F465573

General Info

Members Datasets Scaffolds Average Seq Length
576 299 518 400

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939631187|2939634047
Length 470
Sequence AESMQILTVLRAANCARFGILNMPGFTLIPGFLRFTLFPHLFYAWVPTRGRLPYFLSGLSMTAKSAAIGVPDLSSAPPATEKSSGFLLPIVGGAAFAHLLNDLIQAMLPSIYPLLKDNFSLSFSQIGILAMVYQVTASLLQPWIGLYTDKHPKPFLLPSGMGMTFIGIILLATAGSFYMLLVAAAVIGVGSATFHPEASRIARLASGGRFGTAQSTFQVGGNTGSAIGPLLAAAIIIPYGQKAAAWFTVVAGVAIVVLYHLTIWVKHNGQAKAKSLARSHSEGLARSKVVQAVTVICILMFAKFVYIASFTNYFTFYLIQHFSLSVQQSQLFLFMFLASVAAGTFAGGPVGDRIGRKAVIWISFLGVAPFALALPYANLFWTGALSIIIGLIMSSAFAALVVYAQEAVPGRVGLVSGLMFGLMFGIGGIGAAGLGELADKYGIVWVYGVTSFLPLLGLATAFLPNTRKKI

Samples

Sample ID Description Type Environment
1 2511231024 Pseudomonas sp. GM84 Isolate Nodule
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
6 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
7 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
8 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
9 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
10 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
11 2643221645 Massilia sp. Root351 Isolate Unclassified
12 2643221664 Massilia sp. Root418 Isolate Unclassified
13 2671180694 Paenibacillus sp. A3 Isolate Unclassified
14 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
15 2721755523 Delftia sp. HK171 Isolate Unclassified
16 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
17 2738541280 Massilia sp. GV090 Isolate Unclassified
18 2738541297 Duganella sp. GV083 Isolate Unclassified
19 2738541300 Massilia sp. GV016 Isolate Unclassified
20 2738541357 Duganella sp. GV053 Isolate Unclassified
21 2738543003 Duganella sp. GV066 Isolate Unclassified
22 2738543018 Massilia sp. GV045 Isolate Unclassified
23 2738543026 Duganella sp. GV089 Isolate Unclassified
24 2738543029 Duganella sp. GV039 Isolate Unclassified
25 2738543030 Massilia sp. GV097 Isolate Unclassified
26 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
27 2765235841 Pseudomonas putida AA7 Isolate Unclassified
28 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
29 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
30 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
31 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
32 2842711865 Duganella sp. R-73148 Isolate Unclassified
33 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
34 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
35 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
36 2857553236 Duganella sp. R-74557 Isolate Unclassified
37 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
38 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
39 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
40 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
41 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
42 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
43 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
44 2919513703 Luteimonas sp. 3794 Isolate Unclassified
