F465672

General Info

Members Datasets Scaffolds Average Seq Length
577 314 1154 102

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0003403|Ga0501044_0003403_3557_3892
Length 111
Sequence VLPPELPPLPALTRAEGELIDRYLEAVDLLGRINPAHHGDTYRGLRAAQALVRKAAELRDALALMHRRGEAELHGDTLARALRVLDGERRAARVALPPDDADRPGRPSGAA

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
59 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
60 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
61 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
62 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
63 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
64 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
67 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
70 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
71 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
74 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
75 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
76 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
77 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
78 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
79 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
80 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
81 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
217 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
218 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
229 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
230 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
231 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
232 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
233 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
234 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
235 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
241 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
242 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
243 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
246 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
249 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
252 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
253 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
254 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
255 2643221647 Streptomyces sp. Root369 Isolate Unclassified
256 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
257 2643221714 Streptomyces sp. Root264 Isolate Unclassified
258 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
259 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
260 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
261 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
262 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
263 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
264 2808606448 Streptomyces sp. 193411 Isolate Unclassified
265 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
266 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
267 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
268 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
269 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
270 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
271 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
272 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
273 2862574272 Streptomyces sp. AcE210 Isolate Nodule
274 2867369537 Streptomyces sp. Z26 Isolate Unclassified
275 2867428634 Streptomyces sp. RP5T Isolate Unclassified
276 2867475112 Streptomyces sp. TM32 Isolate Unclassified
277 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
278 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
279 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
280 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
281 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
282 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
283 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
284 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
285 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
286 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
287 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
288 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
289 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
290 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
291 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
292 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
293 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
294 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
295 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
296 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
297 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
298 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
299 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
300 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
301 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
302 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
303 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
304 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
305 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
306 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
307 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
308 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
309 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
310 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
311 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
312 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
313 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
314 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.56
Metatranscriptomes 0.35
