F465574

General Info

Members Datasets Scaffolds Average Seq Length
576 342 508 248

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2977942078|2977947348
Length 286
Sequence GRERNQWLLLPASKPSTARACSGRMLLNVLIKEKRMTKRLENKIAVVTGANGGIGLATAKLFAAEGAYVYITGRRKELLDAAVAEIGGKVTAVNADSTKMEDLDRLFAQVKVDHGRLDAIVVNAGGGTVLPLGQITEEQVDDTLARNVKAVIFTVQKALPLLGKGSSVILIGSTTSIEGTEAFSIYSASKAAVRNLARSWTLDLKGTGVRVNVLSPGPTRTPGLVELVGDDKNAQQGFLEALASTIPLGRVGEPEEIAKAALFLASDDSSFVNGVELFADGGKAQV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
3 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
4 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
5 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
6 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
7 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
8 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
9 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
10 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
11 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
12 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
13 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
14 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
15 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
16 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
17 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
18 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
19 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
20 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
21 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
22 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
23 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
24 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
25 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
26 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
27 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
28 2643221599 Rhizobium sp. Root708 Isolate Unclassified
29 2643221610 Ensifer sp. Root74 Isolate Unclassified
30 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
31 2643221675 Ensifer sp. Root1298 Isolate Unclassified
32 2643221680 Ensifer sp. Root1312 Isolate Unclassified
33 2643221693 Rhizobium sp. Root491 Isolate Unclassified
34 2643221719 Rhizobium sp. Root274 Isolate Unclassified
35 2643221726 Ensifer sp. Root954 Isolate Unclassified
36 2738541293 Rhizobium sp. GV031 Isolate Unclassified
37 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
38 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
39 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
40 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
41 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
42 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
43 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
44 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
45 2818991457 Xanthomonas translucens 569 Isolate Unclassified
46 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
47 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
48 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
49 2857472729 Cohnella sp. R-74144 Isolate Unclassified
50 2857558681 Duganella sp. R-74565 Isolate Unclassified
51 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
52 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
53 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
54 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
55 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
56 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
57 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
58 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
59 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
60 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
61 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
62 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
63 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
64 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
65 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
66 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
67 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
68 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
69 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
70 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
71 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
72 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
73 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
76 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
77 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
78 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
81 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
82 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
83 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
86 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
87 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
94 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
95 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
96 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
99 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
100 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
101 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
197 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
212 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
309 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
320 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
321 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
322 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
323 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
324 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
325 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
326 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
327 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
328 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
331 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
332 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
333 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
334 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
335 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
336 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
337 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
338 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
339 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
340 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
341 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
342 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.02
Metatranscriptomes 0.17
Isolates 11.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 14.58
Nodule 0.69
Rhizoplane 4.51
Rhizosphere 58.33
Stem 0
Stem Tuber 0
Unclassified 21.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2275730 2162886007 Bacteria 2934
2 SwRhRL2b_contig_843216 2162886007 Bacteria 959
3 JGI25162J39368_1000018 3300002737 Bacteria 277875
4 JGI25157J39369_1000011 3300002741 Bacteria 206831
5 JGI25157J39369_1000835 3300002741 Bacteria 15295
6 JGI25163J39215_1000107 3300002771 Bacteria 34813
7 JGI25164J39214_1000007 3300002772 Bacteria 312507
8 JGI25152J39213_1001043 3300002773 Bacteria 13181
9 JGI25165J46597_1000029 3300003214 Bacteria 312507
10 rootH2_10046723 3300003320 Bacteria 26070
11 rootL2_10154963 3300003322 Bacteria 4095
12 rootH1_10269096 3300003323 Bacteria 1235
13 Ga0055538_1000557 3300003751 Bacteria 12850
14 Ga0055535_1000025 3300003761 Bacteria 213549
15 Ga0055542_1000024 3300003762 Bacteria 277875
16 Ga0055529_1000029 3300003763 Bacteria 277978
17 Ga0055524_1000446 3300003775 Bacteria 34169
18 Ga0055524_1000926 3300003775 Bacteria 18886
19 Ga0055528_1000039 3300003790 Bacteria 112899
20 Ga0055528_1001470 3300003790 Bacteria 14315
21 Ga0055528_1001847 3300003790 Bacteria 12073
22 Ga0055528_1034247 3300003790 Bacteria 1256
23 Ga0055540_1000054 3300003792 Bacteria 142505
24 Ga0055531_10000037 3300003794 Bacteria 144244
25 Ga0058692_1000033 3300003856 Bacteria 174393
26 Ga0058692_1001483 3300003856 Bacteria 8612
27 Ga0065165_1004458 3300005262 Bacteria 8665
28 Ga0065165_1064499 3300005262 Bacteria 992
29 Ga0065714_10065183 3300005288 Bacteria 12142
30 Ga0065714_10066890 3300005288 Bacteria 6141
