3300048915 Bacteria 4743
427 Ga0496112_0044914 3300048915 Bacteria 4330
428 Ga0496112_0085997 3300048915 Bacteria 3111
429 Ga0496112_0114185 3300048915 Bacteria 2672
430 Ga0496112_0270973 3300048915 Bacteria 1646
431 Ga0496112_0319082 3300048915 Bacteria 1498
432 Ga0496113_0056377 3300048916 Bacteria 2950
433 Ga0496114_0000129 3300048917 Bacteria 54506
434 Ga0496114_0002907 3300048917 Bacteria 13126
435 Ga0496114_0014203 3300048917 Bacteria 6388
436 Ga0496114_0139836 3300048917 Bacteria 2095
437 Ga0496114_0221282 3300048917 Bacteria 1662
438 Ga0496114_0310375 3300048917 Bacteria 1393
439 Ga0496115_0008916 3300048918 Bacteria 7438
440 Ga0496115_0109846 3300048918 Bacteria 2265
441 Ga0501031_0025953 3300049568 Bacteria 3822
442 Ga0501031_0036091 3300049568 Bacteria 3224
443 Ga0501031_0050300 3300049568 Bacteria 2715
444 Ga0501031_0051142 3300049568 Bacteria 2691
445 Ga0501032_0011842 3300049569 Bacteria 6248
446 Ga0501032_0052793 3300049569 Bacteria 2739
447 Ga0501033_0008551 3300049570 Bacteria 7919
448 Ga0501033_0026554 3300049570 Bacteria 4358
449 Ga0501033_0111964 3300049570 Bacteria 1986
450 Ga0501034_0164074 3300049571 Bacteria 2191
451 Ga0501036_0019651 3300049572 Bacteria 5671
452 Ga0501036_0039539 3300049572 Bacteria 3991
453 Ga0501036_0251074 3300049572 Bacteria 1482
454 Ga0501036_0253516 3300049572 Unclassified 1474
455 Ga0501037_0004665 3300049573 Bacteria 9956
456 Ga0501037_0057804 3300049573 Bacteria 2831
457 Ga0501038_0010622 3300049574 Bacteria 8417
458 Ga0501038_0013815 3300049574 Bacteria 7358
459 Ga0501038_0033105 3300049574 Bacteria 4553
460 Ga0501039_0007438 3300049575 Bacteria 8359
461 Ga0501039_0018756 3300049575 Bacteria 5310
462 Ga0501039_0031389 3300049575 Bacteria 4095
463 Ga0501040_0014290 3300049576 Bacteria 5229
464 Ga0501040_0027975 3300049576 Bacteria 3798
465 Ga0501040_0040262 3300049576 Bacteria 3179
466 Ga0501040_0121393 3300049576 Bacteria 1833
467 Ga0501041_0013077 3300049577 Bacteria 4918
468 Ga0501042_0013484 3300049578 Bacteria 5564
469 Ga0501042_0043911 3300049578 Bacteria 3183
470 Ga0501042_0054379 3300049578 Bacteria 2855
471 Ga0501042_0143456 3300049578 Bacteria 1722
472 Ga0501043_0153646 3300049579 Bacteria 1800
473 Ga0501043_0155113 3300049579 Bacteria 1791
474 Ga0501046_0004220 3300049580 Bacteria 13077
475 Ga0501046_0073875 3300049580 Bacteria 2645
476 Ga0501046_0193598 3300049580 Bacteria 1516
477 Ga0501048_0016582 3300049582 Bacteria 5431
478 Ga0501048_0034626 3300049582 Bacteria 3641
479 Ga0501048_0097924 3300049582 Bacteria 2069
480 Ga0501048_0113477 3300049582 Bacteria 1914
481 Ga0501067_0002403 3300049583 Bacteria 10346
482 Ga0501067_0003124 3300049583 Bacteria 9146
483 Ga0501068_0009338 3300049584 Bacteria 5482
484 Ga0501068_0017040 3300049584 Bacteria 4198
485 Ga0501068_0039004 3300049584 Bacteria 2847