Isolates 11.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.92
Nodule 0.69
Rhizoplane 1.04
Rhizosphere 72.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0003403 3300049823 Bacteria 17916
2 JGI24739J22299_10071069 3300001989 Bacteria 1083
3 JGI24737J22298_10034647 3300001990 Bacteria 1565
4 JGI24735J21928_10126731 3300002067 Bacteria 736
5 JGI24738J21930_10046980 3300002075 Bacteria 878
6 rootH1_10000283 3300003316 Bacteria 12547
7 rootH1_10090014 3300003316 Bacteria 2125
8 rootH2_10030795 3300003320 Bacteria 4076
9 rootL2_10042621 3300003322 Bacteria 2283
10 rootH1_10011606 3300003323 Bacteria 1145
11 JGI25160J50197_1024122 3300003354 Bacteria 1734
12 JGI25160J50197_1024767 3300003354 Bacteria 1695
13 JGI25160J50197_1040286 3300003354 Bacteria 1084
14 Ga0006562J51391_1050508 3300003578 Bacteria 529
15 Ga0006562J51391_1109584 3300003578 Bacteria 505
16 Ga0070708_102116104 3300005445 Bacteria 520
17 Ga0068853_100256675 3300005539 Bacteria 1606
18 Ga0068853_101017554 3300005539 Bacteria 798
19 Ga0068857_101204493 3300005577 Bacteria 733
20 Ga0081455_10535766 3300005937 Bacteria 778
21 Ga0075365_10093490 3300006038 Bacteria 2051
22 Ga0075363_100001559 3300006048 Bacteria 8797
23 Ga0075363_100099724 3300006048 Bacteria 1606
24 Ga0070715_10060909 3300006163 Bacteria 1656
25 Ga0075367_10003073 3300006178 Bacteria 7830
26 Ga0075369_10346049 3300006186 Bacteria 697
27 Ga0075370_10027466 3300006353 Bacteria 3158
28 Ga0075370_10332033 3300006353 Bacteria 907
29 Ga0099826_10048191 3300006948 Bacteria 2885
30 Ga0105251_10079994 3300009011 Bacteria 1512
31 Ga0105250_10194989 3300009092 Bacteria 853
32 Ga0105245_10204002 3300009098 Bacteria 1900
33 Ga0105243_10129613 3300009148 Bacteria 2138
34 Ga0105148_122158 3300009978 Bacteria 512
35 Ga0157372_10069529 3300013307 Bacteria 3960
36 Ga0157375_10152878 3300013308 Bacteria 2444
37 Ga0157375_12339823 3300013308 Bacteria 637
38 Ga0182008_10018417 3300014497 Bacteria 3616
39 Ga0182006_1034031 3300015261 Bacteria 2041
40 Ga0182007_10000170 3300015262 Bacteria 44373
41 Ga0183367_1003 3300015688 Bacteria 814276
42 Ga0209758_1013977 3300025297 Bacteria 4318
43 Ga0207426_1002017 3300025302 Bacteria 14333
44 Ga0207426_1008095 3300025302 Bacteria 4306
45 Ga0207426_1009010 3300025302 Bacteria 3975
46 Ga0207426_1056020 3300025302 Bacteria 1152
47 Ga0207696_1081037 3300025711 Bacteria 896
48 Ga0207713_1236277 3300025735 Bacteria 544
49 Ga0207647_10425560 3300025904 Bacteria 746
50 Ga0207687_11213445 3300025927 Bacteria 648
51 Ga0207687_11568460 3300025927 Bacteria 565
52 Ga0207709_10060617 3300025935 Bacteria 2360
53 Ga0207639_10178678 3300026041 Bacteria 1804
54 Ga0307517_10004498 3300028786 Bacteria 21398
55 Ga0307517_10017502 3300028786 Bacteria 9343
56 Ga0307515_10066693 3300028794 Bacteria 4980
57 Ga0307515_10085202 3300028794 Bacteria 4047
58 Ga0307515_10295096 3300028794 Bacteria 1312
59 Ga0307515_10508502 3300028794 Bacteria 815
60 Ga0307511_10000652 3300030521 Bacteria 37046
61 Ga0307511_10082062 3300030521 Bacteria 2257
62 Ga0307511_10132933 3300030521 Bacteria 1492
63 Ga0307511_10182164 3300030521 Bacteria 1129
64 Ga0307511_10288860 3300030521 Bacteria 751
65 Ga0307512_10001761 3300030522 Bacteria 29532
66 Ga0307512_10346872 3300030522 Bacteria 657
67 Ga0307513_10276473 3300031456 Bacteria 1459
68 Ga0307513_10426797 3300031456 Bacteria 1054
69 Ga0307509_10028458 3300031507 Bacteria 6212
70 Ga0307509_10134367 3300031507 Bacteria 2422
71 Ga0307509_10186564 3300031507 Bacteria 1931
72 Ga0307508_10033500 3300031616 Bacteria 4637
73 Ga0307508_10065485 3300031616 Bacteria 3201
74 Ga0307508_10084659 3300031616 Bacteria 2753
75 Ga0307508_10354011 3300031616 Bacteria 1059
76 Ga0307508_10444272 3300031616 Bacteria 889
77 Ga0307508_10462771 3300031616 Bacteria 861
78 Ga0307514_10011710 3300031649 Bacteria 7297
79 Ga0307514_10268269 3300031649 Bacteria 991
80 Ga0307514_10332952 3300031649 Bacteria 823
81 Ga0307514_10340503 3300031649 Bacteria 807
82 Ga0307516_10004873 3300031730 Bacteria 16350
83 Ga0307516_10060832 3300031730 Bacteria 3668
84 Ga0307516_10120036 3300031730 Bacteria 2421
85 Ga0307516_10137884 3300031730 Bacteria 2212
86 Ga0307516_10745751 3300031730 Bacteria 638
87 Ga0307518_10097796 3300031838 Bacteria 2104
88 Ga0307518_10123873 3300031838 Bacteria 1825
89 Ga0307518_10339712 3300031838 Bacteria 882
90 Ga0307518_10350623 3300031838 Bacteria 859
91 Ga0307507_10100562 3300033179 Bacteria 2422
92 Ga0307507_10112063 3300033179 Bacteria 2224
93 Ga0307507_10383062 3300033179 Bacteria 809
94 Ga0307510_10142466 3300033180 Bacteria 2037
95 Ga0307510_10215372 3300033180 Bacteria 1438
96 Ga0307510_10313116 3300033180 Bacteria 1028
97 Ga0307510_10435736 3300033180 Bacteria 752
98 Ga0307510_10494795 3300033180 Bacteria 665
99 Ga0395900_0387515 3300037418 Bacteria 1364
100 Ga0395900_0892916 3300037418 Bacteria 812
101 Ga0395898_0015611 3300037466 Bacteria 7785
102 Ga0395898_0024116 3300037466 Bacteria 6139
103 Ga0395898_0129746 3300037466 Bacteria 2415
104 Ga0395898_1356966 3300037466 Bacteria 639
105 Ga0395905_0599981 3300037471 Bacteria 1003
106 Ga0395901_0937640 3300038443 Bacteria 845
107 Ga0439436_0012642 3300041404 Bacteria 2562
108 Ga0439436_0128311 3300041404 Bacteria 710
109 Ga0439439_0002771 3300041406 Bacteria 3777
110 Ga0439439_0098599 3300041406 Bacteria 803
111 Ga0439439_0105392 3300041406 Bacteria 778
112 Ga0439466_0169000 3300041411 Bacteria 668
113 Ga0451791_1171975 3300041451 Bacteria 561
114 Ga0451807_2283274 3300041486 Bacteria 2163
115 Ga0451833_0143112 3300041491 Bacteria 901
116 Ga0451833_1084891 3300041491 Bacteria 783
117 Ga0451835_0875240 3300041492 Bacteria 593
118 Ga0451837_0005122 3300041494 Bacteria 3299
119 Ga0451845_0398276 3300041501 Bacteria 1609
120 Ga0451843_0695223 3300041509 Bacteria 584
121 Ga0451853_0408476 3300041512 Bacteria 7606