45 2919675420 Luteimonas terrae 4099 Isolate Unclassified
46 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
47 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
48 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
49 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
50 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
51 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
52 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
53 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
54 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
55 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
56 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
57 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
58 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
70 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
73 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
170 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
190 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
191 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
250 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
297 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
298 8052494512 Pseudomonas putida LD6 Isolate Unclassified
299 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.93
Metatranscriptomes 0
Isolates 10.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 8.68
Nodule 1.39
Rhizoplane 2.6
Rhizosphere 70.49
Stem 0
Stem Tuber 0
Unclassified 16.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1013011 3300001904 Bacteria 1345
2 JGI25154J39366_1001065 3300002738 Bacteria 10834
3 JGI25159J45721_1001688 3300002987 Bacteria 8942
4 rootL2_10103549 3300003322 Bacteria 4946
5 Ga0055526_1000973 3300003771 Bacteria 21094
6 Ga0055537_1000440 3300003773 Bacteria 26604
7 Ga0055536_1000444 3300003781 Bacteria 29058
8 Ga0055536_1000543 3300003781 Bacteria 25842
9 Ga0055536_1011470 3300003781 Bacteria 3395
10 Ga0055536_1025964 3300003781 Bacteria 1655
11 Ga0055528_1000860 3300003790 Bacteria 20583
12 Ga0055530_10000021 3300003791 Bacteria 139383
13 Ga0055530_10000323 3300003791 Bacteria 43172
14 Ga0055531_10001266 3300003794 Bacteria 19128
15 Ga0055531_10002303 3300003794 Bacteria 12902
16 Ga0055531_10003871 3300003794 Bacteria 9366
17 Ga0055531_10014955 3300003794 Bacteria 3458
18 Ga0058692_1000014 3300003856 Bacteria 313984
19 Ga0058692_1007691 3300003856 Bacteria 2839
20 Ga0065165_1000005 3300005262 Bacteria 370361
21 Ga0065165_1003002 3300005262 Bacteria 12769
22 Ga0065703_1000120 3300005272 Bacteria 47864
23 Ga0065704_10006065 3300005289 Bacteria 2673
24 Ga0070658_10085130 3300005327 Bacteria 2600
25 Ga0070683_100056176 3300005329 Bacteria 3655
26 Ga0070670_100009223 3300005331 Bacteria 8431
27 Ga0070666_10001416 3300005335 Bacteria 14517
28 Ga0070666_10013299 3300005335 Bacteria 5218
29 Ga0070668_100052987 3300005347 Bacteria 3129
30 Ga0070711_100047669 3300005439 Bacteria 2927
31 Ga0070663_100024233 3300005455 Bacteria 4081