486 Ga0501068_0103943 3300049584 Bacteria 1762
487 Ga0501069_0013610 3300049585 Bacteria 4339
488 Ga0501070_0005044 3300049586 Bacteria 11262
489 Ga0501070_0016262 3300049586 Bacteria 6252
490 Ga0501070_0019135 3300049586 Bacteria 5743
491 Ga0501070_0193988 3300049586 Bacteria 1669
492 Ga0501070_0217406 3300049586 Bacteria 1568
493 Ga0501071_0008398 3300049587 Bacteria 6823
494 Ga0501071_0011283 3300049587 Bacteria 6013
495 Ga0501071_0155027 3300049587 Bacteria 1710
496 Ga0501072_0016655 3300049588 Bacteria 5646
497 Ga0501072_0086991 3300049588 Bacteria 2480
498 Ga0501072_0113089 3300049588 Bacteria 2161
499 Ga0501073_0018853 3300049589 Bacteria 4986
500 Ga0501074_0019003 3300049590 Bacteria 4991
501 Ga0501074_0030919 3300049590 Bacteria 3880
502 Ga0501074_0083551 3300049590 Bacteria 2289
503 Ga0501074_0096266 3300049590 Bacteria 2119
504 Ga0501074_0105262 3300049590 Bacteria 2020
505 Ga0501075_0008246 3300049591 Bacteria 7256
506 Ga0501075_0022784 3300049591 Bacteria 4579
507 Ga0501075_0029607 3300049591 Bacteria 4050
508 Ga0501075_0093397 3300049591 Bacteria 2284
509 Ga0501075_0102066 3300049591 Bacteria 2179
510 Ga0501075_0137496 3300049591 Bacteria 1861
511 Ga0501075_0222156 3300049591 Bacteria 1441
512 Ga0501076_0009797 3300049592 Bacteria 7077
513 Ga0501076_0017029 3300049592 Bacteria 5517
514 Ga0501076_0017781 3300049592 Bacteria 5405
515 Ga0501076_0032135 3300049592 Bacteria 4095
516 Ga0501076_0041612 3300049592 Bacteria 3615
517 Ga0501076_0042183 3300049592 Bacteria 3592
518 Ga0501076_0070290 3300049592 Bacteria 2799
519 Ga0501076_0340360 3300049592 Bacteria 1231
520 Ga0501077_0001461 3300049593 Bacteria 14225
521 Ga0501077_0015610 3300049593 Bacteria 4783
522 Ga0501077_0030938 3300049593 Bacteria 3405
523 Ga0501077_0045450 3300049593 Bacteria 2790
524 Ga0501077_0054861 3300049593 Bacteria 2530
525 Ga0501077_0069468 3300049593 Bacteria 2232
526 Ga0501077_0095408 3300049593 Bacteria 1885
527 Ga0501079_0009117 3300049741 Bacteria 7511
528 Ga0501079_0067529 3300049741 Bacteria 2759
529 Ga0501080_0003283 3300049742 Bacteria 14289
530 Ga0501081_0004599 3300049743 Bacteria 8856
531 Ga0501081_0004754 3300049743 Bacteria 8739
532 Ga0501081_0022798 3300049743 Bacteria 4191
533 Ga0501081_0148478 3300049743 Bacteria 1683
534 Ga0501083_0010483 3300049744 Bacteria 6523
535 Ga0501083_0017848 3300049744 Bacteria 4949
536 Ga0501083_0020554 3300049744 Bacteria 4592
537 Ga0501083_0151612 3300049744 Bacteria 1518
538 Ga0501083_0221208 3300049744 Unclassified 1233
539 Ga0501035_0005337 3300049822 Bacteria 12156
540 Ga0501035_0240905 3300049822 Unclassified 1538
541 Ga0501045_0003899 3300049824 Bacteria 10270
542 Ga0501045_0005962 3300049824 Bacteria 8431
543 Ga0501045_0069471 3300049824 Bacteria 2590
544 Ga0501045_0140247 3300049824 Bacteria 1797