122 Ga0451853_0855223 3300041512 Bacteria 2568
123 Ga0451853_0903718 3300041512 Bacteria 4252
124 Ga0451853_2768007 3300041512 Bacteria 1191
125 Ga0439433_0001395 3300041999 Bacteria 4964
126 Ga0439433_0026489 3300041999 Bacteria 1312
127 Ga0439442_020500 3300042002 Bacteria 1370
128 Ga0439448_0014186 3300042005 Bacteria 2402
129 Ga0439449_0000590 3300042007 Bacteria 13610
130 Ga0439449_0017520 3300042007 Bacteria 2691
131 Ga0439449_0100629 3300042007 Bacteria 1068
132 Ga0439457_001444 3300042014 Bacteria 7149
133 Ga0439457_019320 3300042014 Bacteria 1513
134 Ga0450920_053080 3300042122 Bacteria 814
135 Ga0450890_019966 3300042127 Bacteria 905
136 Ga0450894_000888 3300042131 Bacteria 4767
137 Ga0450896_003841 3300042133 Bacteria 2017
138 Ga0450898_069062 3300042134 Bacteria 705
139 Ga0450899_000945 3300042135 Bacteria 3306
140 Ga0450902_046154 3300042137 Bacteria 745
141 Ga0450903_000095 3300042138 Bacteria 18505
142 Ga0450906_005259 3300042145 Bacteria 2674
143 Ga0439458_0000663 3300042157 Bacteria 8854
144 Ga0439458_0016648 3300042157 Bacteria 1673
145 Ga0450908_009803 3300042184 Bacteria 1774
146 Ga0450901_026926 3300042533 Bacteria 628
147 Ga0466969_0036381 3300044656 Bacteria 2487
148 Ga0466972_0009915 3300044658 Bacteria 4781
149 Ga0466972_0018530 3300044658 Bacteria 3481
150 Ga0466972_0142036 3300044658 Bacteria 1130
151 Ga0466972_0152564 3300044658 Bacteria 1086
152 Ga0466972_0281374 3300044658 Bacteria 777
153 Ga0466965_0003378 3300044683 Bacteria 6990
154 Ga0466965_0039334 3300044683 Bacteria 2325
155 Ga0466965_0057486 3300044683 Bacteria 1939
156 Ga0466965_0725442 3300044683 Bacteria 571
157 Ga0466966_0007528 3300044684 Bacteria 7213
158 Ga0466966_0019431 3300044684 Bacteria 4469
159 Ga0466966_0179140 3300044684 Bacteria 1286
160 Ga0466961_0001971 3300044693 Bacteria 12768
161 Ga0466961_0030504 3300044693 Bacteria 3465
162 Ga0466961_0177693 3300044693 Bacteria 1322
163 Ga0466963_0003723 3300044694 Bacteria 8772
164 Ga0466963_0440623 3300044694 Bacteria 919
165 Ga0466964_0009585 3300044706 Bacteria 3649
166 Ga0466971_0003547 3300044719 Bacteria 6668
167 Ga0466971_0126560 3300044719 Bacteria 1184
168 Ga0466971_0365797 3300044719 Bacteria 699
169 Ga0466971_0497652 3300044719 Bacteria 601
170 Ga0466968_0304219 3300044735 Bacteria 767
171 Ga0466970_0002926 3300044765 Bacteria 8272
172 Ga0466970_0010567 3300044765 Bacteria 4688
173 Ga0466970_0344189 3300044765 Bacteria 845
174 Ga0466957_0000722 3300044842 Bacteria 16962
175 Ga0466960_0093529 3300044901 Bacteria 1536
176 Ga0466960_0103032 3300044901 Bacteria 1473
177 Ga0466960_0378539 3300044901 Bacteria 812
178 Ga0466959_0479037 3300045049 Bacteria 842
179 Ga0466958_0003160 3300045836 Bacteria 8477
180 Ga0466958_0237264 3300045836 Bacteria 1165
181 Ga0466967_0017610 3300045976 Bacteria 5680
182 Ga0466967_0098517 3300045976 Bacteria 2669
183 Ga0466967_0586840 3300045976 Bacteria 1099
184 Ga0495617_064395 3300046452 Bacteria 1209
185 Ga0495627_066827 3300046453 Bacteria 1055
186 Ga0495627_092756 3300046453 Bacteria 867
187 Ga0495592_0008348 3300046454 Bacteria 7767
188 Ga0495592_0566636 3300046454 Bacteria 696
189 Ga0495603_0004210 3300046455 Bacteria 8568
190 Ga0495603_0037191 3300046455 Bacteria 2920
191 Ga0495603_0099508 3300046455 Bacteria 1698
192 Ga0495603_0182070 3300046455 Bacteria 1215
193 Ga0495603_0227903 3300046455 Bacteria 1074
194 Ga0495603_0404660 3300046455 Bacteria 782
195 Ga0495603_0420699 3300046455 Bacteria 765
196 Ga0495590_0089800 3300046457 Bacteria 1086
197 Ga0495629_0005761 3300046459 Bacteria 9249
198 Ga0495629_0010541 3300046459 Bacteria 6725
199 Ga0495629_0034967 3300046459 Bacteria 3552
200 Ga0495629_0071262 3300046459 Bacteria 2425
201 Ga0495629_0148538 3300046459 Bacteria 1629
202 Ga0495629_0155828 3300046459 Bacteria 1587
203 Ga0495629_0619769 3300046459 Bacteria 722
204 Ga0495629_0751906 3300046459 Bacteria 645
205 Ga0495638_0079205 3300046460 Bacteria 1998
206 Ga0495638_0179444 3300046460 Bacteria 1209
207 Ga0495638_0235547 3300046460 Bacteria 1016
208 Ga0495638_0360111 3300046460 Bacteria 765
209 Ga0495641_0262774 3300046461 Bacteria 777
210 Ga0495651_0001712 3300046462 Bacteria 16952
211 Ga0495651_0243761 3300046462 Bacteria 1231
212 Ga0495653_0277975 3300046463 Bacteria 1100
213 Ga0495653_0465301 3300046463 Bacteria 793
214 Ga0495580_0752919 3300046472 Bacteria 634
215 Ga0495580_0755039 3300046472 Bacteria 633
216 Ga0495582_0129321 3300046473 Bacteria 1426
217 Ga0495582_0236579 3300046473 Bacteria 1046
218 Ga0495582_0811344 3300046473 Bacteria 541
219 Ga0495582_0885211 3300046473 Bacteria 516
220 Ga0495605_0001821 3300046474 Bacteria 13622
221 Ga0495639_0050532 3300046475 Bacteria 1889
222 Ga0495662_0003036 3300046476 Bacteria 8467
223 Ga0495662_0005845 3300046476 Bacteria 6153
224 Ga0495662_0067735 3300046476 Bacteria 1727
225 Ga0495664_0000486 3300046477 Bacteria 19785
226 Ga0495664_0053891 3300046477 Bacteria 2391
227 Ga0495585_0084423 3300046492 Bacteria 1717
228 Ga0495585_0195960 3300046492 Bacteria 1031
229 Ga0495594_0031173 3300046499 Bacteria 2890
230 Ga0495594_0032103 3300046499 Bacteria 2849
231 Ga0495594_0055995 3300046499 Bacteria 2175
232 Ga0495594_0064241 3300046499 Bacteria 2034
233 Ga0495594_0135947 3300046499 Bacteria 1393
234 Ga0495596_0046922 3300046500 Bacteria 1696
235 Ga0495607_0023971 3300046501 Bacteria 3811
236 Ga0495583_0015895 3300046506 Bacteria 4071
237 Ga0495583_0030782 3300046506 Bacteria 2609
238 Ga0495583_0106538 3300046506 Bacteria 1191
239 Ga0495606_0035088 3300046507 Bacteria 3433
240 Ga0495610_0041053 3300046512 Bacteria 2326
241 Ga0495610_0340591 3300046512 Bacteria 567
242 Ga0495616_0055294 3300046513 Bacteria 1965
243 Ga0495616_0443120 3300046513 Bacteria 527
244 Ga0495618_0500565 3300046514 Bacteria 732
245 Ga0495620_0005414 3300046515 Bacteria 7120
246 Ga0495620_0179303 3300046515 Bacteria 819