32 Ga0070662_100002992 3300005457 Bacteria 10507
33 Ga0068867_100058751 3300005459 Bacteria 2850
34 Ga0068867_100287819 3300005459 Bacteria 1350
35 Ga0070685_10001399 3300005466 Bacteria 12653
36 Ga0068853_100068815 3300005539 Bacteria 3078
37 Ga0070693_100015318 3300005547 Bacteria 3945
38 Ga0070665_100002074 3300005548 Bacteria 22481
39 Ga0070665_100123098 3300005548 Bacteria 2596
40 Ga0070665_100180444 3300005548 Bacteria 2112
41 Ga0068855_100219355 3300005563 Bacteria 2133
42 Ga0068854_100001668 3300005578 Bacteria 13516
43 Ga0068856_100163854 3300005614 Bacteria 2234
44 Ga0068852_100021482 3300005616 Bacteria 5155
45 Ga0068852_100294492 3300005616 Bacteria 1569
46 Ga0068859_100105454 3300005617 Bacteria 2878
47 Ga0068864_100170091 3300005618 Bacteria 1986
48 Ga0068851_10007699 3300005834 Bacteria 4953
49 Ga0068858_100011561 3300005842 Bacteria 8328
50 Ga0068860_100006646 3300005843 Bacteria 11615
51 Ga0075365_10033667 3300006038 Bacteria 3304
52 Ga0075364_10008169 3300006051 Bacteria 6246
53 Ga0075364_10010115 3300006051 Bacteria 5689
54 Ga0075364_10063113 3300006051 Bacteria 2432
55 Ga0075362_10003784 3300006177 Bacteria 5356
56 Ga0097621_100098237 3300006237 Bacteria 2459
57 Ga0068871_100120401 3300006358 Bacteria 2216
58 Ga0068865_100052282 3300006881 Bacteria 2831
59 Ga0099823_1000097 3300006944 Bacteria 42542
60 Ga0079104_1000167 3300006946 Bacteria 93750
61 Ga0079104_1010157 3300006946 Bacteria 3125
62 Ga0105251_10027421 3300009011 Bacteria 2888
63 Ga0105244_10000377 3300009036 Bacteria 41493
64 Ga0105244_10045369 3300009036 Bacteria 2261
65 Ga0105244_10102552 3300009036 Bacteria 1398
66 Ga0105250_10000700 3300009092 Bacteria 20825
67 Ga0105250_10009178 3300009092 Bacteria 4173
68 Ga0105240_10001002 3300009093 Bacteria 50418
69 Ga0105240_10010295 3300009093 Bacteria 13164
70 Ga0105240_10155309 3300009093 Bacteria 2722
71 Ga0105240_10255603 3300009093 Bacteria 2024
72 Ga0105247_10000502 3300009101 Bacteria 32176
73 Ga0105243_10000163 3300009148 Bacteria 75904
74 Ga0105243_10009598 3300009148 Bacteria 7368
75 Ga0105241_10010307 3300009174 Bacteria 6861
76 Ga0105242_10006291 3300009176 Bacteria 9148
77 Ga0105242_10107905 3300009176 Bacteria 2369
78 Ga0105248_10071149 3300009177 Bacteria 3907
79 Ga0105248_10402198 3300009177 Bacteria 1542
80 Ga0105237_10078783 3300009545 Bacteria 3285
81 Ga0105237_10142936 3300009545 Bacteria 2387
82 Ga0105238_10027161 3300009551 Bacteria 5833
83 Ga0105238_10030988 3300009551 Bacteria 5444
84 Ga0105249_10012965 3300009553 Bacteria 7356
85 Ga0105239_10051630 3300010375 Bacteria 4507
86 Ga0157371_10000022 3300013102 Bacteria 295029
87 Ga0157371_10037745 3300013102 Bacteria 3457
88 Ga0157370_10005813 3300013104 Bacteria 13785
89 Ga0157369_10000653 3300013105 Bacteria 44847
90 Ga0163162_10025637 3300013306 Bacteria 5828
91 Ga0163162_10035513 3300013306 Bacteria 4965
92 Ga0163162_10062232 3300013306 Bacteria 3772
93 Ga0157372_10123800 3300013307 Bacteria 2972
94 Ga0157375_10000107 3300013308 Bacteria 81910