545 Ga0501045_0205960 3300049824 Bacteria 1465
546 nmdc:mga05p37_14330_c1 3300050507 Bacteria 9519
547 nmdc:mga05p37_45574_c1 3300050507 Bacteria 5392
548 nmdc:mga09592_11215_c1 3300050508 Bacteria 7292
549 nmdc:mga0qj67_175554_c1 3300050509 Bacteria 1740
550 nmdc:mga06r32_195528_c1 3300050510 Bacteria 2010
551 nmdc:mga06r32_73735_c1 3300050510 Bacteria 3307
552 nmdc:mga08y16_240692_c1 3300050511 Bacteria 1871
553 nmdc:mga08y16_430565_c1 3300050511 Bacteria 1347
554 nmdc:mga08y16_46063_c1 3300050511 Bacteria 4567
555 nmdc:mga08y16_57724_c1 3300050511 Bacteria 4055
556 nmdc:mga08y16_59420_c1 3300050511 Bacteria 3993
557 nmdc:mga08y16_6816_c1 3300050511 Bacteria 11984
558 nmdc:mga0n895_232577_c1 3300050512 Bacteria 1871
559 nmdc:mga0rr50_131250_c1 3300050513 Bacteria 2006
560 nmdc:mga0a205_83160_c1 3300050515 Bacteria 3092
561 Ga0501084_0000894 3300054114 Bacteria 23050
562 Ga0501084_0011251 3300054114 Bacteria 7408
563 Ga0501084_0021022 3300054114 Bacteria 5444
564 Ga0501084_0114493 3300054114 Bacteria 2267
565 Ga0501084_0179265 3300054114 Bacteria 1788
566 Ga0501082_0002920 3300060353 Bacteria 14917
567 Ga0501082_0019233 3300060353 Bacteria 5887
568 Ga0501082_0022467 3300060353 Bacteria 5433
569 Ga0501082_0131071 3300060353 Bacteria 2175
570 Ga0501082_0148543 3300060353 Bacteria 2035
571 Ga0530510_0004714 3300061734 Bacteria 9434
572 Ga0530510_0007213 3300061734 Bacteria 7736
573 Ga0530510_0010114 3300061734 Bacteria 6613
574 Ga0530510_0026003 3300061734 Bacteria 4186
575 Ga0530510_0037347 3300061734 Bacteria 3502
576 Ga0530510_0075235 3300061734 Bacteria 2452
577 Ga0530510_0130167 3300061734 Bacteria 1851
578 Ga0530510_0303824 3300061734 Bacteria 1194
579 Ga0070714_100253214
580 JGI24738J21930_10002519
581 JGI25406J46586_10001030
582 Ga0070658_10006813
583 Ga0070676_10045014
584 Ga0070683_100211433
585 Ga0070670_100003940
586 Ga0070670_100012525
587 Ga0070666_10184052
588 Ga0070682_100021271
589 Ga0070682_100035078
590 Ga0070682_100172216
591 Ga0070660_100005447
592 Ga0070660_100091243
593 Ga0070660_100190986
594 Ga0070689_100026468
595 Ga0070691_10008208
596 Ga0070661_100011372
597 Ga0070661_100079208
598 Ga0070692_10093752
599 Ga0070668_100015420
600 Ga0070675_100024105
601 Ga0070674_100002472
602 Ga0070674_100010330
603 Ga0070674_100048278
604 Ga0070674_100107084
605 Ga0070674_100123399
606 Ga0070673_100001497
607 Ga0070673_100273119
608 Ga0070688_100002344
609 Ga0070659_100068853
610 Ga0070659_100111989
611 Ga0070667_100002802
612 Ga0070667_100210460
613 Ga0070703_10006766
614 Ga0070714_100011860
615 Ga0070714_100015242
616 Ga0070714_100102277
617 Ga0070714_100121003
618 Ga0070713_100059721
619 Ga0070710_10047012
620 Ga0070701_10005851
621 Ga0070701_10069236
622 Ga0070711_100033223
623 Ga0070705_100061414
624 Ga0070700_100031357