247 Ga0495620_0191463 3300046515 Bacteria 788
248 Ga0495628_0052608 3300046516 Bacteria 3216
249 Ga0495628_0060102 3300046516 Bacteria 2983
250 Ga0495628_0690796 3300046516 Bacteria 721
251 Ga0495630_0247444 3300046517 Bacteria 1362
252 Ga0495630_0454659 3300046517 Bacteria 981
253 Ga0495631_0010972 3300046518 Bacteria 4472
254 Ga0495631_0327753 3300046518 Bacteria 652
255 Ga0495632_0024028 3300046519 Bacteria 3245
256 Ga0495637_0166634 3300046520 Bacteria 824
257 Ga0495643_0011778 3300046522 Bacteria 5305
258 Ga0495643_0014698 3300046522 Bacteria 4651
259 Ga0495643_0332764 3300046522 Bacteria 684
260 Ga0495644_0228140 3300046523 Bacteria 721
261 Ga0495644_0332145 3300046523 Bacteria 597
262 Ga0495648_0139719 3300046524 Bacteria 1276
263 Ga0495648_0314551 3300046524 Bacteria 728
264 Ga0495648_0409496 3300046524 Bacteria 604
265 Ga0495666_0025991 3300046526 Bacteria 2889
266 Ga0495666_0405498 3300046526 Bacteria 612
267 Ga0495642_0383387 3300046528 Bacteria 619
268 Ga0495652_0021255 3300046529 Bacteria 5770
269 Ga0495652_0054635 3300046529 Bacteria 3400
270 Ga0495652_0303624 3300046529 Bacteria 1159
271 Ga0495654_0034103 3300046530 Bacteria 2571
272 Ga0495640_0009050 3300046533 Bacteria 7769
273 Ga0495586_0018907 3300046535 Bacteria 3667
274 Ga0495587_0010720 3300046536 Bacteria 5819
275 Ga0495609_0026069 3300046538 Bacteria 2676
276 Ga0495597_0021481 3300046542 Bacteria 3000
277 Ga0495597_0118065 3300046542 Bacteria 1107
278 Ga0495597_0135257 3300046542 Bacteria 1020
279 Ga0495645_0036522 3300046543 Bacteria 3581
280 Ga0495622_0052009 3300046557 Bacteria 1900
281 Ga0495622_0071573 3300046557 Bacteria 1600
282 Ga0495622_0133685 3300046557 Bacteria 1128
283 Ga0495622_0133694 3300046557 Bacteria 1128
284 Ga0495633_0053139 3300046558 Bacteria 1907
285 Ga0495633_0174081 3300046558 Bacteria 991
286 Ga0495667_0240767 3300046559 Bacteria 1152
287 Ga0495667_1014976 3300046559 Bacteria 506
288 Ga0495656_0257427 3300046615 Bacteria 883
289 Ga0495656_0647088 3300046615 Bacteria 567
290 Ga0495668_0021135 3300046616 Bacteria 3735
291 Ga0495668_0573110 3300046616 Bacteria 623
292 Ga0495634_0001165 3300046642 Bacteria 24350
293 Ga0495634_0353540 3300046642 Bacteria 879
294 Ga0495634_0413625 3300046642 Bacteria 799
295 Ga0495634_0859408 3300046642 Bacteria 515
296 Ga0495611_0075869 3300046648 Bacteria 1540
297 Ga0495611_0163865 3300046648 Bacteria 1039
298 Ga0495611_0359723 3300046648 Bacteria 667
299 Ga0495625_0015578 3300046660 Bacteria 6014
300 Ga0495625_0032383 3300046660 Bacteria 3876
301 Ga0495625_0074543 3300046660 Bacteria 2377
302 Ga0495625_0136139 3300046660 Bacteria 1660
303 Ga0495625_0554529 3300046660 Bacteria 695
304 Ga0495635_0001162 3300046663 Bacteria 17568
305 Ga0495635_0353150 3300046663 Bacteria 980
306 Ga0495635_0506888 3300046663 Bacteria 794
307 Ga0495659_0242544 3300046664 Bacteria 749
308 Ga0495661_0460302 3300046665 Bacteria 611
309 Ga0495588_0003076 3300046674 Bacteria 7220
310 Ga0495588_0009637 3300046674 Bacteria 4471
311 Ga0495588_0120126 3300046674 Bacteria 1385
312 Ga0495588_0512759 3300046674 Bacteria 628
313 Ga0495657_0000283 3300046675 Bacteria 45961
314 Ga0495657_0026260 3300046675 Bacteria 4124
315 Ga0495657_0170482 3300046675 Bacteria 1340
316 Ga0495599_0507669 3300046678 Bacteria 709
317 Ga0495623_0026384 3300046679 Bacteria 3740
318 Ga0495646_0001097 3300046680 Bacteria 15738
319 Ga0495658_0105317 3300046683 Bacteria 1689
320 Ga0495613_0004479 3300046689 Bacteria 10466
321 Ga0495613_0016022 3300046689 Bacteria 5581
322 Ga0495613_0089893 3300046689 Bacteria 2224
323 Ga0495613_0589501 3300046689 Bacteria 740
324 Ga0495624_0041946 3300046690 Bacteria 2925
325 Ga0495624_0087448 3300046690 Bacteria 1924
326 Ga0495624_0218123 3300046690 Bacteria 1157
327 Ga0495670_0016895 3300046691 Bacteria 3587
328 Ga0495670_0049344 3300046691 Bacteria 2106
329 Ga0495670_0213764 3300046691 Bacteria 1023
330 Ga0495670_0679311 3300046691 Bacteria 561
331 Ga0495671_0012980 3300046692 Bacteria 4531
332 Ga0495671_0053900 3300046692 Bacteria 1995
333 Ga0495671_0104799 3300046692 Bacteria 1381
334 Ga0495671_0179895 3300046692 Bacteria 1027
335 Ga0495671_0273703 3300046692 Bacteria 814
336 Ga0495649_0022390 3300046694 Bacteria 3536
337 Ga0495649_0158408 3300046694 Bacteria 1187
338 Ga0495649_0163272 3300046694 Bacteria 1167
339 Ga0495589_0007947 3300046794 Bacteria 5555
340 Ga0495589_0031156 3300046794 Bacteria 2685
341 Ga0495589_0073158 3300046794 Bacteria 1673
342 Ga0495589_0165973 3300046794 Bacteria 1051
343 Ga0495589_0245983 3300046794 Bacteria 836
344 Ga0495589_0246435 3300046794 Bacteria 835
345 Ga0495600_0003679 3300046809 Bacteria 9059
346 Ga0495600_0063078 3300046809 Bacteria 2421
347 Ga0495600_0405021 3300046809 Bacteria 848
348 Ga0495600_0553290 3300046809 Bacteria 703
349 Ga0495660_0284229 3300046810 Bacteria 755
350 Ga0495660_0402589 3300046810 Bacteria 599
351 Ga0495581_0015830 3300047315 Bacteria 4380
352 Ga0495581_0019968 3300047315 Bacteria 3891
353 Ga0495581_0093395 3300047315 Bacteria 1746
354 Ga0495581_0115004 3300047315 Bacteria 1565
355 Ga0495604_0023549 3300047317 Bacteria 4912
356 Ga0495604_0319740 3300047317 Bacteria 1037
357 Ga0495636_0012224 3300047318 Bacteria 3398
358 Ga0495636_0016079 3300047318 Bacteria 2985
359 Ga0495636_0024261 3300047318 Bacteria 2458
360 Ga0495636_0030356 3300047318 Bacteria 2210
361 Ga0495636_0042321 3300047318 Bacteria 1892
362 Ga0495636_0293435 3300047318 Bacteria 759
363 Ga0495636_0400220 3300047318 Bacteria 654
364 Ga0495636_0477961 3300047318 Bacteria 601
365 Ga0495674_0020875 3300047319 Bacteria 6064
366 Ga0495674_0102630 3300047319 Bacteria 2432
367 Ga0495672_0028214 3300047320 Bacteria 3554
368 Ga0495676_0000850 3300047321 Bacteria 25574
369 Ga0495676_0001475 3300047321 Bacteria 20305
370 Ga0495676_0093614 3300047321 Bacteria 2240
371 Ga0495676_0210420 3300047321 Bacteria 1345