31 Ga0065714_10135124 3300005288 Bacteria 1215
32 Ga0065704_10001230 3300005289 Bacteria 16226
33 Ga0065704_10004875 3300005289 Bacteria 3141
34 Ga0065704_10071710 3300005289 Bacteria 10180
35 Ga0065704_10103753 3300005289 Bacteria 2162
36 Ga0065712_10069134 3300005290 Bacteria 7949
37 Ga0070670_100003014 3300005331 Bacteria 13938
38 Ga0070670_100082237 3300005331 Bacteria 2767
39 Ga0070670_100177919 3300005331 Bacteria 1846
40 Ga0070661_100000024 3300005344 Bacteria 121810
41 Ga0070661_100015493 3300005344 Bacteria 5380
42 Ga0070668_100233546 3300005347 Bacteria 1521
43 Ga0070669_100000048 3300005353 Bacteria 118472
44 Ga0070669_100001022 3300005353 Bacteria 20393
45 Ga0070669_100135309 3300005353 Bacteria 1895
46 Ga0070667_100541824 3300005367 Bacteria 1069
47 Ga0070667_100606245 3300005367 Bacteria 1009
48 Ga0070714_100000072 3300005435 Bacteria 89816
49 Ga0070710_10078922 3300005437 Bacteria 1917
50 Ga0070694_100487238 3300005444 Bacteria 979
51 Ga0070708_100545588 3300005445 Bacteria 1094
52 Ga0070662_100002680 3300005457 Bacteria 10988
53 Ga0070662_100012490 3300005457 Bacteria 5632
54 Ga0070706_100406248 3300005467 Bacteria 1268
55 Ga0070699_100700332 3300005518 Bacteria 925
56 Ga0070697_100555993 3300005536 Bacteria 1006
57 Ga0070695_100507053 3300005545 Bacteria 934
58 Ga0070665_100002261 3300005548 Bacteria 21400
59 Ga0070665_100030515 3300005548 Bacteria 5423
60 Ga0070665_100054024 3300005548 Bacteria 4029
61 Ga0070664_100000024 3300005564 Bacteria 94521
62 Ga0068854_100020041 3300005578 Bacteria 4516
63 Ga0068852_100060968 3300005616 Bacteria 3277
64 Ga0068861_100023529 3300005719 Bacteria 4444
65 Ga0068851_10002000 3300005834 Bacteria 8978
66 Ga0068860_100043262 3300005843 Bacteria 4298
67 Ga0068860_100453757 3300005843 Bacteria 1275
68 Ga0068860_100610101 3300005843 Bacteria 1097
69 Ga0068862_100000128 3300005844 Bacteria 88625
70 Ga0068862_100006036 3300005844 Bacteria 10087
71 Ga0075363_100000283 3300006048 Bacteria 14718
72 Ga0075364_10056524 3300006051 Bacteria 2569
73 Ga0075432_10029860 3300006058 Bacteria 1883
74 Ga0075362_10000278 3300006177 Bacteria 14359
75 Ga0075362_10116254 3300006177 Bacteria 1263
76 Ga0075367_10234399 3300006178 Bacteria 1149
77 Ga0075369_10094377 3300006186 Bacteria 1337
78 Ga0075366_10017040 3300006195 Bacteria 4178
79 Ga0075370_10001412 3300006353 Bacteria 10386
80 Ga0075370_10014247 3300006353 Bacteria 4239
81 Ga0075433_10012272 3300006852 Bacteria 6910
82 Ga0075433_10082094 3300006852 Bacteria 2843
83 Ga0105251_10000076 3300009011 Bacteria 93688
84 Ga0105251_10000420 3300009011 Bacteria 41190
85 Ga0105251_10001881 3300009011 Bacteria 17207
86 Ga0105251_10010020 3300009011 Bacteria 5540
87 Ga0105251_10028675 3300009011 Bacteria 2810
88 Ga0105244_10000907 3300009036 Bacteria 25017
89 Ga0105244_10001009 3300009036 Bacteria 23540
90 Ga0105244_10145468 3300009036 Bacteria 1138
91 Ga0105250_10000015 3300009092 Bacteria 262683
92 Ga0105250_10006837 3300009092 Bacteria 4950
93 Ga0105240_10000141 3300009093 Bacteria 147198
94 Ga0105240_10015290 3300009093 Bacteria 10445
95 Ga0111539_10065809 3300009094 Bacteria 4281
96 Ga0111539_10644405 3300009094 Bacteria 1234
97 Ga0105247_10033750 3300009101 Bacteria 3115
98 Ga0105247_10111877 3300009101 Bacteria 1758
99 Ga0105243_10051722 3300009148 Bacteria 3250
100 Ga0105243_10111985 3300009148 Bacteria 2285
101 Ga0105243_10486395 3300009148 Bacteria 1166
102 Ga0105242_10002506 3300009176 Bacteria 14403
103 Ga0105242_10159571 3300009176 Bacteria 1973
104 Ga0105248_10125379 3300009177 Bacteria 2897
105 Ga0105248_10257944 3300009177 Bacteria 1963
106 Ga0105237_10000042 3300009545 Bacteria 181280
107 Ga0105237_10002445 3300009545 Bacteria 23058
108 Ga0105249_10017944 3300009553 Bacteria 6288
109 Ga0105249_10046317 3300009553 Bacteria 3958
110 Ga0105239_10006568 3300010375 Bacteria 13472
111 Ga0105246_10023447 3300011119 Bacteria 3993
112 Ga0105246_10419588 3300011119 Bacteria 1116
113 Ga0157373_10003996 3300013100 Bacteria 11123
114 Ga0157373_10022870 3300013100 Bacteria 4533
115 Ga0157373_10027919 3300013100 Bacteria 4072
116 Ga0157373_10047486 3300013100 Bacteria 3063
117 Ga0157373_10102589 3300013100 Bacteria 2013
118 Ga0157371_10000660 3300013102 Bacteria 40985
119 Ga0157370_10000993 3300013104 Bacteria 35812
120 Ga0157369_10000627 3300013105 Bacteria 45796
121 Ga0157369_10001667 3300013105 Bacteria 27075
122 Ga0157369_10002926 3300013105 Bacteria 20415
123 Ga0157369_10209007 3300013105 Bacteria 2046
124 Ga0163162_10464230 3300013306 Bacteria 1398
125 Ga0163162_10732009 3300013306 Bacteria 1109
126 Ga0157375_10001088 3300013308 Bacteria 23574
127 Ga0157375_10006607 3300013308 Bacteria 10089
128 Ga0182008_10001810 3300014497 Bacteria 13955
129 Ga0182008_10003925 3300014497 Bacteria 8805
130 Ga0182008_10041473 3300014497 Bacteria 2295
131 Ga0182008_10229654 3300014497 Bacteria 952
132 Ga0182006_1000066 3300015261 Bacteria 151095
133 Ga0182006_1000099 3300015261 Bacteria 98453
134 Ga0182007_10000990 3300015262 Bacteria 15586
135 Ga0182007_10002655 3300015262 Bacteria 8782
136 Ga0182007_10003836 3300015262 Bacteria 6989
137 Ga0182007_10015961 3300015262 Bacteria 2784
138 Ga0182005_1001642 3300015265 Bacteria 8697
139 Ga0182005_1007825 3300015265 Bacteria 3181
140 Ga0182005_1007860 3300015265 Bacteria 3171
141 Ga0163161_10005566 3300017792 Bacteria 8730
142 Ga0163161_10005681 3300017792 Bacteria 8647
143 Ga0163161_10039282 3300017792 Bacteria 3397
144 Ga0163161_10172309 3300017792 Bacteria 1655
145 Ga0209760_100322 3300025207 Bacteria 14684
146 Ga0209784_100026 3300025224 Bacteria 371540
147 Ga0207427_100023 3300025231 Bacteria 439725
148 Ga0209437_100069 3300025233 Bacteria 307733
149 Ga0209437_100644 3300025233 Bacteria 20406
150 Ga0209258_100059 3300025242 Bacteria 324934
151 Ga0209646_1000773 3300025246 Bacteria 11012
152 Ga0209026_1000036 3300025250 Bacteria 296607
153 Ga0209026_1000051 3300025250 Bacteria 250792
154 Ga0209677_100250 3300025253 Bacteria 36632
155 Ga0209148_1000010 3300025254 Bacteria 1265567
156 Ga0209759_1000023 3300025256 Bacteria 321695
157 Ga0209129_1000237 3300025258 Bacteria 60205
158 Ga0209233_1000009 3300025261 Bacteria 1265567
159 Ga0209233_1000169 3300025261 Bacteria 148980
160 Ga0209455_1000020 3300025272 Bacteria 702259
161 Ga0209673_1000161 3300025273 Bacteria 142073
162 Ga0209673_1000554 3300025273 Bacteria 60073
163 Ga0209673_1051635 3300025273 Bacteria 1084
164 Ga0209676_1000105 3300025292 Bacteria 224151
165 Ga0209564_1025098 3300025295 Bacteria 2017
166 Ga0209564_1040728 3300025295 Bacteria 1257
167 Ga0209758_1029952 3300025297 Bacteria 2263
168 Ga0209050_1001141 3300025298 Bacteria 31960
169 Ga0209256_1000286 3300025299 Bacteria 88880
170 Ga0209256_1000292 3300025299 Bacteria 88135
171 Ga0209256_1013108 3300025299 Bacteria 3104
172 Ga0207426_1082057 3300025302 Bacteria 873
173 Ga0209051_1000064 3300025303 Bacteria 231735
174 Ga0209257_1000109 3300025304 Bacteria 239439
175 Ga0207697_10000121 3300025315 Bacteria 37017
176 Ga0207656_10001062 3300025321 Bacteria 8986
177 Ga0207696_1000017 3300025711 Bacteria 491130
178 Ga0207655_1000074 3300025728 Bacteria 232056
179 Ga0207655_1006811 3300025728 Bacteria 7511
180 Ga0207713_1000578 3300025735 Bacteria 36427
181 Ga0207713_1002383 3300025735 Bacteria 13729
182 Ga0207713_1008981 3300025735 Bacteria 5684
183 Ga0207713_1025016 3300025735 Bacteria 2766
184 Ga0207685_10084263 3300025905 Bacteria 1323
185 Ga0207684_10319351 3300025910 Bacteria 1339
186 Ga0207695_10000152 3300025913 Bacteria 206407
187 Ga0207671_10000474 3300025914 Bacteria 54456
188 Ga0207671_10001441 3300025914 Bacteria 27559
189 Ga0207693_10054158 3300025915 Unclassified 3147
190 Ga0207693_10250170 3300025915 Bacteria 1391
191 Ga0207663_10409476 3300025916 Bacteria 1039
192 Ga0207663_10416918 3300025916 Bacteria 1030
193 Ga0207649_10000010 3300025920 Bacteria 284354
194 Ga0207649_10062151 3300025920 Bacteria 2353
195 Ga0207681_10000050 3300025923 Bacteria 118481
196 Ga0207681_10002673 3300025923 Bacteria 11291
197 Ga0207650_10003119 3300025925 Bacteria 11421
198 Ga0207650_10095530 3300025925 Bacteria 2278
199 Ga0207664_10000013 3300025929 Bacteria 260716
200 Ga0207664_10198143 3300025929 Bacteria 1732
201 Ga0207706_10002181 3300025933 Bacteria 19100
202 Ga0207706_10079231 3300025933 Bacteria 2889
203 Ga0207686_10016716 3300025934 Bacteria 4120
204 Ga0207665_10068153 3300025939 Bacteria 2424
205 Ga0207711_10085037 3300025941 Bacteria 2770