625 Ga0070700_100197538
626 Ga0070694_100076994
627 Ga0070678_100015109
628 Ga0070678_100017668
629 Ga0070678_100018200
630 Ga0070662_100017102
631 Ga0070681_10011153
632 Ga0068867_100085453
633 Ga0068867_100137612
634 Ga0068867_100180153
635 Ga0070685_10002424
636 Ga0070706_100021289
637 Ga0070706_100029075
638 Ga0070706_100194912
639 Ga0070707_100092416
640 Ga0070707_100191247
641 Ga0070698_100002289
642 Ga0070698_100020650
643 Ga0070698_100036620
644 Ga0070698_100108958
645 Ga0070699_100052017
646 Ga0070699_100069896
647 Ga0070699_100081094
648 Ga0070679_100003293
649 Ga0070679_100022999
650 Ga0070679_100067517
651 Ga0070679_100113136
652 Ga0070684_100018044
653 Ga0070684_100047272
654 Ga0068853_100009961
655 Ga0068853_100280882
656 Ga0070686_100110225
657 Ga0070695_100040387
658 Ga0070696_100035730
659 Ga0070693_100027761
660 Ga0070693_100053594
661 Ga0070704_100008702
662 Ga0070704_100134954
663 Ga0070664_100014252
664 Ga0070664_100052366
665 Ga0068857_100026574
666 Ga0068857_100080043
667 Ga0068856_100019762
668 Ga0068856_100022850
669 Ga0070702_100027284
670 Ga0070702_100064946
671 Ga0068852_100007859
672 Ga0068852_100028658
673 Ga0068859_100039017
674 Ga0068859_100274602
675 Ga0068864_100162584
676 Ga0068864_100212347
677 Ga0068861_100154603
678 Ga0068870_10010648
679 Ga0068870_10063398
680 Ga0068870_10099521
681 Ga0068863_100044143
682 Ga0068858_100024703
683 Ga0068858_100183178
684 Ga0068860_100024714
685 Ga0081455_10009289
686 Ga0081455_10019628
687 Ga0081455_10034188
688 Ga0081455_10035432
689 Ga0081455_10071332
690 Ga0081539_10000216
691 Ga0070717_10018957
692 Ga0070717_10046764
693 Ga0075432_10001526
694 Ga0075432_10053092
695 Ga0070716_100016688
696 Ga0070712_100099443
697 Ga0097621_100063032
698 Ga0068871_100147753
699 Ga0075428_100008186
700 Ga0075428_100435519
701 Ga0075430_100010663
702 Ga0075431_100037810
703 Ga0075433_10116142
704 Ga0075434_100058689
705 Ga0075429_100187406
706 Ga0068865_100003053
707 Ga0068865_100045919
708 Ga0097620_100039017
709 Ga0097620_100274618
710 Ga0075435_100106250
711 Ga0111539_10005600
712 Ga0111539_10063259
713 Ga0111539_10064054
714 Ga0111539_10074740
715 Ga0105245_10009018
716 Ga0105245_10112968
717 Ga0105245_10343439
718 Ga0105245_10364944
719 Ga0114129_10002317
720 Ga0114129_10190717
721 Ga0114129_10453789
722 Ga0105243_10007847
723 Ga0105243_10014078
724 Ga0105243_10108401
725 Ga0105243_10137731
726 Ga0105243_10202339
727 Ga0105241_10197367
728 Ga0105242_10093583
729 Ga0105248_10018496
730 Ga0105248_10133286
731 Ga0105238_10039167
732 Ga0105249_10173138
733 Ga0105249_10288343
734 Ga0105239_10026053
735 Ga0105239_10153508
736 Ga0105239_10333608
737 Ga0105246_10071889
738 Ga0157371_10008817
739 Ga0157370_10212217
740 Ga0157369_10005947
741 Ga0157374_10065986
742 Ga0157378_10152787
743 Ga0163162_10169167