372 Ga0495680_0086765 3300047322 Bacteria 2354
373 Ga0495680_0537174 3300047322 Bacteria 789
374 Ga0495680_0706469 3300047322 Bacteria 665
375 Ga0495683_0072641 3300047323 Bacteria 1687
376 Ga0495683_0168109 3300047323 Bacteria 1010
377 Ga0495687_003711 3300047443 Bacteria 10847
378 Ga0495687_014978 3300047443 Bacteria 3961
379 Ga0495687_031941 3300047443 Bacteria 2409
380 Ga0495687_071626 3300047443 Bacteria 1388
381 Ga0495687_140484 3300047443 Bacteria 840
382 Ga0495687_168899 3300047443 Bacteria 726
383 Ga0495687_228235 3300047443 Bacteria 570
384 Ga0495675_0016331 3300047444 Bacteria 4696
385 Ga0495675_0030010 3300047444 Bacteria 3469
386 Ga0495675_0061919 3300047444 Bacteria 2370
387 Ga0495677_0138294 3300047445 Bacteria 934
388 Ga0495677_0211940 3300047445 Bacteria 754
389 Ga0495685_000564 3300047447 Bacteria 11463
390 Ga0495685_004622 3300047447 Bacteria 4461
391 Ga0495685_006943 3300047447 Bacteria 3724
392 Ga0495685_010122 3300047447 Bacteria 3160
393 Ga0495685_018415 3300047447 Bacteria 2397
394 Ga0495685_054023 3300047447 Bacteria 1359
395 Ga0495685_104849 3300047447 Bacteria 932
396 Ga0495681_0001066 3300047470 Bacteria 20908
397 Ga0495681_0004621 3300047470 Bacteria 9350
398 Ga0495681_0132419 3300047470 Bacteria 1060
399 Ga0495681_0307965 3300047470 Bacteria 611
400 Ga0495684_0093233 3300047471 Bacteria 2281
401 Ga0495686_0012090 3300047472 Bacteria 6060
402 Ga0495686_0108722 3300047472 Bacteria 1665
403 Ga0495686_0123188 3300047472 Bacteria 1543
404 Ga0495593_0001501 3300047673 Bacteria 13711
405 Ga0495593_0118007 3300047673 Bacteria 1351
406 Ga0495593_0138444 3300047673 Bacteria 1233
407 Ga0495602_0027031 3300048088 Bacteria 5525
408 Ga0495602_0169647 3300048088 Bacteria 1695
409 Ga0495614_0039073 3300048089 Bacteria 2036
410 Ga0495614_0047972 3300048089 Bacteria 1831
411 Ga0495614_0231203 3300048089 Bacteria 842
412 Ga0495614_0282566 3300048089 Bacteria 764
413 Ga0495626_0026684 3300048091 Bacteria 2812
414 Ga0496104_1717628 3300048907 Bacteria 530
415 Ga0496109_0097382 3300048912 Bacteria 2727
416 Ga0496110_0845982 3300048913 Bacteria 820
417 Ga0495678_069037 3300049459 Bacteria 1301
418 Ga0495682_0164160 3300049460 Bacteria 791
419 Ga0501032_0035365 3300049569 Bacteria 3415
420 Ga0501032_0108023 3300049569 Bacteria 1842
421 Ga0501033_0015327 3300049570 Bacteria 5814
422 Ga0501033_0029690 3300049570 Bacteria 4108
423 Ga0501034_0027401 3300049571 Bacteria 5795
424 Ga0501034_0247523 3300049571 Bacteria 1727
425 Ga0501034_1404277 3300049571 Bacteria 573
426 Ga0501036_0203440 3300049572 Bacteria 1665
427 Ga0501036_0498169 3300049572 Bacteria 1014
428 Ga0501037_0135594 3300049573 Bacteria 1763
429 Ga0501038_0000639 3300049574 Bacteria 31108
430 Ga0501038_0034151 3300049574 Bacteria 4474
431 Ga0501038_0870303 3300049574 Bacteria 666
432 Ga0501039_0014036 3300049575 Bacteria 6130
433 Ga0501043_0059889 3300049579 Bacteria 2988
434 Ga0501043_0060369 3300049579 Bacteria 2976
435 Ga0501043_0489073 3300049579 Bacteria 920
436 Ga0501047_0008405 3300049581 Bacteria 9741
437 Ga0501047_0057908 3300049581 Bacteria 3745
438 Ga0501047_0853987 3300049581 Bacteria 724
439 Ga0501070_0008796 3300049586 Bacteria 8538
440 Ga0501070_0092166 3300049586 Bacteria 2508
441 Ga0501070_0351934 3300049586 Bacteria 1195
442 Ga0501071_1278064 3300049587 Bacteria 567
443 Ga0501072_0698755 3300049588 Bacteria 797
444 Ga0501073_0160211 3300049589 Bacteria 1559
445 Ga0501257_238813 3300049686 Bacteria 535
446 Ga0501080_0167953 3300049742 Bacteria 2024
447 Ga0501080_1027783 3300049742 Bacteria 714
448 Ga0501035_0009028 3300049822 Bacteria 9272
449 Ga0501035_0152227 3300049822 Bacteria 2006
450 Ga0501035_0163887 3300049822 Bacteria 1923
451 Ga0501035_0730313 3300049822 Bacteria 796
452 Ga0501044_0009694 3300049823 Bacteria 10475
453 Ga0501044_0094543 3300049823 Bacteria 3013
454 Ga0501044_0144603 3300049823 Bacteria 2364
455 Ga0501044_0560500 3300049823 Bacteria 1039
456 Ga0501044_0884641 3300049823 Bacteria 769
457 Ga0501045_0023467 3300049824 Bacteria 4423
458 Ga0501045_0033450 3300049824 Bacteria 3728
459 nmdc:mga03n38_20118_c1 3300050490 Bacteria 2665
460 nmdc:mga0yw44_1167431_c1 3300050492 Bacteria 520
461 nmdc:mga06z11_3953_c1 3300050494 Bacteria 5777
462 nmdc:mga07m45_227099_c1 3300050496 Bacteria 1086
463 nmdc:mga07m45_40452_c1 3300050496 Bacteria 2608
464 Ga0495612_0060529 3300053078 Bacteria 1567
465 Ga0500610_0166995 3300053079 Bacteria 1090
466 Ga0500635_0217766 3300053080 Bacteria 745
467 Ga0495655_0053373 3300053083 Bacteria 1078
468 Ga0495655_0345336 3300053083 Bacteria 520
469 Ga0495595_0439112 3300053084 Bacteria 663
470 Ga0500578_0050522 3300053086 Bacteria 2666
471 Ga0500644_0017702 3300053088 Bacteria 2074
472 Ga0500646_0013143 3300053090 Bacteria 2143
473 Ga0500583_0090949 3300053092 Bacteria 1485
474 Ga0500583_0384322 3300053092 Bacteria 676
475 Ga0500651_0182608 3300053093 Bacteria 1245
476 Ga0500566_0131060 3300053094 Bacteria 1341
477 Ga0500640_002729 3300053095 Bacteria 5928
478 Ga0500641_0062782 3300053096 Bacteria 1550
479 Ga0500641_0352827 3300053096 Bacteria 591
480 Ga0500650_0229010 3300053098 Bacteria 839
481 Ga0500654_029449 3300053099 Bacteria 3331
482 Ga0500553_183202 3300053101 Bacteria 747
483 Ga0500553_218418 3300053101 Bacteria 625
484 Ga0500560_008061 3300053107 Bacteria 2515
485 Ga0500560_074017 3300053107 Bacteria 1126
486 Ga0500560_163010 3300053107 Bacteria 736
487 Ga0500572_005879 3300053111 Bacteria 2792
488 Ga0500621_127680 3300053126 Bacteria 978
489 Ga0500628_047562 3300053129 Bacteria 1005
490 Ga0500628_050868 3300053129 Bacteria 982
491 Ga0500652_013690 3300053131 Bacteria 2880
492 Ga0500658_0053694 3300053134 Bacteria 1653
493 Ga0500561_0006968 3300053137 Bacteria 2180
494 Ga0500573_0040032 3300053140 Bacteria 2707
495 Ga0500573_0098258 3300053140 Bacteria 1649