95 Ga0163163_10003683 3300014325 Bacteria 13047
96 Ga0182008_10000013 3300014497 Bacteria 286492
97 Ga0182008_10000390 3300014497 Bacteria 34042
98 Ga0182008_10010135 3300014497 Bacteria 5052
99 Ga0157376_10016081 3300014969 Bacteria 5671
100 Ga0157376_10066806 3300014969 Bacteria 3040
101 Ga0157376_10139449 3300014969 Bacteria 2173
102 Ga0182006_1000026 3300015261 Bacteria 253543
103 Ga0182006_1000097 3300015261 Bacteria 102186
104 Ga0182006_1005529 3300015261 Bacteria 6002
105 Ga0182007_10000004 3300015262 Bacteria 485875
106 Ga0182007_10000095 3300015262 Bacteria 63829
107 Ga0182005_1000007 3300015265 Bacteria 490994
108 Ga0182005_1000038 3300015265 Bacteria 160030
109 Ga0163161_10001217 3300017792 Bacteria 19401
110 Ga0163161_10006939 3300017792 Bacteria 7830
111 Ga0163161_10016788 3300017792 Bacteria 5118
112 Ga0163161_10026647 3300017792 Bacteria 4095
113 Ga0213872_10029947 3300021361 Bacteria 2496
114 Ga0209646_1000010 3300025246 Bacteria 573803
115 Ga0209233_1000759 3300025261 Bacteria 14553
116 Ga0209565_1000024 3300025263 Bacteria 379907
117 Ga0209673_1000413 3300025273 Bacteria 75089
118 Ga0209130_1000046 3300025284 Bacteria 236658
119 Ga0209675_1000039 3300025291 Bacteria 247966
120 Ga0209676_1000011 3300025292 Bacteria 860463
121 Ga0209676_1000650 3300025292 Bacteria 49825
122 Ga0209676_1000655 3300025292 Bacteria 49591
123 Ga0209676_1000724 3300025292 Bacteria 45433
124 Ga0209676_1012468 3300025292 Bacteria 3336
125 Ga0209564_1000068 3300025295 Bacteria 311171
126 Ga0209564_1000411 3300025295 Bacteria 75939
127 Ga0209050_1000032 3300025298 Bacteria 456335
128 Ga0209050_1000069 3300025298 Bacteria 297615
129 Ga0209050_1006468 3300025298 Bacteria 6925
130 Ga0209256_1006758 3300025299 Bacteria 5934
131 Ga0209257_1000014 3300025304 Bacteria 946850
132 Ga0209257_1000858 3300025304 Bacteria 43308
133 Ga0209257_1003880 3300025304 Bacteria 12204
134 Ga0209257_1007359 3300025304 Bacteria 6673
135 Ga0207696_1001811 3300025711 Bacteria 11015
136 Ga0207696_1002185 3300025711 Bacteria 9800
137 Ga0207696_1002705 3300025711 Bacteria 8482
138 Ga0207655_1000646 3300025728 Bacteria 41672
139 Ga0207655_1000822 3300025728 Bacteria 33630
140 Ga0207655_1001110 3300025728 Bacteria 26288
141 Ga0207713_1002154 3300025735 Bacteria 14631
142 Ga0207713_1008819 3300025735 Bacteria 5748
143 Ga0207713_1023376 3300025735 Bacteria 2910
144 Ga0207710_10000009 3300025900 Bacteria 485205
145 Ga0207680_10145788 3300025903 Bacteria 1574
146 Ga0207647_10000269 3300025904 Bacteria 42790
147 Ga0207654_10023484 3300025911 Bacteria 3304
148 Ga0207695_10000040 3300025913 Bacteria 452787
149 Ga0207695_10004908 3300025913 Bacteria 18021
150 Ga0207695_10006253 3300025913 Bacteria 15503
151 Ga0207695_10021399 3300025913 Bacteria 7377
152 Ga0207695_10054758 3300025913 Bacteria 4162
153 Ga0207671_10006578 3300025914 Bacteria 10322
154 Ga0207671_10042268 3300025914 Bacteria 3374
155 Ga0207671_10081813 3300025914 Bacteria 2422
156 Ga0207649_10071702 3300025920 Bacteria 2213