744 Ga0163162_10605650
745 Ga0157372_10027412
746 Ga0157375_10097969
747 Ga0157375_10142742
748 Ga0157375_10157757
749 Ga0157375_10320571
750 Ga0163163_10057351
751 Ga0163163_10082744
752 Ga0163163_10186430
753 Ga0157380_10020727
754 Ga0157380_10039984
755 Ga0157380_10069743
756 Ga0157377_10012852
757 Ga0157379_10019699
758 Ga0157379_10046824
759 Ga0157379_10214694
760 Ga0157376_10177910
761 Ga0157376_10226247
762 Ga0157376_10393508
763 Ga0206353_10740778
764 Ga0213871_10001245
765 Ga0224712_10021077
766 Ga0207656_10082693
767 Ga0207653_10007683
768 Ga0207642_10017070
769 Ga0207642_10056991
770 Ga0207688_10022838
771 Ga0207647_10070752
772 Ga0207699_10159610
773 Ga0207645_10042305
774 Ga0207645_10069487
775 Ga0207643_10001366
776 Ga0207643_10107084
777 Ga0207705_10161066
778 Ga0207684_10056415
779 Ga0207707_10009939
780 Ga0207693_10001920
781 Ga0207693_10126236
782 Ga0207693_10215423
783 Ga0207657_10007917
784 Ga0207657_10027418
785 Ga0207657_10079537
786 Ga0207657_10134519
787 Ga0207657_10150510
788 Ga0207649_10048446
789 Ga0207652_10002716
790 Ga0207652_10052728
791 Ga0207652_10134175
792 Ga0207652_10264295
793 Ga0207650_10013901
794 Ga0207650_10024739
795 Ga0207659_10017888
796 Ga0207659_10053729
797 Ga0207687_10014490
798 Ga0207687_10019300
799 Ga0207687_10020223
800 Ga0207687_10042693
801 Ga0207687_10048161
802 Ga0207687_10052839
803 Ga0207687_10119855
804 Ga0207687_10134433
805 Ga0207687_10204658
806 Ga0207700_10043334
807 Ga0207664_10104870
808 Ga0207644_10081627
809 Ga0207690_10060285
810 Ga0207706_10021078
811 Ga0207706_10089695
812 Ga0207706_10262789
813 Ga0207686_10004271
814 Ga0207686_10085157
815 Ga0207709_10006169
816 Ga0207709_10063848
817 Ga0207670_10052589
818 Ga0207669_10026751
819 Ga0207669_10144950
820 Ga0207704_10015730
821 Ga0207704_10037474
822 Ga0207704_10113699
823 Ga0207665_10011309
824 Ga0207691_10021858
825 Ga0207691_10028733
826 Ga0207691_10035027
827 Ga0207711_10197971
828 Ga0207689_10153648
829 Ga0207689_10179028
830 Ga0207661_10012443
831 Ga0207661_10068899
832 Ga0207661_10265056
833 Ga0207679_10157833
834 Ga0207679_10254174
835 Ga0207668_10267866
836 Ga0207640_10074408
837 Ga0207640_10166145
838 Ga0207677_10011319
839 Ga0207639_10057106
840 Ga0207678_10024010
841 Ga0207708_10011773
842 Ga0207708_10016363
843 Ga0207708_10142580
844 Ga0207708_10201342
845 Ga0207708_10272964
846 Ga0207702_10003255
847 Ga0207702_10014040
848 Ga0207702_10172278
849 Ga0207648_10024975
850 Ga0207648_10076117
851 Ga0207648_10124696
852 Ga0207648_10240489
853 Ga0207674_10014525
854 Ga0207674_10018936
855 Ga0207675_100035383
856 Ga0207675_100035433
857 Ga0207683_10008250
858 Ga0207683_10020687
859 Ga0207683_10112498
860 Ga0207698_10007276
861 Ga0207698_10040198
862 Ga0207428_10000277
863 Ga0207428_10013248
864 Ga0207428_10106074
865 Ga0207428_10127412