206 Ga0207679_10000022 3300025945 Bacteria 219036
207 Ga0207712_10009031 3300025961 Bacteria 6306
208 Ga0207712_10067127 3300025961 Bacteria 2566
209 Ga0207640_10088424 3300025981 Bacteria 2139
210 Ga0207658_10167720 3300025986 Bacteria 1806
211 Ga0207675_100112344 3300026118 Bacteria 2571
212 Ga0207698_10055314 3300026142 Bacteria 3058
213 Ga0209371_1000003 3300027312 Bacteria 1122971
214 Ga0209371_1000088 3300027312 Bacteria 174446
215 Ga0268266_10006471 3300028379 Bacteria 10721
216 Ga0268266_10087653 3300028379 Bacteria 2723
217 Ga0268266_10636381 3300028379 Bacteria 1026
218 Ga0268265_10000102 3300028380 Bacteria 106737
219 Ga0268265_10004439 3300028380 Bacteria 9741
220 Ga0268264_10004795 3300028381 Bacteria 11474
221 Ga0307515_10072663 3300028794 Bacteria 4636
222 Ga0307515_10166097 3300028794 Bacteria 2224
223 Ga0265338_10108043 3300028800 Bacteria 2248
224 Ga0268256_1000004 3300030500 Bacteria 1122967
225 Ga0268256_1000079 3300030500 Bacteria 174445
226 Ga0265770_1040846 3300030878 Bacteria 811
227 Ga0265331_10002302 3300031250 Bacteria 13020
228 Ga0265313_10002917 3300031595 Bacteria 14296
229 Ga0307405_10000271 3300031731 Bacteria 19026
230 Ga0307405_10000471 3300031731 Bacteria 15147
231 Ga0307406_10025530 3300031901 Bacteria 3538
232 Ga0307412_10003698 3300031911 Bacteria 8489
233 Ga0307412_10090730 3300031911 Bacteria 2137
234 Ga0307416_100080802 3300032002 Bacteria 2746
235 Ga0307414_10342399 3300032004 Bacteria 1280
236 Ga0307411_10034826 3300032005 Bacteria 3137
237 Ga0307411_10312526 3300032005 Bacteria 1265
238 Ga0307510_10000048 3300033180 Bacteria 91952
239 Ga0307510_10021885 3300033180 Bacteria 7438
240 Ga0436363_1193321 3300039450 Bacteria 14277
241 Ga0436363_1665054 3300039450 Bacteria 3475
242 Ga0439432_000003 3300042006 Bacteria 117054
243 Ga0466969_0013385 3300044656 Bacteria 4320
244 Ga0451576_0650821 3300045051 Bacteria 1107
245 Ga0495617_000658 3300046452 Bacteria 17368
246 Ga0495617_001633 3300046452 Bacteria 9648
247 Ga0495627_000413 3300046453 Bacteria 37760
248 Ga0495627_001968 3300046453 Bacteria 10626
249 Ga0495627_079786 3300046453 Bacteria 949
250 Ga0495603_0006859 3300046455 Bacteria 6831
251 Ga0495591_000196 3300046458 Bacteria 61706
252 Ga0495591_009916 3300046458 Bacteria 3739
253 Ga0495629_0006857 3300046459 Bacteria 8410
254 Ga0495638_0001006 3300046460 Bacteria 28233
255 Ga0495641_0069127 3300046461 Bacteria 1587
256 Ga0495653_0017328 3300046463 Bacteria 5859
257 Ga0495650_0003213 3300046471 Bacteria 12140
258 Ga0495580_0000405 3300046472 Bacteria 35466
259 Ga0495580_0010158 3300046472 Bacteria 7353
260 Ga0495582_0000667 3300046473 Bacteria 18903
261 Ga0495605_0000025 3300046474 Bacteria 223594
262 Ga0495605_0068200 3300046474 Bacteria 1686
263 Ga0495662_0005991 3300046476 Bacteria 6078
264 Ga0495664_0001735 3300046477 Bacteria 11583
265 Ga0495585_0000002 3300046492 Bacteria 529316
266 Ga0495585_0009815 3300046492 Bacteria 5726
267 Ga0495607_0003234 3300046501 Bacteria 12559
268 Ga0495607_0025991 3300046501 Bacteria 3635
269 Ga0495607_0038589 3300046501 Bacteria 2860
270 Ga0495583_0000086 3300046506 Bacteria 165176
271 Ga0495583_0000118 3300046506 Bacteria 133498
272 Ga0495583_0039260 3300046506 Bacteria 2231
273 Ga0495606_0000489 3300046507 Bacteria 64822
274 Ga0495606_0123919 3300046507 Bacteria 1543
275 Ga0495610_0010069 3300046512 Bacteria 5903
276 Ga0495610_0014683 3300046512 Bacteria 4589
277 Ga0495610_0054553 3300046512 Bacteria 1930
278 Ga0495616_0000745 3300046513 Bacteria 23812
279 Ga0495616_0079256 3300046513 Bacteria 1575
280 Ga0495618_0019387 3300046514 Bacteria 4184
281 Ga0495620_0000005 3300046515 Bacteria 284456
282 Ga0495620_0000151 3300046515 Bacteria 56368
283 Ga0495620_0000299 3300046515 Bacteria 35229
284 Ga0495630_0000722 3300046517 Bacteria 23376
285 Ga0495631_0001863 3300046518 Bacteria 12450
286 Ga0495631_0004223 3300046518 Bacteria 7684
287 Ga0495632_0000003 3300046519 Bacteria 396071
288 Ga0495632_0000199 3300046519 Bacteria 61019
289 Ga0495637_0019191 3300046520 Bacteria 3162
290 Ga0495637_0074093 3300046520 Bacteria 1368
291 Ga0495643_0002758 3300046522 Bacteria 13457
292 Ga0495643_0039149 3300046522 Bacteria 2594
293 Ga0495648_0000027 3300046524 Bacteria 228881
294 Ga0495648_0000858 3300046524 Bacteria 32095
295 Ga0495648_0005971 3300046524 Bacteria 10010
296 Ga0495648_0009638 3300046524 Bacteria 7451
297 Ga0495663_0000101 3300046525 Bacteria 35106
298 Ga0495666_0000844 3300046526 Bacteria 14185
299 Ga0495652_0030127 3300046529 Bacteria 4761
300 Ga0495652_0054975 3300046529 Bacteria 3387
301 Ga0495654_0000117 3300046530 Bacteria 89307
302 Ga0495654_0027189 3300046530 Bacteria 2935
303 Ga0495654_0042361 3300046530 Bacteria 2260
304 Ga0495665_0039693 3300046531 Bacteria 2506
305 Ga0495640_0014801 3300046533 Bacteria 5891
306 Ga0495586_0009421 3300046535 Bacteria 5196
307 Ga0495587_0001191 3300046536 Bacteria 17191
308 Ga0495609_0000347 3300046538 Bacteria 40421
309 Ga0495609_0007229 3300046538 Bacteria 5570
310 Ga0495597_0001247 3300046542 Bacteria 18818
311 Ga0495645_0009232 3300046543 Bacteria 6891
312 Ga0495622_0011803 3300046557 Bacteria 4040
313 Ga0495633_0000013 3300046558 Bacteria 262742
314 Ga0495633_0040263 3300046558 Bacteria 2227
315 Ga0495668_0073791 3300046616 Bacteria 1873
316 Ga0495634_0000661 3300046642 Bacteria 33530
317 Ga0495611_0000583 3300046648 Bacteria 21088
318 Ga0495611_0001476 3300046648 Bacteria 11680
319 Ga0495625_0014362 3300046660 Bacteria 6326
320 Ga0495625_0024437 3300046660 Bacteria 4598
321 Ga0495625_0120592 3300046660 Bacteria 1785
322 Ga0495625_0345208 3300046660 Bacteria 942
323 Ga0495635_0004428 3300046663 Bacteria 9731
324 Ga0495661_0000008 3300046665 Bacteria 317971
325 Ga0495661_0000043 3300046665 Bacteria 149067
326 Ga0495661_0006285 3300046665 Bacteria 8356
327 Ga0495661_0058784 3300046665 Bacteria 2290
328 Ga0495588_0000921 3300046674 Bacteria 12803
329 Ga0495599_0028532 3300046678 Bacteria 3499
330 Ga0495623_0020521 3300046679 Bacteria 4270
331 Ga0495646_0000880 3300046680 Bacteria 17085
332 Ga0495646_0165793 3300046680 Bacteria 1220
333 Ga0495658_0080827 3300046683 Bacteria 1907
334 Ga0495613_0006601 3300046689 Bacteria 8672
335 Ga0495613_0008092 3300046689 Bacteria 7817
336 Ga0495624_0011513 3300046690 Bacteria 6080
337 Ga0495670_0000129 3300046691 Bacteria 32692
338 Ga0495670_0057402 3300046691 Bacteria 1954
339 Ga0495671_0000401 3300046692 Bacteria 35219
340 Ga0495671_0009173 3300046692 Bacteria 5536
341 Ga0495649_0001081 3300046694 Bacteria 21261
342 Ga0495649_0007511 3300046694 Bacteria 6633
343 Ga0495589_0000373 3300046794 Bacteria 34295
344 Ga0495589_0001151 3300046794 Bacteria 15726
345 Ga0495589_0028663 3300046794 Bacteria 2809
346 Ga0495600_0237587 3300046809 Bacteria 1162
347 Ga0495660_0000052 3300046810 Bacteria 137821
348 Ga0495660_0000088 3300046810 Bacteria 98970
349 Ga0495660_0001557 3300046810 Bacteria 15422
350 Ga0495660_0002786 3300046810 Bacteria 11015
351 Ga0495660_0003211 3300046810 Bacteria 10155
352 Ga0495660_0015112 3300046810 Bacteria 4464
353 Ga0495581_0004478 3300047315 Bacteria 8077
354 Ga0495604_0005494 3300047317 Bacteria 10052
355 Ga0495674_0024059 3300047319 Bacteria 5603
356 Ga0495676_0000397 3300047321 Bacteria 35189
357 Ga0495676_0003111 3300047321 Bacteria 15010
358 Ga0495680_0003526 3300047322 Bacteria 15341
359 Ga0495683_0000002 3300047323 Bacteria 638279
360 Ga0495687_000478 3300047443 Bacteria 48491
361 Ga0495675_0024025 3300047444 Bacteria 3883
362 Ga0495679_000034 3300047446 Bacteria 164878
363 Ga0495679_000866 3300047446 Bacteria 19121
364 Ga0495679_003522 3300047446 Bacteria 7484
365 Ga0495673_0000036 3300047469 Bacteria 311035
366 Ga0495673_0045819 3300047469 Bacteria 1941
367 Ga0495681_0000722 3300047470 Bacteria 25319
368 Ga0495681_0007966 3300047470 Bacteria 6691
369 Ga0495681_0019692 3300047470 Bacteria 3675
370 Ga0495681_0071998 3300047470 Bacteria 1564
371 Ga0495686_0001164 3300047472 Bacteria 30807
372 Ga0495686_0008280 3300047472 Bacteria 7653
373 Ga0495593_0002387 3300047673 Bacteria 11288
374 Ga0495602_0017057 3300048088 Bacteria 7285
375 Ga0495602_0069071 3300048088 Bacteria 3031
376 Ga0495614_0003427 3300048089 Bacteria 7095
377 Ga0496101_0021062 3300048904 Bacteria 4475
378 Ga0496101_0089873 3300048904 Bacteria 2283
379 Ga0496102_0006182 3300048905 Bacteria 10208
380 Ga0496102_0273076 3300048905 Unclassified 1594
381 Ga0496103_0002289 3300048906 Bacteria 12103