157 Ga0207681_10001205 3300025923 Bacteria 16638
158 Ga0207694_10006754 3300025924 Bacteria 8714
159 Ga0207694_10016455 3300025924 Bacteria 5584
160 Ga0207694_10296854 3300025924 Bacteria 1330
161 Ga0207650_10248764 3300025925 Bacteria 1439
162 Ga0207706_10003257 3300025933 Bacteria 15550
163 Ga0207709_10000001 3300025935 Bacteria 2228154
164 Ga0207709_10000143 3300025935 Bacteria 99457
165 Ga0207711_10080412 3300025941 Bacteria 2846
166 Ga0207689_10251638 3300025942 Bacteria 1461
167 Ga0207667_10074390 3300025949 Bacteria 3529
168 Ga0207667_10135978 3300025949 Bacteria 2531
169 Ga0207712_10000364 3300025961 Bacteria 40077
170 Ga0207658_10001525 3300025986 Bacteria 18001
171 Ga0207677_10134254 3300026023 Bacteria 1884
172 Ga0207703_10002227 3300026035 Bacteria 16996
173 Ga0207639_10000308 3300026041 Bacteria 34625
174 Ga0207639_10005209 3300026041 Bacteria 8770
175 Ga0207678_10006904 3300026067 Bacteria 10072
176 Ga0207702_10016777 3300026078 Bacteria 6062
177 Ga0207648_10029800 3300026089 Bacteria 4839
178 Ga0207648_10076713 3300026089 Bacteria 2913
179 Ga0207674_10054318 3300026116 Bacteria 4078
180 Ga0207683_10017243 3300026121 Bacteria 6150
181 Ga0207698_10009909 3300026142 Bacteria 6095
182 Ga0209281_1000017 3300027111 Bacteria 583251
183 Ga0209281_1003314 3300027111 Bacteria 5426
184 Ga0209389_1000013 3300027296 Bacteria 208890
185 Ga0209371_1000040 3300027312 Bacteria 340804
186 Ga0209371_1000095 3300027312 Bacteria 166175
187 Ga0209971_1009826 3300027682 Bacteria 2266
188 Ga0268266_10000008 3300028379 Bacteria 1161875
189 Ga0268264_10040409 3300028381 Bacteria 3854
190 Ga0268256_1000041 3300030500 Bacteria 340725
191 Ga0268256_1000116 3300030500 Bacteria 115451
192 Ga0316176_1172566 3300030732 Bacteria 3913
193 Ga0265327_10001037 3300031251 Bacteria 39182
194 Ga0265316_10042875 3300031344 Bacteria 3613
195 Ga0307408_100002587 3300031548 Bacteria 12614
196 Ga0307508_10052854 3300031616 Bacteria 3607
197 Ga0265314_10019230 3300031711 Bacteria 5297
198 Ga0307412_10064926 3300031911 Bacteria 2468
199 Ga0307414_10004927 3300032004 Bacteria 7301
200 Ga0373937_0029112 3300036401 Bacteria 5001
201 Ga0395899_0038892 3300037312 Bacteria 3562
202 Ga0395905_0016308 3300037471 Bacteria 7060
203 Ga0395905_0085602 3300037471 Bacteria 2953
204 Ga0436361_0010019 3300039447 Bacteria 6376
205 Ga0436361_0915026 3300039447 Bacteria 2082
206 Ga0439466_0036358 3300041411 Bacteria 1663
207 Ga0439432_007006 3300042006 Bacteria 4008
208 Ga0450904_000075 3300042139 Bacteria 22281
209 Ga0450905_006046 3300042142 Bacteria 1631
210 Ga0495617_000002 3300046452 Bacteria 710121
211 Ga0495617_000041 3300046452 Bacteria 124027
212 Ga0495627_000007 3300046453 Bacteria 575915
213 Ga0495627_002837 3300046453 Bacteria 8019
214 Ga0495627_006326 3300046453 Bacteria 4651
215 Ga0495603_0010538 3300046455 Bacteria 5600
216 Ga0495590_0000025 3300046457 Bacteria 165221
217 Ga0495590_0002397 3300046457 Bacteria 7763
218 Ga0495591_004009 3300046458 Bacteria 7368