866 Ga0268266_10115026
867 Ga0268264_10147314
868 Ga0265319_1016255
869 Ga0265334_10012186
870 Ga0265318_10003613
871 Ga0265322_10020385
872 Ga0265320_10025032
873 Ga0265320_10033007
874 Ga0265325_10046973
875 Ga0265340_10024401
876 Ga0265327_10046387
877 Ga0265316_10008980
878 Ga0373948_0001553
879 Ga0373960_0012571
880 Ga0373931_0025122
881 Ga0373947_0022800
882 Ga0373925_0011766
883 Ga0395899_0004083
884 Ga0395899_0014905
885 Ga0395899_0062184
886 Ga0395899_0099282
887 Ga0395900_0006024
888 Ga0395900_0015244
889 Ga0395900_0141402
890 Ga0395900_0216680
891 Ga0395898_0051149
892 Ga0395898_0117922
893 Ga0395898_0168535
894 Ga0395905_0006295
895 Ga0395905_0032760
896 Ga0395905_0034957
897 Ga0395905_0063392
898 Ga0395905_0169501
899 Ga0395905_0333083
900 Ga0395901_0049330
901 Ga0395901_0056863
902 Ga0395901_0173657
903 Ga0436365_1339243
904 Ga0436360_0429986
905 Ga0439462_0009691
906 Ga0450907_001568
907 Ga0466963_0281086
908 Ga0466964_0025756
909 Ga0466957_0003689
910 Ga0466959_0020678
911 Ga0466967_0031677
912 Ga0466967_0037140
913 Ga0466967_0224141
914 Ga0495603_0002507
915 Ga0495603_0124465
916 Ga0495629_0037686
917 Ga0495582_0100915
918 Ga0495605_0041052
919 Ga0495639_0071443
920 Ga0495630_0059609
921 Ga0495630_0070343
922 Ga0495630_0103246
923 Ga0495631_0070067
924 Ga0495663_0022533
925 Ga0495645_0065923
926 Ga0495667_0030214
927 Ga0495634_0041341
928 Ga0495588_0105017
929 Ga0495599_0069522
930 Ga0495646_0023236
931 Ga0495613_0023170
932 Ga0495600_0071106
933 Ga0495636_0040054
934 Ga0495636_0069977
935 Ga0495676_0051827
936 Ga0495680_0050871
937 Ga0495680_0150958
938 Ga0496100_0010952
939 Ga0496100_0023311
940 Ga0496100_0079476
941 Ga0496100_0209912
942 Ga0496100_0249415
943 Ga0496101_0001218
944 Ga0496101_0003277
945 Ga0496101_0026666
946 Ga0496101_0030393
947 Ga0496101_0039250
948 Ga0496101_0096459
949 Ga0496101_0167028
950 Ga0496102_0002587
951 Ga0496102_0081639
952 Ga0496102_0192252
953 Ga0496103_0070877
954 Ga0496103_0101042
955 Ga0496104_0000151
956 Ga0496104_0001596
957 Ga0496104_0015597
958 Ga0496104_0034174
959 Ga0496104_0078100
960 Ga0496104_0084577
961 Ga0496105_0000049
962 Ga0496105_0027849
963 Ga0496105_0115690
964 Ga0496106_0018253
965 Ga0496106_0024263
966 Ga0496106_0027219
967 Ga0496107_0055995
968 Ga0496108_0003788
969 Ga0496108_0009393
970 Ga0496108_0011851
971 Ga0496108_0015219
972 Ga0496108_0016513
973 Ga0496108_0063741
974 Ga0496108_0206131
975 Ga0496109_0000205
976 Ga0496109_0003147
977 Ga0496109_0004319
978 Ga0496109_0006019
979 Ga0496109_0006161
980 Ga0496109_0020182
981 Ga0496109_0034577
982 Ga0496109_0067019
983 Ga0496109_0105820
984 Ga0496109_0129343
985 Ga0496109_0220301
986 Ga0496109_0249357
987 Ga0496110_0000227
988 Ga0496110_0000363
989 Ga0496110_0003678
990 Ga0496110_0019451
991 Ga0496110_0066834