382 Ga0496104_0023463 3300048907 Bacteria 5672
383 Ga0496104_0071683 3300048907 Bacteria 3294
384 Ga0496105_0006178 3300048908 Bacteria 9186
385 Ga0496106_0001032 3300048909 Bacteria 20508
386 Ga0496110_0527980 3300048913 Bacteria 1073
387 Ga0496111_0000302 3300048914 Bacteria 24160
388 Ga0496112_0386670 3300048915 Bacteria 1340
389 Ga0496113_0017173 3300048916 Bacteria 5018
390 Ga0496113_0062064 3300048916 Bacteria 2822
391 Ga0496115_0301217 3300048918 Unclassified 1314
392 Ga0496116_0000216 3300048919 Bacteria 108542
393 Ga0496116_0003027 3300048919 Bacteria 17024
394 Ga0496116_0003234 3300048919 Bacteria 16222
395 Ga0496116_0033365 3300048919 Bacteria 3654
396 Ga0496116_0041481 3300048919 Bacteria 3157
397 Ga0496116_0059044 3300048919 Bacteria 2497
398 Ga0496117_0000033 3300048920 Bacteria 345605
399 Ga0496117_0000205 3300048920 Bacteria 116761
400 Ga0496117_0003402 3300048920 Bacteria 18519
401 Ga0496117_0003432 3300048920 Bacteria 18430
402 Ga0496117_0006036 3300048920 Bacteria 12444
403 Ga0496117_0007740 3300048920 Bacteria 10382
404 Ga0496118_0002026 3300048921 Bacteria 28649
405 Ga0496118_0002067 3300048921 Bacteria 28277
406 Ga0496118_0003826 3300048921 Bacteria 18519
407 Ga0496118_0006907 3300048921 Bacteria 12283
408 Ga0496118_0017760 3300048921 Bacteria 6457
409 Ga0496118_0057850 3300048921 Bacteria 2902
410 Ga0496119_0001141 3300048922 Bacteria 33321
411 Ga0496119_0002270 3300048922 Bacteria 21377
412 Ga0496119_0004289 3300048922 Bacteria 14257
413 Ga0496119_0005149 3300048922 Bacteria 12656
414 Ga0496119_0005872 3300048922 Bacteria 11585
415 Ga0496119_0012547 3300048922 Bacteria 6868
416 Ga0496120_0000557 3300048923 Bacteria 56887
417 Ga0496120_0001053 3300048923 Bacteria 36536
418 Ga0496120_0002086 3300048923 Bacteria 21428
419 Ga0496120_0003426 3300048923 Bacteria 14493
420 Ga0496120_0003727 3300048923 Bacteria 13539
421 Ga0496120_0022332 3300048923 Bacteria 3982
422 Ga0496121_0000166 3300048924 Bacteria 145051
423 Ga0496121_0000566 3300048924 Bacteria 69717
424 Ga0496121_0000782 3300048924 Bacteria 58365
425 Ga0496121_0001665 3300048924 Bacteria 36652
426 Ga0496121_0029565 3300048924 Bacteria 5062
427 Ga0496121_0327790 3300048924 Bacteria 1028
428 Ga0496122_0000365 3300048925 Bacteria 97184
429 Ga0496122_0001082 3300048925 Bacteria 47312
430 Ga0496122_0001575 3300048925 Bacteria 35879
431 Ga0496122_0001796 3300048925 Bacteria 32863
432 Ga0496122_0003182 3300048925 Bacteria 21893
433 Ga0496122_0011028 3300048925 Bacteria 9230
434 Ga0496122_0013035 3300048925 Bacteria 8188
435 Ga0496122_0015388 3300048925 Bacteria 7316
436 Ga0496122_0029229 3300048925 Bacteria 4654
437 Ga0496122_0044169 3300048925 Bacteria 3481
438 Ga0496122_0061762 3300048925 Bacteria 2748
439 Ga0496123_0000298 3300048926 Bacteria 97184
440 Ga0496123_0001260 3300048926 Bacteria 36421
441 Ga0496123_0005440 3300048926 Bacteria 12823
442 Ga0496123_0006246 3300048926 Bacteria 11617
443 Ga0496123_0010959 3300048926 Bacteria 7930
444 Ga0496123_0016463 3300048926 Bacteria 6002
445 Ga0496123_0026504 3300048926 Bacteria 4339
446 Ga0496123_0045184 3300048926 Bacteria 3003
447 Ga0496123_0072323 3300048926 Bacteria 2146
448 Ga0496123_0167287 3300048926 Bacteria 1164
449 Ga0496123_0250862 3300048926 Bacteria 873
450 Ga0496124_0000023 3300048927 Bacteria 415226
451 Ga0496124_0000602 3300048927 Bacteria 60543
452 Ga0496124_0001445 3300048927 Bacteria 35092
453 Ga0496124_0006590 3300048927 Bacteria 12609
454 Ga0496124_0008191 3300048927 Bacteria 10963
455 Ga0496124_0026446 3300048927 Bacteria 5231
456 Ga0496124_0060592 3300048927 Bacteria 3174
457 Ga0496124_0220519 3300048927 Bacteria 1426
458 Ga0496124_0250201 3300048927 Bacteria 1311
459 Ga0496125_0000304 3300048928 Bacteria 96693
460 Ga0496125_0001914 3300048928 Bacteria 28499
461 Ga0496125_0003618 3300048928 Bacteria 18557
462 Ga0496125_0006887 3300048928 Bacteria 12167
463 Ga0496125_0013308 3300048928 Bacteria 8093
464 Ga0496125_0023286 3300048928 Bacteria 5720
465 Ga0496125_0051600 3300048928 Bacteria 3390
466 Ga0496126_0002098 3300048929 Bacteria 27910
467 Ga0496126_0054498 3300048929 Bacteria 3622
468 Ga0496126_0059990 3300048929 Bacteria 3423
469 Ga0496126_0101364 3300048929 Bacteria 2518
470 Ga0496126_0133926 3300048929 Bacteria 2139
471 Ga0496126_0435549 3300048929 Bacteria 1058
472 Ga0495678_000005 3300049459 Bacteria 522958
473 Ga0495678_000635 3300049459 Bacteria 32497
474 Ga0495682_0000331 3300049460 Bacteria 35194
475 nmdc:mga03683_5099_c1 3300050489 Bacteria 4409
476 nmdc:mga03n38_168_c1 3300050490 Bacteria 14571
477 nmdc:mga00v17_24_c1 3300050491 Bacteria 102283
478 nmdc:mga0yw44_10256_c1 3300050492 Bacteria 4778
479 nmdc:mga0k408_39617_c1 3300050493 Bacteria 2709
480 nmdc:mga07m45_3054_c1 3300050496 Bacteria 7993
481 nmdc:mga07m45_519_c1 3300050496 Bacteria 16356
482 nmdc:mga05p37_168917_c1 3300050507 Bacteria 2668
483 nmdc:mga0n895_149123_c1 3300050512 Bacteria 2368
484 nmdc:mga0a205_16049_c1 3300050515 Bacteria 7010
485 nmdc:mga0a205_94717_c1 3300050515 Bacteria 2885
486 nmdc:mga0sz30_365_c1 3300050516 Bacteria 17255
487 Ga0500578_0001023 3300053086 Bacteria 30718
488 Ga0500644_0040592 3300053088 Bacteria 1541
489 Ga0500583_0001248 3300053092 Bacteria 7266
490 Ga0500555_001689 3300053103 Bacteria 6643
491 Ga0500556_0000005 3300053104 Bacteria 581135
492 Ga0500595_002887 3300053119 Bacteria 8234
493 Ga0500597_002098 3300053120 Bacteria 5398
494 Ga0500608_000602 3300053122 Bacteria 13251
495 Ga0500618_000100 3300053125 Bacteria 70229
496 Ga0500618_000858 3300053125 Bacteria 16336
497 Ga0500618_002158 3300053125 Bacteria 7726
498 Ga0500618_003100 3300053125 Bacteria 5873
499 Ga0500559_0048970 3300053136 Bacteria 1860
500 Ga0500561_0000214 3300053137 Bacteria 10545
501 Ga0500564_015525 3300053138 Bacteria 3440
502 Ga0500574_000079 3300053141 Bacteria 10936
503 Ga0500619_030319 3300053154 Bacteria 1642
504 Ga0500622_0000174 3300053156 Bacteria 69403
505 Ga0500624_000211 3300053157 Bacteria 22021
506 Ga0500638_000107 3300053162 Bacteria 15788
507 Ga0500636_0005443 3300053177 Bacteria 7264
508 Ga0500567_061510 3300053723 Bacteria 1680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_168917_c1 nmdc:mga05p37_168917_c1_377_1123 218
2 3300005353 Ga0070669_100000048 Ga0070669_10000004865 229
3 3300005719 Ga0068861_100023529 Ga0068861_1000235296 229
4 3300005843 Ga0068860_100043262 Ga0068860_1000432624 229
5 3300005844 Ga0068862_100000128 Ga0068862_10000012866 229
6 3300009553 Ga0105249_10017944 Ga0105249_100179441 229
7 3300025315 Ga0207697_10000121 Ga0207697_100001213 229
8 3300025923 Ga0207681_10000050 Ga0207681_1000005065 229
9 3300025961 Ga0207712_10009031 Ga0207712_100090317 229
10 3300026118 Ga0207675_100112344 Ga0207675_1001123443 229
11 3300028380 Ga0268265_10000102 Ga0268265_1000010248 229
12 3300028381 Ga0268264_10004795 Ga0268264_100047959 229
13 3300005344 Ga0070661_100015493 Ga0070661_1000154934 234
14 3300009101 Ga0105247_10033750 Ga0105247_100337502 234
15 3300015261 Ga0182006_1000066 Ga0182006_100006653 234
16 3300015262 Ga0182007_10003836 Ga0182007_100038364 234
17 3300015265 Ga0182005_1001642 Ga0182005_10016427 234
18 3300025920 Ga0207649_10062151 Ga0207649_100621512 234
19 3300046616 Ga0495668_0073791 Ga0495668_0073791_222_977 234
20 3300046810 Ga0495660_0000052 Ga0495660_0000052_71797_72552 234
21 3300047469 Ga0495673_0000036 Ga0495673_0000036_117473_118228 234
22 3300048909 Ga0496106_0001032 Ga0496106_0001032_5770_6525 234
23 3300048924 Ga0496121_0000782 Ga0496121_0000782_39245_40000 234
24 3300048929 Ga0496126_0435549 Ga0496126_0435549_282_1037 234
25 iso_pu_bacteria 2929195423 2929196660 235
26 3300046691 Ga0495670_0057402 Ga0495670_0057402_1014_1730 237
27 3300005367 Ga0070667_100606245 Ga0070667_1006062451 239
28 3300005548 Ga0070665_100030515 Ga0070665_1000305156 239
29 3300005578 Ga0068854_100020041 Ga0068854_1000200412 239
30 3300005616 Ga0068852_100060968 Ga0068852_1000609682 239
31 3300009093 Ga0105240_10000141 Ga0105240_10000141114 239
32 3300009545 Ga0105237_10002445 Ga0105237_100024454 239
33 3300010375 Ga0105239_10006568 Ga0105239_100065684 239
34 3300013104 Ga0157370_10000993 Ga0157370_1000099320 239
35 3300013105 Ga0157369_10209007 Ga0157369_102090072 239
36 3300014497 Ga0182008_10041473 Ga0182008_100414732 239
37 3300015262 Ga0182007_10002655 Ga0182007_100026556 239
38 3300015265 Ga0182005_1007860 Ga0182005_10078602 239
39 3300025253 Ga0209677_100250 Ga0209677_10025026 239