496 Ga0500577_0342599 3300053142 Bacteria 653
497 Ga0500579_169209 3300053143 Bacteria 895
498 Ga0500586_240862 3300053145 Bacteria 572
499 Ga0500588_0026185 3300053146 Bacteria 1629
500 Ga0500600_0065068 3300053149 Bacteria 2018
501 Ga0500600_0098783 3300053149 Bacteria 1543
502 Ga0500600_0188082 3300053149 Bacteria 986
503 Ga0500600_0221936 3300053149 Bacteria 871
504 Ga0500600_0418673 3300053149 Bacteria 525
505 Ga0500616_0020946 3300053153 Bacteria 3670
506 Ga0500633_0001070 3300053160 Bacteria 4899
507 Ga0500634_0144836 3300053161 Bacteria 1119
508 Ga0500636_0159562 3300053177 Bacteria 1231
509 Ga0500656_000887 3300053732 Bacteria 2414
510 Ga0500587_003134 3300053739 Bacteria 2332
511 Ga0466962_0002206 3300061719 Bacteria 9206
512 Ga0466962_0024483 3300061719 Bacteria 2900
513 Ga0466962_0214072 3300061719 Bacteria 943
514 2547409105 2547132111 Bacteria 8013147
515 2585309693 2582581313 Bacteria 10042643
516 2585315918 2582581314 Bacteria 11452267
517 2616693029 2616644814 Bacteria 11555299
518 2644264276 2643221647 Bacteria 10741251
519 2644438299 2643221678 Bacteria 9540101
520 2644630055 2643221714 Bacteria 9015452
521 2784586497 2784132148 Bacteria 8627943
522 2785346012 2784746763 Bacteria 9783172
523 2785366895 2784746768 Bacteria 10036182
524 2786667932 2786546132 Bacteria 10419719
525 2808847396 2808606359 Bacteria 9866990
526 2808918116 2808606375 Bacteria 9466072
527 2809230009 2808606448 Bacteria 8656184
528 2812360572 2811994879 Bacteria 9313447
529 2812482640 2811994917 Bacteria 7761064
530 2852641397 2852635781 Bacteria 8251373
531 2862181316 2862178590 Bacteria 8583590
532 2862289975 2862281513 Bacteria 9621493
533 2862296533 2862290372 Bacteria 7471434
534 2862386299 2862382967 Bacteria 10317375
535 2862516184 2862507626 Bacteria 9425308
536 2862580276 2862574272 Bacteria 10567477
537 2867369621 2867369537 Bacteria 6501581
538 2867432558 2867428634 Bacteria 9590268
539 2867481360 2867475112 Bacteria 6909112
540 2877683661 2877676314 Bacteria 9512378
541 2912722933 2912715099 Bacteria 9460473
542 2912726428 2912723979 Bacteria 8557534
543 2912758532 2912757875 Bacteria 7940295
544 2919474353 2919468124 Bacteria 9133025
545 2946065312 2946064051 Bacteria 8957905
546 2946073681 2946072368 Bacteria 8999607
547 2947232134 2947224130 Bacteria 9938529
548 2954008746 2954002825 Bacteria 9173742
549 2954388908 2954380949 Bacteria 10050426
550 2954674217 2954673503 Bacteria 9685905
551 2954689915 2954682443 Bacteria 9862841
552 2954699699 2954691527 Bacteria 10720516
553 2954702500 2954701450 Bacteria 10834262
554 2954718638 2954711539 Bacteria 10867210
555 2954728609 2954721474 Bacteria 10456478
556 2954733203 2954731030 Bacteria 10243860
557 2954747505 2954740390 Bacteria 10229294
558 2954752083 2954749733 Bacteria 10366972
559 2954766621 2954759201 Bacteria 9358192
560 2990064742 2990059506 Bacteria 9321252
561 2990092687 2990088156 Bacteria 6657676
562 2997452748 2997451912 Bacteria 8492419
563 3006396357 3006393351 Bacteria 6615579
564 3006430788 3006425503 Bacteria 6491253
565 3006497127 3006493962 Bacteria 8825450
566 8008560979 8008558824 Bacteria 10610750
567 8008581036 8008574985 Bacteria 7815457
568 8023628646 8023623736 Bacteria 8593882
569 8025535985 8025530807 Bacteria 8495698
570 8047894464 8047893842 Bacteria 11723082
571 8048134799 8048127548 Bacteria 11053136
572 8048364588 8048356638 Bacteria 11044339
573 8048371481 8048369669 Bacteria 11666822
574 8048380282 8048379754 Bacteria 11877923
575 8048412941 8048406513 Bacteria 8936924
576 8054164254 8054160619 Bacteria 7783213
577 8056832584 8056829672 Bacteria 9045328
578 Ga0501044_0003403
579 JGI24739J22299_10071069
580 JGI24737J22298_10034647
581 JGI24735J21928_10126731
582 JGI24738J21930_10046980
583 rootH1_10000283
584 rootH1_10090014
585 rootH2_10030795
586 rootL2_10042621
587 rootH1_10011606
588 JGI25160J50197_1024122
589 JGI25160J50197_1024767
590 JGI25160J50197_1040286
591 Ga0006562J51391_1050508
592 Ga0006562J51391_1109584
593 Ga0070708_102116104
594 Ga0068853_100256675
595 Ga0068853_101017554
596 Ga0068857_101204493
597 Ga0081455_10535766
598 Ga0075365_10093490
599 Ga0075363_100001559
600 Ga0075363_100099724
601 Ga0070715_10060909
602 Ga0075367_10003073
603 Ga0075369_10346049
604 Ga0075370_10027466
605 Ga0075370_10332033
606 Ga0099826_10048191
607 Ga0105251_10079994
608 Ga0105250_10194989
609 Ga0105245_10204002
610 Ga0105243_10129613
611 Ga0105148_122158
612 Ga0157372_10069529
613 Ga0157375_10152878
614 Ga0157375_12339823
615 Ga0182008_10018417
616 Ga0182006_1034031
617 Ga0182007_10000170
618 Ga0183367_1003
619 Ga0209758_1013977
620 Ga0207426_1002017
621 Ga0207426_1008095
622 Ga0207426_1009010
623 Ga0207426_1056020
624 Ga0207696_1081037
625 Ga0207713_1236277
626 Ga0207647_10425560
627 Ga0207687_11213445
628 Ga0207687_11568460
629 Ga0207709_10060617
630 Ga0207639_10178678
631 Ga0307517_10004498
632 Ga0307517_10017502
633 Ga0307515_10066693
634 Ga0307515_10085202
635 Ga0307515_10295096
636 Ga0307515_10508502
637 Ga0307511_10000652
638 Ga0307511_10082062
639 Ga0307511_10132933
640 Ga0307511_10182164
641 Ga0307511_10288860
642 Ga0307512_10001761
643 Ga0307512_10346872
644 Ga0307513_10276473
645 Ga0307513_10426797
646 Ga0307509_10028458
647 Ga0307509_10134367
648 Ga0307509_10186564
649 Ga0307508_10033500
650 Ga0307508_10065485
651 Ga0307508_10084659
652 Ga0307508_10354011
653 Ga0307508_10444272
654 Ga0307508_10462771
655 Ga0307514_10011710
656 Ga0307514_10268269
657 Ga0307514_10332952
658 Ga0307514_10340503
659 Ga0307516_10004873
660 Ga0307516_10060832
661 Ga0307516_10120036
662 Ga0307516_10137884
663 Ga0307516_10745751
664 Ga0307518_10097796
665 Ga0307518_10123873
666 Ga0307518_10339712
667 Ga0307518_10350623
668 Ga0307507_10100562
669 Ga0307507_10112063
670 Ga0307507_10383062
671 Ga0307510_10142466
672 Ga0307510_10215372
673 Ga0307510_10313116
674 Ga0307510_10435736