992 Ga0496110_0139099
993 Ga0496110_0145262
994 Ga0496110_0165387
995 Ga0496110_0168746
996 Ga0496111_0000514
997 Ga0496111_0002721
998 Ga0496111_0003418
999 Ga0496111_0012817
1000 Ga0496111_0020527
1001 Ga0496111_0081814
1002 Ga0496111_0125362
1003 Ga0496112_0005810
1004 Ga0496112_0037326
1005 Ga0496112_0044914
1006 Ga0496112_0085997
1007 Ga0496112_0114185
1008 Ga0496112_0270973
1009 Ga0496112_0319082
1010 Ga0496113_0056377
1011 Ga0496114_0000129
1012 Ga0496114_0002907
1013 Ga0496114_0014203
1014 Ga0496114_0139836
1015 Ga0496114_0221282
1016 Ga0496114_0310375
1017 Ga0496115_0008916
1018 Ga0496115_0109846
1019 Ga0501031_0025953
1020 Ga0501031_0036091
1021 Ga0501031_0050300
1022 Ga0501031_0051142
1023 Ga0501032_0011842
1024 Ga0501032_0052793
1025 Ga0501033_0008551
1026 Ga0501033_0026554
1027 Ga0501033_0111964
1028 Ga0501034_0164074
1029 Ga0501036_0019651
1030 Ga0501036_0039539
1031 Ga0501036_0251074
1032 Ga0501036_0253516
1033 Ga0501037_0004665
1034 Ga0501037_0057804
1035 Ga0501038_0010622
1036 Ga0501038_0013815
1037 Ga0501038_0033105
1038 Ga0501039_0007438
1039 Ga0501039_0018756
1040 Ga0501039_0031389
1041 Ga0501040_0014290
1042 Ga0501040_0027975
1043 Ga0501040_0040262
1044 Ga0501040_0121393
1045 Ga0501041_0013077
1046 Ga0501042_0013484
1047 Ga0501042_0043911
1048 Ga0501042_0054379
1049 Ga0501042_0143456
1050 Ga0501043_0153646
1051 Ga0501043_0155113
1052 Ga0501046_0004220
1053 Ga0501046_0073875
1054 Ga0501046_0193598
1055 Ga0501048_0016582
1056 Ga0501048_0034626
1057 Ga0501048_0097924
1058 Ga0501048_0113477
1059 Ga0501067_0002403
1060 Ga0501067_0003124
1061 Ga0501068_0009338
1062 Ga0501068_0017040
1063 Ga0501068_0039004
1064 Ga0501068_0103943
1065 Ga0501069_0013610
1066 Ga0501070_0005044
1067 Ga0501070_0016262
1068 Ga0501070_0019135
1069 Ga0501070_0193988
1070 Ga0501070_0217406
1071 Ga0501071_0008398
1072 Ga0501071_0011283
1073 Ga0501071_0155027
1074 Ga0501072_0016655
1075 Ga0501072_0086991
1076 Ga0501072_0113089
1077 Ga0501073_0018853
1078 Ga0501074_0019003
1079 Ga0501074_0030919
1080 Ga0501074_0083551
1081 Ga0501074_0096266
1082 Ga0501074_0105262
1083 Ga0501075_0008246
1084 Ga0501075_0022784
1085 Ga0501075_0029607
1086 Ga0501075_0093397
1087 Ga0501075_0102066
1088 Ga0501075_0137496
1089 Ga0501075_0222156
1090 Ga0501076_0009797
1091 Ga0501076_0017029
1092 Ga0501076_0017781
1093 Ga0501076_0032135
1094 Ga0501076_0041612
1095 Ga0501076_0042183
1096 Ga0501076_0070290
1097 Ga0501076_0340360
1098 Ga0501077_0001461
1099 Ga0501077_0015610
1100 Ga0501077_0030938
1101 Ga0501077_0045450
1102 Ga0501077_0054861
1103 Ga0501077_0069468
1104 Ga0501077_0095408
1105 Ga0501079_0009117
1106 Ga0501079_0067529
1107 Ga0501080_0003283
1108 Ga0501081_0004599
1109 Ga0501081_0004754
1110 Ga0501081_0022798
1111 Ga0501081_0148478
1112 Ga0501083_0010483
1113 Ga0501083_0017848