40 3300025261 Ga0209233_1000169 Ga0209233_1000169134 239
41 3300025913 Ga0207695_10000152 Ga0207695_1000015220 239
42 3300025914 Ga0207671_10001441 Ga0207671_100014417 239
43 3300025981 Ga0207640_10088424 Ga0207640_100884242 239
44 3300026142 Ga0207698_10055314 Ga0207698_100553144 239
45 3300048905 Ga0496102_0006182 Ga0496102_0006182_8857_9612 239
46 3300048906 Ga0496103_0002289 Ga0496103_0002289_4822_5577 239
47 3300048916 Ga0496113_0017173 Ga0496113_0017173_936_1691 239
48 3300048919 Ga0496116_0003234 Ga0496116_0003234_5477_6232 239
49 3300048920 Ga0496117_0003402 Ga0496117_0003402_10605_11360 239
50 3300048921 Ga0496118_0003826 Ga0496118_0003826_10605_11360 239
51 3300048922 Ga0496119_0002270 Ga0496119_0002270_6276_7031 239
52 3300048923 Ga0496120_0003426 Ga0496120_0003426_6707_7462 239
53 3300048924 Ga0496121_0000566 Ga0496121_0000566_48488_49243 239
54 3300048925 Ga0496122_0015388 Ga0496122_0015388_2647_3402 239
55 3300048926 Ga0496123_0010959 Ga0496123_0010959_3311_4066 239
56 3300048927 Ga0496124_0006590 Ga0496124_0006590_10805_11560 239
57 3300048928 Ga0496125_0003618 Ga0496125_0003618_10409_11164 239
58 3300048929 Ga0496126_0059990 Ga0496126_0059990_1675_2430 239
59 iso_pu_bacteria 2899845264 2899846108 239
60 3300003775 Ga0055524_1000446 Ga0055524_10004467 241
61 3300025295 Ga0209564_1025098 Ga0209564_10250982 241
62 3300025299 Ga0209256_1000286 Ga0209256_100028680 241
63 3300031731 Ga0307405_10000471 Ga0307405_100004712 241
64 3300031901 Ga0307406_10025530 Ga0307406_100255304 241
65 3300031911 Ga0307412_10003698 Ga0307412_100036989 241
66 3300033180 Ga0307510_10021885 Ga0307510_100218858 241
67 3300046452 Ga0495617_000658 Ga0495617_000658_2424_3224 241
68 3300046452 Ga0495617_001633 Ga0495617_001633_4379_5134 241
69 3300046460 Ga0495638_0001006 Ga0495638_0001006_810_1565 241
70 3300046474 Ga0495605_0068200 Ga0495605_0068200_741_1496 241
71 3300046492 Ga0495585_0000002 Ga0495585_0000002_207313_208113 241
72 3300046492 Ga0495585_0009815 Ga0495585_0009815_3711_4466 241
73 3300046506 Ga0495583_0039260 Ga0495583_0039260_605_1360 241
74 3300046512 Ga0495610_0054553 Ga0495610_0054553_873_1628 241
75 3300046513 Ga0495616_0000745 Ga0495616_0000745_4374_5174 241
76 3300046513 Ga0495616_0079256 Ga0495616_0079256_809_1564 241
77 3300046515 Ga0495620_0000299 Ga0495620_0000299_29268_30023 241
78 3300046522 Ga0495643_0002758 Ga0495643_0002758_12402_13157 241
79 3300046522 Ga0495643_0039149 Ga0495643_0039149_1725_2480 241
80 3300046524 Ga0495648_0000027 Ga0495648_0000027_207315_208115 241
81 3300046524 Ga0495648_0009638 Ga0495648_0009638_5203_5958 241
82 3300046525 Ga0495663_0000101 Ga0495663_0000101_29234_29989 241
83 3300046557 Ga0495622_0011803 Ga0495622_0011803_436_1191 241
84 3300046558 Ga0495633_0040263 Ga0495633_0040263_719_1519 241
85 3300046648 Ga0495611_0000583 Ga0495611_0000583_15149_15904 241
86 3300046660 Ga0495625_0024437 Ga0495625_0024437_947_1702 241
87 3300046665 Ga0495661_0058784 Ga0495661_0058784_645_1400 241
88 3300046674 Ga0495588_0000921 Ga0495588_0000921_6852_7607 241
89 3300046680 Ga0495646_0165793 Ga0495646_0165793_143_898 241
90 3300046683 Ga0495658_0080827 Ga0495658_0080827_65_820 241
91 3300046689 Ga0495613_0006601 Ga0495613_0006601_5108_5863 241
92 3300046691 Ga0495670_0000129 Ga0495670_0000129_2861_3616 241
93 3300046692 Ga0495671_0000401 Ga0495671_0000401_5197_5952 241
94 3300046694 Ga0495649_0007511 Ga0495649_0007511_5214_5969 241
95 3300046794 Ga0495589_0028663 Ga0495589_0028663_536_1291 241
96 3300046810 Ga0495660_0015112 Ga0495660_0015112_2911_3666 241
97 3300047443 Ga0495687_000478 Ga0495687_000478_5202_5957 241
98 3300047470 Ga0495681_0000722 Ga0495681_0000722_19377_20132 241
99 3300047472 Ga0495686_0001164 Ga0495686_0001164_810_1565 241
100 3300048904 Ga0496101_0021062 Ga0496101_0021062_841_1596 241
101 3300048904 Ga0496101_0089873 Ga0496101_0089873_1001_1756 241
102 3300048913 Ga0496110_0527980 Ga0496110_0527980_274_1029 241
103 3300048914 Ga0496111_0000302 Ga0496111_0000302_8102_8857 241
104 3300048919 Ga0496116_0000216 Ga0496116_0000216_71144_71899 241
105 3300048920 Ga0496117_0007740 Ga0496117_0007740_1263_2018 241
106 3300048921 Ga0496118_0002026 Ga0496118_0002026_5326_6081 241
107 3300048925 Ga0496122_0001796 Ga0496122_0001796_22188_22943 241
108 3300048925 Ga0496122_0003182 Ga0496122_0003182_13076_13831 241
109 3300048925 Ga0496122_0029229 Ga0496122_0029229_15_770 241
110 3300048925 Ga0496122_0061762 Ga0496122_0061762_1262_2017 241
111 3300048926 Ga0496123_0005440 Ga0496123_0005440_8676_9431 241
112 3300048926 Ga0496123_0045184 Ga0496123_0045184_1938_2693 241
113 3300048926 Ga0496123_0072323 Ga0496123_0072323_393_1148 241
114 3300048926 Ga0496123_0167287 Ga0496123_0167287_296_1051 241
115 3300048927 Ga0496124_0000023 Ga0496124_0000023_370751_371506 241
116 3300048927 Ga0496124_0250201 Ga0496124_0250201_539_1294 241
117 3300048928 Ga0496125_0023286 Ga0496125_0023286_3071_3826 241
118 3300048928 Ga0496125_0051600 Ga0496125_0051600_1472_2227 241
119 3300049459 Ga0495678_000635 Ga0495678_000635_26652_27407 241
120 3300049460 Ga0495682_0000331 Ga0495682_0000331_29241_29996 241
121 3300053086 Ga0500578_0001023 Ga0500578_0001023_29182_29937 241
122 3300053088 Ga0500644_0040592 Ga0500644_0040592_196_951 241
123 3300053092 Ga0500583_0001248 Ga0500583_0001248_5079_5834 241
124 3300053103 Ga0500555_001689 Ga0500555_001689_4896_5651 241
125 3300053120 Ga0500597_002098 Ga0500597_002098_2376_3131 241
126 3300053122 Ga0500608_000602 Ga0500608_000602_7412_8167 241
127 3300053125 Ga0500618_000858 Ga0500618_000858_1378_2133 241
128 3300053125 Ga0500618_002158 Ga0500618_002158_1892_2647 241
129 3300053136 Ga0500559_0048970 Ga0500559_0048970_811_1566 241
130 3300053138 Ga0500564_015525 Ga0500564_015525_1867_2622 241
131 3300053141 Ga0500574_000079 Ga0500574_000079_5092_5847 241
132 3300053154 Ga0500619_030319 Ga0500619_030319_144_899 241
133 3300053156 Ga0500622_0000174 Ga0500622_0000174_4238_4993 241
134 3300053157 Ga0500624_000211 Ga0500624_000211_16090_16845 241
135 3300053162 Ga0500638_000107 Ga0500638_000107_5072_5827 241
136 3300053177 Ga0500636_0005443 Ga0500636_0005443_5066_5821 241
137 3300053723 Ga0500567_061510 Ga0500567_061510_374_1129 241
138 3300003323 rootH1_10269096 rootH1_102690962 242
139 3300003856 Ga0058692_1001483 Ga0058692_10014833 242
140 3300005435 Ga0070714_100000072 Ga0070714_10000007259 242
141 3300005548 Ga0070665_100054024 Ga0070665_1000540244 242
142 3300006048 Ga0075363_100000283 Ga0075363_1000002833 242
143 3300006051 Ga0075364_10056524 Ga0075364_100565242 242
144 3300006177 Ga0075362_10000278 Ga0075362_1000027814 242
145 3300006186 Ga0075369_10094377 Ga0075369_100943771 242
146 3300006195 Ga0075366_10017040 Ga0075366_100170405 242
147 3300006353 Ga0075370_10001412 Ga0075370_100014122 242
148 3300009148 Ga0105243_10111985 Ga0105243_101119852 242
149 3300013100 Ga0157373_10003996 Ga0157373_100039963 242
150 3300013102 Ga0157371_10000660 Ga0157371_1000066027 242
151 3300025929 Ga0207664_10000013 Ga0207664_1000001371 242
152 3300027312 Ga0209371_1000003 Ga0209371_1000003387 242
153 3300030500 Ga0268256_1000004 Ga0268256_1000004664 242
154 3300048916 Ga0496113_0062064 Ga0496113_0062064_571_1326 242
155 3300048919 Ga0496116_0041481 Ga0496116_0041481_1832_2587 242
156 3300048920 Ga0496117_0000033 Ga0496117_0000033_62696_63451 242
157 3300048921 Ga0496118_0017760 Ga0496118_0017760_4206_4961 242
158 3300048922 Ga0496119_0004289 Ga0496119_0004289_12912_13667 242
159 3300048923 Ga0496120_0001053 Ga0496120_0001053_17961_18716 242
160 3300048925 Ga0496122_0000365 Ga0496122_0000365_17961_18716 242
161 3300048926 Ga0496123_0000298 Ga0496123_0000298_78469_79224 242
162 3300048927 Ga0496124_0060592 Ga0496124_0060592_924_1679 242
163 3300048927 Ga0496124_0220519 Ga0496124_0220519_114_869 242
164 3300048929 Ga0496126_0101364 Ga0496126_0101364_1720_2475 242
165 3300050489 nmdc:mga03683_5099_c1 nmdc:mga03683_5099_c1_1636_2391 242
166 3300050490 nmdc:mga03n38_168_c1 nmdc:mga03n38_168_c1_11990_12745 242
167 3300050491 nmdc:mga00v17_24_c1 nmdc:mga00v17_24_c1_55774_56529 242
168 3300050492 nmdc:mga0yw44_10256_c1 nmdc:mga0yw44_10256_c1_545_1300 242
169 3300050493 nmdc:mga0k408_39617_c1 nmdc:mga0k408_39617_c1_1812_2567 242
170 3300050496 nmdc:mga07m45_3054_c1 nmdc:mga07m45_3054_c1_6452_7207 242
171 3300050516 nmdc:mga0sz30_365_c1 nmdc:mga0sz30_365_c1_13266_14021 242
172 3300053137 Ga0500561_0000214 Ga0500561_0000214_2515_3270 242