675 Ga0307510_10494795
676 Ga0395900_0387515
677 Ga0395900_0892916
678 Ga0395898_0015611
679 Ga0395898_0024116
680 Ga0395898_0129746
681 Ga0395898_1356966
682 Ga0395905_0599981
683 Ga0395901_0937640
684 Ga0439436_0012642
685 Ga0439436_0128311
686 Ga0439439_0002771
687 Ga0439439_0098599
688 Ga0439439_0105392
689 Ga0439466_0169000
690 Ga0451791_1171975
691 Ga0451807_2283274
692 Ga0451833_0143112
693 Ga0451833_1084891
694 Ga0451835_0875240
695 Ga0451837_0005122
696 Ga0451845_0398276
697 Ga0451843_0695223
698 Ga0451853_0408476
699 Ga0451853_0855223
700 Ga0451853_0903718
701 Ga0451853_2768007
702 Ga0439433_0001395
703 Ga0439433_0026489
704 Ga0439442_020500
705 Ga0439448_0014186
706 Ga0439449_0000590
707 Ga0439449_0017520
708 Ga0439449_0100629
709 Ga0439457_001444
710 Ga0439457_019320
711 Ga0450920_053080
712 Ga0450890_019966
713 Ga0450894_000888
714 Ga0450896_003841
715 Ga0450898_069062
716 Ga0450899_000945
717 Ga0450902_046154
718 Ga0450903_000095
719 Ga0450906_005259
720 Ga0439458_0000663
721 Ga0439458_0016648
722 Ga0450908_009803
723 Ga0450901_026926
724 Ga0466969_0036381
725 Ga0466972_0009915
726 Ga0466972_0018530
727 Ga0466972_0142036
728 Ga0466972_0152564
729 Ga0466972_0281374
730 Ga0466965_0003378
731 Ga0466965_0039334
732 Ga0466965_0057486
733 Ga0466965_0725442
734 Ga0466966_0007528
735 Ga0466966_0019431
736 Ga0466966_0179140
737 Ga0466961_0001971
738 Ga0466961_0030504
739 Ga0466961_0177693
740 Ga0466963_0003723
741 Ga0466963_0440623
742 Ga0466964_0009585
743 Ga0466971_0003547
744 Ga0466971_0126560
745 Ga0466971_0365797
746 Ga0466971_0497652
747 Ga0466968_0304219
748 Ga0466970_0002926
749 Ga0466970_0010567
750 Ga0466970_0344189
751 Ga0466957_0000722
752 Ga0466960_0093529
753 Ga0466960_0103032
754 Ga0466960_0378539
755 Ga0466959_0479037
756 Ga0466958_0003160
757 Ga0466958_0237264
758 Ga0466967_0017610
759 Ga0466967_0098517
760 Ga0466967_0586840
761 Ga0495617_064395
762 Ga0495627_066827
763 Ga0495627_092756
764 Ga0495592_0008348
765 Ga0495592_0566636
766 Ga0495603_0004210
767 Ga0495603_0037191
768 Ga0495603_0099508
769 Ga0495603_0182070
770 Ga0495603_0227903
771 Ga0495603_0404660
772 Ga0495603_0420699
773 Ga0495590_0089800
774 Ga0495629_0005761
775 Ga0495629_0010541
776 Ga0495629_0034967
777 Ga0495629_0071262
778 Ga0495629_0148538
779 Ga0495629_0155828
780 Ga0495629_0619769
781 Ga0495629_0751906
782 Ga0495638_0079205
783 Ga0495638_0179444
784 Ga0495638_0235547
785 Ga0495638_0360111
786 Ga0495641_0262774
787 Ga0495651_0001712
788 Ga0495651_0243761
789 Ga0495653_0277975
790 Ga0495653_0465301
791 Ga0495580_0752919
792 Ga0495580_0755039
793 Ga0495582_0129321
794 Ga0495582_0236579
795 Ga0495582_0811344
796 Ga0495582_0885211
797 Ga0495605_0001821
798 Ga0495639_0050532
799 Ga0495662_0003036
800 Ga0495662_0005845
801 Ga0495662_0067735
802 Ga0495664_0000486
803 Ga0495664_0053891
804 Ga0495585_0084423
805 Ga0495585_0195960
806 Ga0495594_0031173
807 Ga0495594_0032103
808 Ga0495594_0055995
809 Ga0495594_0064241
810 Ga0495594_0135947
811 Ga0495596_0046922
812 Ga0495607_0023971
813 Ga0495583_0015895
814 Ga0495583_0030782
815 Ga0495583_0106538
816 Ga0495606_0035088
817 Ga0495610_0041053
818 Ga0495610_0340591
819 Ga0495616_0055294
820 Ga0495616_0443120
821 Ga0495618_0500565
822 Ga0495620_0005414
823 Ga0495620_0179303
824 Ga0495620_0191463
825 Ga0495628_0052608
826 Ga0495628_0060102
827 Ga0495628_0690796
828 Ga0495630_0247444
829 Ga0495630_0454659
830 Ga0495631_0010972
831 Ga0495631_0327753
832 Ga0495632_0024028
833 Ga0495637_0166634
834 Ga0495643_0011778
835 Ga0495643_0014698
836 Ga0495643_0332764
837 Ga0495644_0228140
838 Ga0495644_0332145
839 Ga0495648_0139719
840 Ga0495648_0314551
841 Ga0495648_0409496
842 Ga0495666_0025991
843 Ga0495666_0405498
844 Ga0495642_0383387
845 Ga0495652_0021255
846 Ga0495652_0054635
847 Ga0495652_0303624
848 Ga0495654_0034103
849 Ga0495640_0009050
850 Ga0495586_0018907
851 Ga0495587_0010720
852 Ga0495609_0026069
853 Ga0495597_0021481
854 Ga0495597_0118065
855 Ga0495597_0135257
856 Ga0495645_0036522
857 Ga0495622_0052009
858 Ga0495622_0071573
859 Ga0495622_0133685
860 Ga0495622_0133694
861 Ga0495633_0053139
862 Ga0495633_0174081
863 Ga0495667_0240767
864 Ga0495667_1014976
865 Ga0495656_0257427
866 Ga0495656_0647088
867 Ga0495668_0021135
868 Ga0495668_0573110
869 Ga0495634_0001165
870 Ga0495634_0353540
871 Ga0495634_0413625
872 Ga0495634_0859408
873 Ga0495611_0075869
874 Ga0495611_0163865
875 Ga0495611_0359723
876 Ga0495625_0015578
877 Ga0495625_0032383
878 Ga0495625_0074543
879 Ga0495625_0136139
880 Ga0495625_0554529
881 Ga0495635_0001162
882 Ga0495635_0353150
883 Ga0495635_0506888
884 Ga0495659_0242544
885 Ga0495661_0460302
886 Ga0495588_0003076
887 Ga0495588_0009637
888 Ga0495588_0120126
889 Ga0495588_0512759
890 Ga0495657_0000283
891 Ga0495657_0026260
892 Ga0495657_0170482
893 Ga0495599_0507669
894 Ga0495623_0026384
895 Ga0495646_0001097
896 Ga0495658_0105317
897 Ga0495613_0004479
898 Ga0495613_0016022
899 Ga0495613_0089893
900 Ga0495613_0589501
901 Ga0495624_0041946
902 Ga0495624_0087448
903 Ga0495624_0218123
904 Ga0495670_0016895
905 Ga0495670_0049344
906 Ga0495670_0213764
907 Ga0495670_0679311
908 Ga0495671_0012980
909 Ga0495671_0053900
910 Ga0495671_0104799
911 Ga0495671_0179895
912 Ga0495671_0273703
913 Ga0495649_0022390
914 Ga0495649_0158408
915 Ga0495649_0163272
916 Ga0495589_0007947
917 Ga0495589_0031156
918 Ga0495589_0073158
919 Ga0495589_0165973
920 Ga0495589_0245983
921 Ga0495589_0246435
922 Ga0495600_0003679
923 Ga0495600_0063078
924 Ga0495600_0405021
925 Ga0495600_0553290
926 Ga0495660_0284229
927 Ga0495660_0402589
928 Ga0495581_0015830
929 Ga0495581_0019968
930 Ga0495581_0093395
931 Ga0495581_0115004
932 Ga0495604_0023549
933 Ga0495604_0319740
934 Ga0495636_0012224
935 Ga0495636_0016079
936 Ga0495636_0024261
937 Ga0495636_0030356
938 Ga0495636_0042321
939 Ga0495636_0293435