1114 Ga0501083_0020554
1115 Ga0501083_0151612
1116 Ga0501083_0221208
1117 Ga0501035_0005337
1118 Ga0501035_0240905
1119 Ga0501045_0003899
1120 Ga0501045_0005962
1121 Ga0501045_0069471
1122 Ga0501045_0140247
1123 Ga0501045_0205960
1124 nmdc:mga05p37_14330_c1
1125 nmdc:mga05p37_45574_c1
1126 nmdc:mga09592_11215_c1
1127 nmdc:mga0qj67_175554_c1
1128 nmdc:mga06r32_195528_c1
1129 nmdc:mga06r32_73735_c1
1130 nmdc:mga08y16_240692_c1
1131 nmdc:mga08y16_430565_c1
1132 nmdc:mga08y16_46063_c1
1133 nmdc:mga08y16_57724_c1
1134 nmdc:mga08y16_59420_c1
1135 nmdc:mga08y16_6816_c1
1136 nmdc:mga0n895_232577_c1
1137 nmdc:mga0rr50_131250_c1
1138 nmdc:mga0a205_83160_c1
1139 Ga0501084_0000894
1140 Ga0501084_0011251
1141 Ga0501084_0021022
1142 Ga0501084_0114493
1143 Ga0501084_0179265
1144 Ga0501082_0002920
1145 Ga0501082_0019233
1146 Ga0501082_0022467
1147 Ga0501082_0131071
1148 Ga0501082_0148543
1149 Ga0530510_0004714
1150 Ga0530510_0007213
1151 Ga0530510_0010114
1152 Ga0530510_0026003
1153 Ga0530510_0037347
1154 Ga0530510_0075235
1155 Ga0530510_0130167
1156 Ga0530510_0303824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05762

VWA_CoxE

VWA domain containing CoxE-like protein

160

380

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mq8-assembly2.cif.gz_D crystal structure of alphal i domain in complex with icam-1 0.6796 194 299
6rhv-assembly1.cif.gz_C crystal structure of mouse cd11b i-domain (cd11b-i) in complex with staphylococcus aureus octameric bi-component leukocidin lukgh (lukh k319a mutant) 0.6792 193 344
8e56-assembly1.cif.gz_F rabbit l-type voltage-gated calcium channel cav1.1 in the presence of amiodarone at 2.8 angstrom resolution 0.6771 192 363
2b2x-assembly1.cif.gz_A vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab 0.6731 194 364
1m10-assembly1.cif.gz_A crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain 0.6633 194 367
ID Description Score Start End Superfamily
af_O53703_171_392_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8078 142 352 3.40.50.410
af_O53703_171_392_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7665 142 352 3.40.50.410
af_P33352_208_374_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7596 193 361 3.40.50.410
af_P33352_208_374_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7237 193 361 3.40.50.410
af_P34393_274_476_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6889 194 363 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A0K2RI11-F1-model_v4 VWA containing CoxE family protein 0.9655 196 362
AF-A0A6L9QDK0-F1-model_v4 VWA domain-containing protein 0.9592 202 363
AF-A0A7K2M9B4-F1-model_v4 VWA domain-containing protein 0.9505 205 362
AF-A0A6I5CAQ2-F1-model_v4 VWA domain-containing protein 0.948 212 362
AF-A0A3C1P487-F1-model_v4 VWA containing CoxE family protein 0.9471 227 366

Map