219 Ga0495591_010207 3300046458 Bacteria 3658
220 Ga0495638_0000711 3300046460 Bacteria 35843
221 Ga0495638_0010587 3300046460 Bacteria 6390
222 Ga0495638_0018141 3300046460 Bacteria 4677
223 Ga0495638_0044745 3300046460 Bacteria 2788
224 Ga0495638_0047547 3300046460 Bacteria 2689
225 Ga0495653_0025046 3300046463 Bacteria 4800
226 Ga0495650_0000156 3300046471 Bacteria 155338
227 Ga0495650_0017029 3300046471 Bacteria 3656
228 Ga0495580_0023251 3300046472 Bacteria 4554
229 Ga0495580_0027938 3300046472 Bacteria 4103
230 Ga0495582_0011407 3300046473 Bacteria 4896
231 Ga0495582_0027916 3300046473 Bacteria 3095
232 Ga0495582_0033012 3300046473 Bacteria 2844
233 Ga0495605_0005636 3300046474 Bacteria 7276
234 Ga0495605_0006745 3300046474 Bacteria 6564
235 Ga0495639_0022458 3300046475 Bacteria 2768
236 Ga0495584_0000238 3300046491 Bacteria 39636
237 Ga0495584_0009414 3300046491 Bacteria 5032
238 Ga0495584_0014400 3300046491 Bacteria 4028
239 Ga0495584_0036003 3300046491 Bacteria 2500
240 Ga0495585_0000812 3300046492 Bacteria 27226
241 Ga0495585_0000946 3300046492 Bacteria 24469
242 Ga0495585_0002065 3300046492 Bacteria 14773
243 Ga0495585_0036784 3300046492 Bacteria 2758
244 Ga0495585_0107215 3300046492 Bacteria 1488
245 Ga0495594_0007313 3300046499 Bacteria 5680
246 Ga0495596_0002512 3300046500 Bacteria 9829
247 Ga0495596_0005819 3300046500 Bacteria 5772
248 Ga0495596_0006752 3300046500 Bacteria 5245
249 Ga0495596_0007102 3300046500 Bacteria 5073
250 Ga0495596_0008228 3300046500 Bacteria 4650
251 Ga0495596_0024858 3300046500 Bacteria 2423
252 Ga0495607_0000811 3300046501 Bacteria 29602
253 Ga0495607_0011620 3300046501 Bacteria 5852
254 Ga0495583_0000520 3300046506 Bacteria 54664
255 Ga0495583_0006505 3300046506 Bacteria 7629
256 Ga0495583_0010415 3300046506 Bacteria 5424
257 Ga0495606_0000777 3300046507 Bacteria 48912
258 Ga0495606_0005924 3300046507 Bacteria 11489
259 Ga0495606_0051981 3300046507 Bacteria 2668
260 Ga0495610_0000003 3300046512 Bacteria 1203910
261 Ga0495610_0001963 3300046512 Bacteria 17672
262 Ga0495610_0004467 3300046512 Bacteria 10331
263 Ga0495610_0004537 3300046512 Bacteria 10214
264 Ga0495610_0005886 3300046512 Bacteria 8593
265 Ga0495616_0004348 3300046513 Bacteria 8939
266 Ga0495616_0035503 3300046513 Bacteria 2579
267 Ga0495616_0062265 3300046513 Bacteria 1827
268 Ga0495630_0027991 3300046517 Bacteria 4188
269 Ga0495631_0000128 3300046518 Bacteria 51035
270 Ga0495631_0000871 3300046518 Bacteria 18972
271 Ga0495631_0006308 3300046518 Bacteria 6134
272 Ga0495631_0006728 3300046518 Bacteria 5899
273 Ga0495631_0008825 3300046518 Bacteria 5061
274 Ga0495631_0014922 3300046518 Bacteria 3737
275 Ga0495631_0058772 3300046518 Bacteria 1671
276 Ga0495632_0000068 3300046519 Bacteria 108872
277 Ga0495632_0003587 3300046519 Bacteria 10927
278 Ga0495632_0045572 3300046519 Bacteria 2183
279 Ga0495637_0000019 3300046520 Bacteria 185953
280 Ga0495643_0000123 3300046522 Bacteria 124936
281 Ga0495643_0000612 3300046522 Bacteria 42656
282 Ga0495643_0010698 3300046522 Bacteria 5637