173 3300005843 Ga0068860_100453757 Ga0068860_1004537572 243
174 3300025297 Ga0209758_1029952 Ga0209758_10299524 243
175 3300025299 Ga0209256_1013108 Ga0209256_10131082 243
176 iso_pu_bacteria 2585428059 2587744682 243
177 iso_pu_bacteria 2857472729 2857478896 243
178 iso_pu_bacteria 2857558681 2857561285 243
179 3300028794 Ga0307515_10072663 Ga0307515_100726633 245
180 3300030878 Ga0265770_1040846 Ga0265770_10408461 245
181 iso_pu_bacteria 2534681796 2535518669 245
182 iso_pu_bacteria 2554235003 2554249648 245
183 iso_pu_bacteria 2582581294 2585202619 245
184 iso_pu_bacteria 2582581304 2585255853 245
185 iso_pu_bacteria 2582581307 2585275195 245
186 iso_pu_bacteria 2582581308 2585282990 245
187 iso_pu_bacteria 2582581316 2585331979 245
188 iso_pu_bacteria 2585427527 2585532762 245
189 iso_pu_bacteria 2585427530 2585553873 245
190 iso_pu_bacteria 2585427531 2585561091 245
191 iso_pu_bacteria 2585427594 2585847644 245
192 iso_pu_bacteria 2585427609 2585908317 245
193 iso_pu_bacteria 2585428125 2587983648 245
194 iso_pu_bacteria 2599185167 2599398318 245
195 iso_pu_bacteria 2599185179 2599450340 245
196 iso_pu_bacteria 2599185188 2599500799 245
197 iso_pu_bacteria 2599185190 2599512822 245
198 iso_pu_bacteria 2599185191 2599521287 245
199 iso_pu_bacteria 2599185288 2599881350 245
200 iso_pu_bacteria 2599185290 2599891499 245
201 iso_pu_bacteria 2599185300 2599932465 245
202 iso_pu_bacteria 2599185303 2599946630 245
203 iso_pu_bacteria 2600255279 2601611964 245
204 iso_pu_bacteria 2600255308 2601748668 245
205 iso_pu_bacteria 2615840626 2616309699 245
206 iso_pu_bacteria 2643221599 2644003939 245
207 iso_pu_bacteria 2643221610 2644064512 245
208 iso_pu_bacteria 2643221653 2644298365 245
209 iso_pu_bacteria 2643221675 2644419607 245
210 iso_pu_bacteria 2643221680 2644452964 245
211 iso_pu_bacteria 2643221693 2644519905 245
212 iso_pu_bacteria 2643221719 2644656594 245
213 iso_pu_bacteria 2643221726 2644691955 245
214 iso_pu_bacteria 2738541293 2738803091 245
215 iso_pu_bacteria 2738541294 2738806867 245
216 iso_pu_bacteria 2738541309 2738894227 245
217 iso_pu_bacteria 2808606384 2808973442 245
218 iso_pu_bacteria 2808606390 2809008167 245
219 iso_pu_bacteria 2808606391 2809015105 245
220 iso_pu_bacteria 2818991438 2819555303 245
221 iso_pu_bacteria 2818991439 2819557585 245
222 iso_pu_bacteria 2818991453 2819642679 245
223 iso_pu_bacteria 2821443989 2821446381 245
224 iso_pu_bacteria 2834028612 2834034014 245
225 iso_pu_bacteria 2852684882 2852686794 245
226 iso_pu_bacteria 2919130084 2919134010 245
227 iso_pu_bacteria 2926760298 2926765412 245
228 iso_pu_bacteria 2931390751 2931394015 245
229 iso_pu_bacteria 2945961074 2945963450 245
230 iso_pu_bacteria 2979089926 2979095335 245
231 iso_pu_bacteria 2979095461 2979097589 245
232 iso_pu_bacteria 2979100975 2979102627 245
233 iso_pu_bacteria 2984509177 2984509489 245
234 iso_pu_bacteria 2984518228 2984519813 245
235 iso_pu_bacteria 2984537506 2984537822 245
236 iso_pu_bacteria 2984601300 2984604565 245
237 iso_pu_bacteria 3003930520 3003935183 245
238 iso_pu_bacteria 8005542996 8005549556 245
239 iso_pu_bacteria 8054285046 8054287730 245
240 iso_pu_bacteria 8054460903 8054462360 245
241 iso_pu_bacteria 8055817908 8055821096 245
242 3300028794 Ga0307515_10166097 Ga0307515_101660971 246
243 3300005331 Ga0070670_100082237 Ga0070670_1000822372 247
244 3300005367 Ga0070667_100541824 Ga0070667_1005418241 247
245 3300005545 Ga0070695_100507053 Ga0070695_1005070531 247
246 3300005843 Ga0068860_100610101 Ga0068860_1006101012 247
247 3300009101 Ga0105247_10111877 Ga0105247_101118772 247
248 3300009177 Ga0105248_10125379 Ga0105248_101253792 247
249 3300025233 Ga0209437_100644 Ga0209437_1006447 247
250 3300025941 Ga0207711_10085037 Ga0207711_100850372 247
251 3300025986 Ga0207658_10167720 Ga0207658_101677202 247
252 3300028800 Ga0265338_10108043 Ga0265338_101080433 247
253 3300039450 Ga0436363_1193321 Ga0436363_1193321_3519_4295 247
254 3300039450 Ga0436363_1665054 Ga0436363_1665054_2632_3408 247
255 3300044656 Ga0466969_0013385 Ga0466969_0013385_3048_3824 247
256 3300046472 Ga0495580_0010158 Ga0495580_0010158_1301_2053 247
257 3300047321 Ga0495676_0000397 Ga0495676_0000397_31107_32054 247
258 3300048925 Ga0496122_0001082 Ga0496122_0001082_14522_15271 247
259 3300048926 Ga0496123_0006246 Ga0496123_0006246_8518_9267 247
260 3300002737 JGI25162J39368_1000018 JGI25162J39368_1000018105 248
261 3300002741 JGI25157J39369_1000011 JGI25157J39369_100001182 248
262 3300002741 JGI25157J39369_1000835 JGI25157J39369_10008355 248
263 3300002771 JGI25163J39215_1000107 JGI25163J39215_100010735 248
264 3300002772 JGI25164J39214_1000007 JGI25164J39214_1000007105 248
265 3300002773 JGI25152J39213_1001043 JGI25152J39213_10010436 248
266 3300003214 JGI25165J46597_1000029 JGI25165J46597_1000029183 248
267 3300003320 rootH2_10046723 rootH2_1004672316 248
268 3300003751 Ga0055538_1000557 Ga0055538_10005577 248
269 3300003761 Ga0055535_1000025 Ga0055535_100002586 248
270 3300003762 Ga0055542_1000024 Ga0055542_1000024105 248
271 3300003763 Ga0055529_1000029 Ga0055529_1000029105 248
272 3300003775 Ga0055524_1000926 Ga0055524_100092617 248
273 3300003790 Ga0055528_1000039 Ga0055528_1000039116 248
274 3300003790 Ga0055528_1001470 Ga0055528_10014707 248
275 3300003790 Ga0055528_1001847 Ga0055528_100184719 248
276 3300003790 Ga0055528_1034247 Ga0055528_10342472 248
277 3300003792 Ga0055540_1000054 Ga0055540_1000054138 248
278 3300003794 Ga0055531_10000037 Ga0055531_100000372 248
279 3300005262 Ga0065165_1004458 Ga0065165_10044581 248
280 3300005262 Ga0065165_1064499 Ga0065165_10644991 248
281 3300005288 Ga0065714_10135124 Ga0065714_101351242 248
282 3300005347 Ga0070668_100233546 Ga0070668_1002335461 248
283 3300005437 Ga0070710_10078922 Ga0070710_100789224 248
284 3300005444 Ga0070694_100487238 Ga0070694_1004872381 248
285 3300005445 Ga0070708_100545588 Ga0070708_1005455882 248
286 3300005457 Ga0070662_100012490 Ga0070662_1000124902 248
287 3300005467 Ga0070706_100406248 Ga0070706_1004062482 248
288 3300005518 Ga0070699_100700332 Ga0070699_1007003321 248
289 3300005536 Ga0070697_100555993 Ga0070697_1005559931 248
290 3300005548 Ga0070665_100002261 Ga0070665_1000022618 248
291 3300005844 Ga0068862_100006036 Ga0068862_1000060363 248
292 3300006058 Ga0075432_10029860 Ga0075432_100298603 248
293 3300006177 Ga0075362_10116254 Ga0075362_101162542 248
294 3300006178 Ga0075367_10234399 Ga0075367_102343992 248
295 3300006353 Ga0075370_10014247 Ga0075370_100142473 248
296 3300006852 Ga0075433_10012272 Ga0075433_100122725 248
297 3300006852 Ga0075433_10082094 Ga0075433_100820943 248
298 3300009036 Ga0105244_10145468 Ga0105244_101454682 248
299 3300009093 Ga0105240_10015290 Ga0105240_100152905 248
300 3300009094 Ga0111539_10065809 Ga0111539_100658092 248
301 3300009094 Ga0111539_10644405 Ga0111539_106444052 248
302 3300009148 Ga0105243_10486395 Ga0105243_104863952 248
303 3300009176 Ga0105242_10159571 Ga0105242_101595712 248
304 3300009177 Ga0105248_10257944 Ga0105248_102579442 248
305 3300009553 Ga0105249_10046317 Ga0105249_100463173 248
306 3300011119 Ga0105246_10419588 Ga0105246_104195882 248
307 3300013306 Ga0163162_10464230 Ga0163162_104642302 248
308 3300014497 Ga0182008_10229654 Ga0182008_102296542 248
309 3300015262 Ga0182007_10015961 Ga0182007_100159612 248
310 3300017792 Ga0163161_10039282 Ga0163161_100392823 248
311 3300017792 Ga0163161_10172309 Ga0163161_101723091 248
312 3300025207 Ga0209760_100322 Ga0209760_1003226 248
313 3300025224 Ga0209784_100026 Ga0209784_10002695 248
314 3300025231 Ga0207427_100023 Ga0207427_10002395 248
315 3300025233 Ga0209437_100069 Ga0209437_100069167 248
316 3300025242 Ga0209258_100059 Ga0209258_10005995 248
317 3300025246 Ga0209646_1000773 Ga0209646_10007736 248
318 3300025250 Ga0209026_1000036 Ga0209026_1000036158 248
319 3300025250 Ga0209026_1000051 Ga0209026_1000051238 248
320 3300025254 Ga0209148_1000010 Ga0209148_100001094 248
321 3300025256 Ga0209759_1000023 Ga0209759_100002379 248
322 3300025258 Ga0209129_1000237 Ga0209129_100023718 248
323 3300025261 Ga0209233_1000009 Ga0209233_10000091077 248
324 3300025272 Ga0209455_1000020 Ga0209455_1000020509 248
325 3300025273 Ga0209673_1000161 Ga0209673_1000161136 248
326 3300025273 Ga0209673_1000554 Ga0209673_100055458 248
327 3300025273 Ga0209673_1051635 Ga0209673_10516351 248
328 3300025292 Ga0209676_1000105 Ga0209676_100010581 248