940 Ga0495636_0400220
941 Ga0495636_0477961
942 Ga0495674_0020875
943 Ga0495674_0102630
944 Ga0495672_0028214
945 Ga0495676_0000850
946 Ga0495676_0001475
947 Ga0495676_0093614
948 Ga0495676_0210420
949 Ga0495680_0086765
950 Ga0495680_0537174
951 Ga0495680_0706469
952 Ga0495683_0072641
953 Ga0495683_0168109
954 Ga0495687_003711
955 Ga0495687_014978
956 Ga0495687_031941
957 Ga0495687_071626
958 Ga0495687_140484
959 Ga0495687_168899
960 Ga0495687_228235
961 Ga0495675_0016331
962 Ga0495675_0030010
963 Ga0495675_0061919
964 Ga0495677_0138294
965 Ga0495677_0211940
966 Ga0495685_000564
967 Ga0495685_004622
968 Ga0495685_006943
969 Ga0495685_010122
970 Ga0495685_018415
971 Ga0495685_054023
972 Ga0495685_104849
973 Ga0495681_0001066
974 Ga0495681_0004621
975 Ga0495681_0132419
976 Ga0495681_0307965
977 Ga0495684_0093233
978 Ga0495686_0012090
979 Ga0495686_0108722
980 Ga0495686_0123188
981 Ga0495593_0001501
982 Ga0495593_0118007
983 Ga0495593_0138444
984 Ga0495602_0027031
985 Ga0495602_0169647
986 Ga0495614_0039073
987 Ga0495614_0047972
988 Ga0495614_0231203
989 Ga0495614_0282566
990 Ga0495626_0026684
991 Ga0496104_1717628
992 Ga0496109_0097382
993 Ga0496110_0845982
994 Ga0495678_069037
995 Ga0495682_0164160
996 Ga0501032_0035365
997 Ga0501032_0108023
998 Ga0501033_0015327
999 Ga0501033_0029690
1000 Ga0501034_0027401
1001 Ga0501034_0247523
1002 Ga0501034_1404277
1003 Ga0501036_0203440
1004 Ga0501036_0498169
1005 Ga0501037_0135594
1006 Ga0501038_0000639
1007 Ga0501038_0034151
1008 Ga0501038_0870303
1009 Ga0501039_0014036
1010 Ga0501043_0059889
1011 Ga0501043_0060369
1012 Ga0501043_0489073
1013 Ga0501047_0008405
1014 Ga0501047_0057908
1015 Ga0501047_0853987
1016 Ga0501070_0008796
1017 Ga0501070_0092166
1018 Ga0501070_0351934
1019 Ga0501071_1278064
1020 Ga0501072_0698755
1021 Ga0501073_0160211
1022 Ga0501257_238813
1023 Ga0501080_0167953
1024 Ga0501080_1027783
1025 Ga0501035_0009028
1026 Ga0501035_0152227
1027 Ga0501035_0163887
1028 Ga0501035_0730313
1029 Ga0501044_0009694
1030 Ga0501044_0094543
1031 Ga0501044_0144603
1032 Ga0501044_0560500
1033 Ga0501044_0884641
1034 Ga0501045_0023467
1035 Ga0501045_0033450
1036 nmdc:mga03n38_20118_c1
1037 nmdc:mga0yw44_1167431_c1
1038 nmdc:mga06z11_3953_c1
1039 nmdc:mga07m45_227099_c1
1040 nmdc:mga07m45_40452_c1
1041 Ga0495612_0060529
1042 Ga0500610_0166995
1043 Ga0500635_0217766
1044 Ga0495655_0053373
1045 Ga0495655_0345336
1046 Ga0495595_0439112
1047 Ga0500578_0050522
1048 Ga0500644_0017702
1049 Ga0500646_0013143
1050 Ga0500583_0090949
1051 Ga0500583_0384322
1052 Ga0500651_0182608
1053 Ga0500566_0131060
1054 Ga0500640_002729
1055 Ga0500641_0062782
1056 Ga0500641_0352827
1057 Ga0500650_0229010
1058 Ga0500654_029449
1059 Ga0500553_183202
1060 Ga0500553_218418
1061 Ga0500560_008061
1062 Ga0500560_074017
1063 Ga0500560_163010
1064 Ga0500572_005879
1065 Ga0500621_127680
1066 Ga0500628_047562
1067 Ga0500628_050868
1068 Ga0500652_013690
1069 Ga0500658_0053694
1070 Ga0500561_0006968
1071 Ga0500573_0040032
1072 Ga0500573_0098258
1073 Ga0500577_0342599
1074 Ga0500579_169209
1075 Ga0500586_240862
1076 Ga0500588_0026185
1077 Ga0500600_0065068
1078 Ga0500600_0098783
1079 Ga0500600_0188082
1080 Ga0500600_0221936
1081 Ga0500600_0418673
1082 Ga0500616_0020946
1083 Ga0500633_0001070
1084 Ga0500634_0144836
1085 Ga0500636_0159562
1086 Ga0500656_000887
1087 Ga0500587_003134
1088 Ga0466962_0002206
1089 Ga0466962_0024483
1090 Ga0466962_0214072
1091 2547409105
1092 2585309693
1093 2585315918
1094 2616693029
1095 2644264276
1096 2644438299
1097 2644630055
1098 2784586497
1099 2785346012
1100 2785366895
1101 2786667932
1102 2808847396
1103 2808918116
1104 2809230009
1105 2812360572
1106 2812482640
1107 2852641397
1108 2862181316
1109 2862289975
1110 2862296533
1111 2862386299
1112 2862516184
1113 2862580276
1114 2867369621
1115 2867432558
1116 2867481360
1117 2877683661
1118 2912722933
1119 2912726428
1120 2912758532
1121 2919474353
1122 2946065312
1123 2946073681
1124 2947232134
1125 2954008746
1126 2954388908
1127 2954674217
1128 2954689915
1129 2954699699
1130 2954702500
1131 2954718638
1132 2954728609
1133 2954733203
1134 2954747505
1135 2954752083
1136 2954766621
1137 2990064742
1138 2990092687
1139 2997452748
1140 3006396357
1141 3006430788
1142 3006497127
1143 8008560979
1144 8008581036
1145 8023628646
1146 8025535985
1147 8047894464
1148 8048134799
1149 8048364588
1150 8048371481
1151 8048380282
1152 8048412941
1153 8054164254
1154 8056832584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rbd-assembly1.cif.gz_A crystal structure of a putative spore coat protein (bh2358) from bacillus halodurans c-125 at 1.54 a resolution 0.8244 15 75
5l8g-assembly1.cif.gz_E crystal structure of rhodospirillum rubrum rru_a0973 mutant h65a 0.7782 14 83
7upq-assembly4.cif.gz_J crystal structure of designed heterotrimeric assembly dht03_1arm_a21/b/c 0.7773 8 67
5l89-assembly3.cif.gz_Z crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a 0.767 14 83
5n5f-assembly1.cif.gz_B crystal structure of haliangium ochraceum encapsulated ferritin 0.7626 14 91
ID Description Score Start End Superfamily
4h63H01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7375 15 72 1.20.58.1710
4javA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.7354 15 70 1.10.287.130
3stqE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7131 15 81 1.10.287.2500
3dgeB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6888 15 72 1.10.287.130
3fyqA00 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6882 15 61 1.20.1420.10
ID Description Score Start End GO Terms
AF-A0A7K2LQH8-F1-model_v4 Uncharacterized protein 0.8694 1 67
AF-A0A538NAI4-F1-model_v4 Uncharacterized protein 0.8254 4 86
AF-A0A1Q9K6T3-F1-model_v4 DUF2383 domain-containing protein 0.816 15 91
AF-A0A3R9WXZ7-F1-model_v4 deleted 0.8146 1 90
AF-A0A3R9WXZ7-F1-model_v4 deleted 0.8065 1 90

Map