283 Ga0495643_0011229 3300046522 Bacteria 5470
284 Ga0495643_0027735 3300046522 Bacteria 3180
285 Ga0495643_0080484 3300046522 Bacteria 1695
286 Ga0495644_0003419 3300046523 Bacteria 6283
287 Ga0495644_0021512 3300046523 Bacteria 2461
288 Ga0495648_0000193 3300046524 Bacteria 70395
289 Ga0495648_0001612 3300046524 Bacteria 21954
290 Ga0495648_0009406 3300046524 Bacteria 7582
291 Ga0495648_0010068 3300046524 Bacteria 7243
292 Ga0495648_0027319 3300046524 Bacteria 3823
293 Ga0495663_0002101 3300046525 Bacteria 6096
294 Ga0495666_0094449 3300046526 Bacteria 1410
295 Ga0495642_0002275 3300046528 Bacteria 7835
296 Ga0495642_0002852 3300046528 Bacteria 6896
297 Ga0495642_0004437 3300046528 Bacteria 5444
298 Ga0495642_0006340 3300046528 Bacteria 4534
299 Ga0495642_0009593 3300046528 Bacteria 3704
300 Ga0495654_0004469 3300046530 Bacteria 8292
301 Ga0495654_0005433 3300046530 Bacteria 7401
302 Ga0495654_0006835 3300046530 Bacteria 6436
303 Ga0495654_0009350 3300046530 Bacteria 5372
304 Ga0495654_0014693 3300046530 Bacteria 4164
305 Ga0495609_0000380 3300046538 Bacteria 37754
306 Ga0495609_0002456 3300046538 Bacteria 11400
307 Ga0495609_0003906 3300046538 Bacteria 8364
308 Ga0495609_0081175 3300046538 Bacteria 1417
309 Ga0495597_0000067 3300046542 Bacteria 90183
310 Ga0495597_0000738 3300046542 Bacteria 26102
311 Ga0495597_0001580 3300046542 Bacteria 16010
312 Ga0495597_0002866 3300046542 Bacteria 10532
313 Ga0495597_0004500 3300046542 Bacteria 7635
314 Ga0495597_0085746 3300046542 Bacteria 1341
315 Ga0495633_0000528 3300046558 Bacteria 38185
316 Ga0495633_0001592 3300046558 Bacteria 17205
317 Ga0495633_0003379 3300046558 Bacteria 10678
318 Ga0495633_0004064 3300046558 Bacteria 9443
319 Ga0495633_0004095 3300046558 Bacteria 9406
320 Ga0495633_0006212 3300046558 Bacteria 7135
321 Ga0495633_0037345 3300046558 Bacteria 2324
322 Ga0495668_0000001 3300046616 Bacteria 1013420
323 Ga0495668_0000718 3300046616 Bacteria 39893
324 Ga0495668_0002188 3300046616 Bacteria 16714
325 Ga0495668_0005410 3300046616 Bacteria 8678
326 Ga0495668_0006070 3300046616 Bacteria 8001
327 Ga0495668_0010723 3300046616 Bacteria 5535
328 Ga0495668_0017490 3300046616 Bacteria 4156
329 Ga0495668_0030721 3300046616 Bacteria 3031
330 Ga0495634_0070630 3300046642 Bacteria 2301
331 Ga0495611_0000724 3300046648 Bacteria 18536
332 Ga0495611_0008372 3300046648 Bacteria 4380
333 Ga0495611_0017878 3300046648 Bacteria 3037
334 Ga0495611_0037631 3300046648 Bacteria 2150
335 Ga0495625_0003436 3300046660 Bacteria 15795
336 Ga0495625_0006578 3300046660 Bacteria 10315
337 Ga0495625_0016791 3300046660 Bacteria 5749
338 Ga0495625_0019641 3300046660 Bacteria 5233
339 Ga0495625_0020788 3300046660 Bacteria 5061
340 Ga0495659_0041617 3300046664 Bacteria 1642
341 Ga0495661_0000602 3300046665 Bacteria 36783
342 Ga0495661_0001847 3300046665 Bacteria 16912
343 Ga0495661_0047386 3300046665 Bacteria 2617
344 Ga0495661_0083799 3300046665 Bacteria 1831
345 Ga0495623_0003901 3300046679 Bacteria 9835