329 3300025295 Ga0209564_1040728 Ga0209564_10407282 248
330 3300025298 Ga0209050_1001141 Ga0209050_100114117 248
331 3300025299 Ga0209256_1000292 Ga0209256_100029252 248
332 3300025302 Ga0207426_1082057 Ga0207426_10820571 248
333 3300025303 Ga0209051_1000064 Ga0209051_1000064140 248
334 3300025304 Ga0209257_1000109 Ga0209257_1000109140 248
335 3300025905 Ga0207685_10084263 Ga0207685_100842631 248
336 3300025910 Ga0207684_10319351 Ga0207684_103193512 248
337 3300025915 Ga0207693_10054158 Ga0207693_100541583 248
338 3300025915 Ga0207693_10250170 Ga0207693_102501702 248
339 3300025916 Ga0207663_10409476 Ga0207663_104094762 248
340 3300025916 Ga0207663_10416918 Ga0207663_104169182 248
341 3300025929 Ga0207664_10198143 Ga0207664_101981432 248
342 3300025933 Ga0207706_10079231 Ga0207706_100792312 248
343 3300025939 Ga0207665_10068153 Ga0207665_100681532 248
344 3300025961 Ga0207712_10067127 Ga0207712_100671272 248
345 3300028379 Ga0268266_10006471 Ga0268266_100064714 248
346 3300028379 Ga0268266_10087653 Ga0268266_100876533 248
347 3300028380 Ga0268265_10004439 Ga0268265_100044397 248
348 3300031250 Ga0265331_10002302 Ga0265331_1000230214 248
349 3300031595 Ga0265313_10002917 Ga0265313_100029174 248
350 3300032002 Ga0307416_100080802 Ga0307416_1000808023 248
351 3300032004 Ga0307414_10342399 Ga0307414_103423991 248
352 3300032005 Ga0307411_10034826 Ga0307411_100348263 248
353 3300032005 Ga0307411_10312526 Ga0307411_103125262 248
354 3300033180 Ga0307510_10000048 Ga0307510_1000004848 248
355 3300045051 Ga0451576_0650821 Ga0451576_0650821_211_966 248
356 3300046455 Ga0495603_0006859 Ga0495603_0006859_4187_4942 248
357 3300046459 Ga0495629_0006857 Ga0495629_0006857_3544_4299 248
358 3300046461 Ga0495641_0069127 Ga0495641_0069127_64_819 248
359 3300046463 Ga0495653_0017328 Ga0495653_0017328_3735_4490 248
360 3300046472 Ga0495580_0000405 Ga0495580_0000405_29891_30646 248
361 3300046473 Ga0495582_0000667 Ga0495582_0000667_10711_11466 248
362 3300046476 Ga0495662_0005991 Ga0495662_0005991_2169_2924 248
363 3300046477 Ga0495664_0001735 Ga0495664_0001735_4723_5478 248
364 3300046501 Ga0495607_0003234 Ga0495607_0003234_7924_8685 248
365 3300046501 Ga0495607_0038589 Ga0495607_0038589_2091_2846 248
366 3300046507 Ga0495606_0123919 Ga0495606_0123919_250_1005 248
367 3300046514 Ga0495618_0019387 Ga0495618_0019387_802_1557 248
368 3300046517 Ga0495630_0000722 Ga0495630_0000722_5699_6454 248
369 3300046519 Ga0495632_0000003 Ga0495632_0000003_77575_78321 248
370 3300046524 Ga0495648_0005971 Ga0495648_0005971_8158_8913 248
371 3300046526 Ga0495666_0000844 Ga0495666_0000844_3607_4362 248
372 3300046529 Ga0495652_0030127 Ga0495652_0030127_1226_1981 248
373 3300046529 Ga0495652_0054975 Ga0495652_0054975_1537_2292 248
374 3300046531 Ga0495665_0039693 Ga0495665_0039693_1226_1981 248
375 3300046533 Ga0495640_0014801 Ga0495640_0014801_4436_5191 248
376 3300046535 Ga0495586_0009421 Ga0495586_0009421_734_1489 248
377 3300046536 Ga0495587_0001191 Ga0495587_0001191_10605_11360 248
378 3300046538 Ga0495609_0007229 Ga0495609_0007229_1019_1774 248
379 3300046543 Ga0495645_0009232 Ga0495645_0009232_1750_2505 248
380 3300046642 Ga0495634_0000661 Ga0495634_0000661_4278_5033 248
381 3300046660 Ga0495625_0014362 Ga0495625_0014362_229_1005 248
382 3300046660 Ga0495625_0345208 Ga0495625_0345208_91_840 248
383 3300046663 Ga0495635_0004428 Ga0495635_0004428_299_1054 248
384 3300046665 Ga0495661_0006285 Ga0495661_0006285_2226_2981 248
385 3300046678 Ga0495599_0028532 Ga0495599_0028532_1104_1859 248
386 3300046679 Ga0495623_0020521 Ga0495623_0020521_2733_3488 248
387 3300046680 Ga0495646_0000880 Ga0495646_0000880_11789_12544 248
388 3300046689 Ga0495613_0008092 Ga0495613_0008092_4659_5414 248
389 3300046690 Ga0495624_0011513 Ga0495624_0011513_939_1694 248
390 3300046809 Ga0495600_0237587 Ga0495600_0237587_174_929 248
391 3300046810 Ga0495660_0001557 Ga0495660_0001557_4212_4967 248
392 3300047315 Ga0495581_0004478 Ga0495581_0004478_2963_3718 248
393 3300047317 Ga0495604_0005494 Ga0495604_0005494_4743_5498 248
394 3300047319 Ga0495674_0024059 Ga0495674_0024059_1242_1997 248
395 3300047321 Ga0495676_0003111 Ga0495676_0003111_9648_10403 248
396 3300047322 Ga0495680_0003526 Ga0495680_0003526_10852_11607 248
397 3300047444 Ga0495675_0024025 Ga0495675_0024025_1635_2390 248
398 3300047446 Ga0495679_003522 Ga0495679_003522_5504_6259 248
399 3300047472 Ga0495686_0008280 Ga0495686_0008280_2973_3728 248
400 3300047673 Ga0495593_0002387 Ga0495593_0002387_7444_8199 248
401 3300048088 Ga0495602_0017057 Ga0495602_0017057_5162_5917 248
402 3300048088 Ga0495602_0069071 Ga0495602_0069071_1960_2715 248
403 3300048089 Ga0495614_0003427 Ga0495614_0003427_3735_4490 248
404 3300048905 Ga0496102_0273076 Ga0496102_0273076_329_1081 248
405 3300048907 Ga0496104_0023463 Ga0496104_0023463_2426_3181 248
406 3300048907 Ga0496104_0071683 Ga0496104_0071683_54_809 248
407 3300048908 Ga0496105_0006178 Ga0496105_0006178_3863_4618 248
408 3300048915 Ga0496112_0386670 Ga0496112_0386670_455_1207 248
409 3300048918 Ga0496115_0301217 Ga0496115_0301217_87_842 248
410 3300048919 Ga0496116_0003027 Ga0496116_0003027_5132_5899 248
411 3300048919 Ga0496116_0033365 Ga0496116_0033365_133_900 248
412 3300048919 Ga0496116_0059044 Ga0496116_0059044_260_1015 248
413 3300048922 Ga0496119_0005872 Ga0496119_0005872_1111_1866 248
414 3300048924 Ga0496121_0000166 Ga0496121_0000166_64994_65770 248
415 3300048924 Ga0496121_0327790 Ga0496121_0327790_208_963 248
416 3300048927 Ga0496124_0008191 Ga0496124_0008191_3910_4665 248
417 3300048929 Ga0496126_0133926 Ga0496126_0133926_1252_2007 248
418 3300050496 nmdc:mga07m45_519_c1 nmdc:mga07m45_519_c1_4986_5741 248
419 3300050512 nmdc:mga0n895_149123_c1 nmdc:mga0n895_149123_c1_723_1478 248
420 3300050515 nmdc:mga0a205_16049_c1 nmdc:mga0a205_16049_c1_4524_5279 248
421 3300050515 nmdc:mga0a205_94717_c1 nmdc:mga0a205_94717_c1_1100_1855 248
422 3300053104 Ga0500556_0000005 Ga0500556_0000005_141272_142021 248
423 3300053119 Ga0500595_002887 Ga0500595_002887_5656_6411 248
424 3300053125 Ga0500618_000100 Ga0500618_000100_21712_22467 248
425 iso_pu_bacteria 2977942078 2977947348 248
426 2162886007 SwRhRL2b_contig_2275730 SwRhRL2b_0424.00005120 249
427 2162886007 SwRhRL2b_contig_843216 SwRhRL2b_0189.00002210 249
428 3300003322 rootL2_10154963 rootL2_101549634 249
429 3300003856 Ga0058692_1000033 Ga0058692_100003349 249
430 3300005288 Ga0065714_10065183 Ga0065714_100651837 249
431 3300005288 Ga0065714_10066890 Ga0065714_100668906 249
432 3300005289 Ga0065704_10001230 Ga0065704_100012301 249
433 3300005289 Ga0065704_10004875 Ga0065704_100048751 249
434 3300005289 Ga0065704_10071710 Ga0065704_100717109 249
435 3300005289 Ga0065704_10103753 Ga0065704_101037532 249
436 3300005290 Ga0065712_10069134 Ga0065712_100691344 249
437 3300005331 Ga0070670_100003014 Ga0070670_1000030145 249
438 3300005331 Ga0070670_100177919 Ga0070670_1001779193 249
439 3300005344 Ga0070661_100000024 Ga0070661_10000002473 249
440 3300005353 Ga0070669_100001022 Ga0070669_1000010227 249
441 3300005353 Ga0070669_100135309 Ga0070669_1001353092 249
442 3300005457 Ga0070662_100002680 Ga0070662_10000268010 249
443 3300005564 Ga0070664_100000024 Ga0070664_10000002467 249
444 3300005834 Ga0068851_10002000 Ga0068851_100020009 249
445 3300009011 Ga0105251_10000076 Ga0105251_1000007677 249
446 3300009011 Ga0105251_10000420 Ga0105251_1000042011 249
447 3300009011 Ga0105251_10001881 Ga0105251_1000188113 249
448 3300009011 Ga0105251_10010020 Ga0105251_100100206 249
449 3300009011 Ga0105251_10028675 Ga0105251_100286752 249
450 3300009036 Ga0105244_10000907 Ga0105244_100009073 249
451 3300009036 Ga0105244_10001009 Ga0105244_100010094 249
452 3300009092 Ga0105250_10000015 Ga0105250_10000015178 249
453 3300009092 Ga0105250_10006837 Ga0105250_100068372 249
454 3300009148 Ga0105243_10051722 Ga0105243_100517224 249
455 3300009176 Ga0105242_10002506 Ga0105242_1000250612 249
456 3300009545 Ga0105237_10000042 Ga0105237_10000042109 249
457 3300011119 Ga0105246_10023447 Ga0105246_100234474 249
458 3300013100 Ga0157373_10022870 Ga0157373_100228703 249
459 3300013100 Ga0157373_10027919 Ga0157373_100279194 249
460 3300013100 Ga0157373_10047486 Ga0157373_100474861 249
461 3300013100 Ga0157373_10102589 Ga0157373_101025892 249
462 3300013105 Ga0157369_10000627 Ga0157369_1000062729 249
463 3300013105 Ga0157369_10001667 Ga0157369_1000166713 249
464 3300013105 Ga0157369_10002926 Ga0157369_1000292611 249
465 3300013306 Ga0163162_10732009 Ga0163162_107320092 249
466 3300013308 Ga0157375_10001088 Ga0157375_1000108824 249
467 3300013308 Ga0157375_10006607 Ga0157375_100066079 249
468 3300014497 Ga0182008_10001810 Ga0182008_1000181010 249
469 3300014497 Ga0182008_10003925 Ga0182008_100039256 249
470 3300015261 Ga0182006_1000099 Ga0182006_100009910 249
471 3300015262 Ga0182007_10000990 Ga0182007_100009908 249
472 3300015265 Ga0182005_1007825 Ga0182005_10078253 249
473 3300017792 Ga0163161_10005566 Ga0163161_100055667 249
474 3300017792 Ga0163161_10005681 Ga0163161_1000568110 249
475 3300025321 Ga0207656_10001062 Ga0207656_100010623 249
476 3300025711 Ga0207696_1000017 Ga0207696_1000017139 249
477 3300025728 Ga0207655_1000074 Ga0207655_100007424 249
478 3300025728 Ga0207655_1006811 Ga0207655_10068113 249
479 3300025735 Ga0207713_1000578 Ga0207713_10005781 249
480 3300025735 Ga0207713_1002383 Ga0207713_100238313 249
481 3300025735 Ga0207713_1008981 Ga0207713_10089816 249
482 3300025735 Ga0207713_1025016 Ga0207713_10250163 249
483 3300025914 Ga0207671_10000474 Ga0207671_1000047429 249
484 3300025920 Ga0207649_10000010 Ga0207649_10000010212 249
485 3300025923 Ga0207681_10002673 Ga0207681_100026733 249
486 3300025925 Ga0207650_10003119 Ga0207650_100031196 249
487 3300025925 Ga0207650_10095530 Ga0207650_100955303 249
488 3300025933 Ga0207706_10002181 Ga0207706_100021813 249
489 3300025934 Ga0207686_10016716 Ga0207686_100167161 249
490 3300025945 Ga0207679_10000022 Ga0207679_10000022128 249
491 3300027312 Ga0209371_1000088 Ga0209371_100008887 249
492 3300028379 Ga0268266_10636381 Ga0268266_106363811 249
493 3300030500 Ga0268256_1000079 Ga0268256_100007950 249
494 3300031731 Ga0307405_10000271 Ga0307405_100002713 249
495 3300031911 Ga0307412_10090730 Ga0307412_100907303 249
496 3300042006 Ga0439432_000003 Ga0439432_000003_107370_108119 249
497 3300046453 Ga0495627_000413 Ga0495627_000413_15511_16260 249
498 3300046453 Ga0495627_001968 Ga0495627_001968_8276_9025 249
499 3300046453 Ga0495627_079786 Ga0495627_079786_121_870 249
500 3300046458 Ga0495591_000196 Ga0495591_000196_20659_21408 249
501 3300046458 Ga0495591_009916 Ga0495591_009916_620_1369 249
502 3300046471 Ga0495650_0003213 Ga0495650_0003213_5948_6697 249
503 3300046474 Ga0495605_0000025 Ga0495605_0000025_29867_30616 249
504 3300046501 Ga0495607_0025991 Ga0495607_0025991_613_1362 249
505 3300046506 Ga0495583_0000086 Ga0495583_0000086_153184_153933 249
506 3300046506 Ga0495583_0000118 Ga0495583_0000118_41667_42416 249
507 3300046507 Ga0495606_0000489 Ga0495606_0000489_50278_51027 249
508 3300046512 Ga0495610_0010069 Ga0495610_0010069_982_1731 249
509 3300046512 Ga0495610_0014683 Ga0495610_0014683_1651_2400 249
510 3300046515 Ga0495620_0000005 Ga0495620_0000005_70461_71210 249
511 3300046515 Ga0495620_0000151 Ga0495620_0000151_33201_33950 249
512 3300046518 Ga0495631_0001863 Ga0495631_0001863_1025_1774 249
513 3300046518 Ga0495631_0004223 Ga0495631_0004223_5925_6674 249
514 3300046519 Ga0495632_0000199 Ga0495632_0000199_40304_41053 249
515 3300046520 Ga0495637_0019191 Ga0495637_0019191_496_1245 249
516 3300046520 Ga0495637_0074093 Ga0495637_0074093_140_889 249
517 3300046524 Ga0495648_0000858 Ga0495648_0000858_15741_16490 249
518 3300046530 Ga0495654_0000117 Ga0495654_0000117_77528_78277 249
519 3300046530 Ga0495654_0027189 Ga0495654_0027189_943_1692 249
520 3300046530 Ga0495654_0042361 Ga0495654_0042361_247_996 249
521 3300046538 Ga0495609_0000347 Ga0495609_0000347_35047_35796 249
522 3300046542 Ga0495597_0001247 Ga0495597_0001247_4653_5402 249
523 3300046558 Ga0495633_0000013 Ga0495633_0000013_196138_196887 249
524 3300046648 Ga0495611_0001476 Ga0495611_0001476_3136_3885 249
525 3300046660 Ga0495625_0120592 Ga0495625_0120592_986_1735 249
526 3300046665 Ga0495661_0000008 Ga0495661_0000008_223585_224334 249
527 3300046665 Ga0495661_0000043 Ga0495661_0000043_126817_127566 249
528 3300046692 Ga0495671_0009173 Ga0495671_0009173_1972_2721 249
529 3300046694 Ga0495649_0001081 Ga0495649_0001081_15130_15879 249
530 3300046794 Ga0495589_0000373 Ga0495589_0000373_32958_33707 249
531 3300046794 Ga0495589_0001151 Ga0495589_0001151_6908_7657 249
532 3300046810 Ga0495660_0000088 Ga0495660_0000088_72503_73282 249
533 3300046810 Ga0495660_0002786 Ga0495660_0002786_2468_3217 249
534 3300046810 Ga0495660_0003211 Ga0495660_0003211_9275_10024 249
535 3300047323 Ga0495683_0000002 Ga0495683_0000002_419396_420145 249
536 3300047446 Ga0495679_000034 Ga0495679_000034_27285_28034 249
537 3300047446 Ga0495679_000866 Ga0495679_000866_7181_7930 249
538 3300047469 Ga0495673_0045819 Ga0495673_0045819_186_935 249
539 3300047470 Ga0495681_0007966 Ga0495681_0007966_272_1021 249
540 3300047470 Ga0495681_0019692 Ga0495681_0019692_604_1353 249
541 3300047470 Ga0495681_0071998 Ga0495681_0071998_519_1268 249
542 3300048920 Ga0496117_0000205 Ga0496117_0000205_15247_15996 249
543 3300048920 Ga0496117_0003432 Ga0496117_0003432_4194_4943 249
544 3300048920 Ga0496117_0006036 Ga0496117_0006036_4194_4943 249
545 3300048921 Ga0496118_0002067 Ga0496118_0002067_26354_27103 249
546 3300048921 Ga0496118_0006907 Ga0496118_0006907_1173_1922 249
547 3300048921 Ga0496118_0057850 Ga0496118_0057850_381_1130 249
548 3300048922 Ga0496119_0001141 Ga0496119_0001141_948_1697 249
549 3300048922 Ga0496119_0005149 Ga0496119_0005149_7515_8264 249
550 3300048922 Ga0496119_0012547 Ga0496119_0012547_388_1137 249
551 3300048923 Ga0496120_0000557 Ga0496120_0000557_31622_32371 249
552 3300048923 Ga0496120_0002086 Ga0496120_0002086_18254_19003 249
553 3300048923 Ga0496120_0003727 Ga0496120_0003727_4386_5135 249
554 3300048923 Ga0496120_0022332 Ga0496120_0022332_1145_1894 249
555 3300048924 Ga0496121_0001665 Ga0496121_0001665_29408_30157 249
556 3300048924 Ga0496121_0029565 Ga0496121_0029565_2995_3744 249
557 3300048925 Ga0496122_0001575 Ga0496122_0001575_870_1619 249
558 3300048925 Ga0496122_0011028 Ga0496122_0011028_1144_1893 249
559 3300048925 Ga0496122_0013035 Ga0496122_0013035_4286_5035 249
560 3300048925 Ga0496122_0044169 Ga0496122_0044169_2457_3206 249
561 3300048926 Ga0496123_0001260 Ga0496123_0001260_1157_1906 249
562 3300048926 Ga0496123_0016463 Ga0496123_0016463_3778_4527 249
563 3300048926 Ga0496123_0026504 Ga0496123_0026504_1653_2402 249
564 3300048926 Ga0496123_0250862 Ga0496123_0250862_15_764 249
565 3300048927 Ga0496124_0000602 Ga0496124_0000602_32479_33228 249
566 3300048927 Ga0496124_0001445 Ga0496124_0001445_5884_6633 249
567 3300048927 Ga0496124_0026446 Ga0496124_0026446_3980_4729 249
568 3300048928 Ga0496125_0000304 Ga0496125_0000304_68695_69444 249
569 3300048928 Ga0496125_0001914 Ga0496125_0001914_1594_2343 249
570 3300048928 Ga0496125_0006887 Ga0496125_0006887_3542_4291 249
571 3300048928 Ga0496125_0013308 Ga0496125_0013308_5253_6086 249
572 3300048929 Ga0496126_0002098 Ga0496126_0002098_10325_11074 249
573 3300048929 Ga0496126_0054498 Ga0496126_0054498_800_1549 249
574 3300049459 Ga0495678_000005 Ga0495678_000005_210085_210834 249
575 3300053125 Ga0500618_003100 Ga0500618_003100_2333_3082 249
576 iso_pu_bacteria 2818991457 2819660918 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

43

232

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

49

284

0.93

PF08659

KR

KR domain

44

215

0.89

PF23441

36

285

0.79

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

45

228

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9891 1 249
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9885 1 249
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9868 1 249
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9864 1 249
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9849 1 249
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9752 3 249 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9657 2 181 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 3 249 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 4 157 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 3 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1H3MJT4-F1-model_v4 deleted 0.9955 1 249
AF-A0A7X2MLV7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9936 1 162 GO:0016491
AF-A0A1H3MJT4-F1-model_v4 deleted 0.9915 1 249
AF-E2XRY9-F1-model_v4 deleted 0.9914 32 249
AF-A0A2V9WAZ8-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9914 1 139 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.42 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map