346 Ga0495658_0033448 3300046683 Bacteria 2815
347 Ga0495669_0001110 3300046684 Bacteria 11153
348 Ga0495669_0002499 3300046684 Bacteria 7504
349 Ga0495669_0008965 3300046684 Bacteria 4214
350 Ga0495669_0009574 3300046684 Bacteria 4087
351 Ga0495669_0039753 3300046684 Bacteria 2083
352 Ga0495613_0022795 3300046689 Bacteria 4666
353 Ga0495670_0004077 3300046691 Bacteria 7165
354 Ga0495670_0074271 3300046691 Bacteria 1724
355 Ga0495671_0000001 3300046692 Bacteria 1169494
356 Ga0495671_0000331 3300046692 Bacteria 39699
357 Ga0495671_0004188 3300046692 Bacteria 8688
358 Ga0495671_0004504 3300046692 Bacteria 8313
359 Ga0495671_0005746 3300046692 Bacteria 7231
360 Ga0495671_0007451 3300046692 Bacteria 6236
361 Ga0495671_0049342 3300046692 Bacteria 2098
362 Ga0495649_0000196 3300046694 Bacteria 53380
363 Ga0495649_0041514 3300046694 Bacteria 2516
364 Ga0495589_0000079 3300046794 Bacteria 89713
365 Ga0495589_0012412 3300046794 Bacteria 4412
366 Ga0495589_0039330 3300046794 Bacteria 2363
367 Ga0495660_0000496 3300046810 Bacteria 32573
368 Ga0495660_0003195 3300046810 Bacteria 10188
369 Ga0495660_0004248 3300046810 Bacteria 8694
370 Ga0495660_0005828 3300046810 Bacteria 7352
371 Ga0495660_0006150 3300046810 Bacteria 7126
372 Ga0495660_0007544 3300046810 Bacteria 6385
373 Ga0495660_0012326 3300046810 Bacteria 4960
374 Ga0495581_0010853 3300047315 Bacteria 5266
375 Ga0495604_0011550 3300047317 Bacteria 7018
376 Ga0495604_0017522 3300047317 Bacteria 5736
377 Ga0495672_0000006 3300047320 Bacteria 589807
378 Ga0495672_0000041 3300047320 Bacteria 267545
379 Ga0495672_0000429 3300047320 Bacteria 50347
380 Ga0495672_0006417 3300047320 Bacteria 9122
381 Ga0495672_0016377 3300047320 Bacteria 4998
382 Ga0495676_0000092 3300047321 Bacteria 66361
383 Ga0495683_0001072 3300047323 Bacteria 18936
384 Ga0495683_0011492 3300047323 Bacteria 4655
385 Ga0495683_0097806 3300047323 Bacteria 1414
386 Ga0495687_000133 3300047443 Bacteria 113757
387 Ga0495687_000537 3300047443 Bacteria 45261
388 Ga0495687_011570 3300047443 Bacteria 4734
389 Ga0495675_0004233 3300047444 Bacteria 8679
390 Ga0495677_0000367 3300047445 Bacteria 19447
391 Ga0495677_0001844 3300047445 Bacteria 8468
392 Ga0495677_0011833 3300047445 Bacteria 3186
393 Ga0495677_0030502 3300047445 Bacteria 1962
394 Ga0495679_013486 3300047446 Bacteria 3065
395 Ga0495679_030806 3300047446 Bacteria 1737
396 Ga0495679_032135 3300047446 Bacteria 1686
397 Ga0495685_001039 3300047447 Bacteria 8451
398 Ga0495685_022108 3300047447 Bacteria 2188
399 Ga0495673_0000016 3300047469 Bacteria 580643
400 Ga0495681_0002000 3300047470 Bacteria 14898
401 Ga0495681_0006542 3300047470 Bacteria 7634
402 Ga0495681_0011916 3300047470 Bacteria 5137
403 Ga0495686_0000006 3300047472 Bacteria 770778
404 Ga0495686_0000279 3300047472 Bacteria 90202
405 Ga0495686_0000479 3300047472 Bacteria 59585
406 Ga0495686_0001600 3300047472 Bacteria 23919
407 Ga0495686_0002005 3300047472 Bacteria 20174
408 Ga0495686_0019374 3300047472 Bacteria 4546
409 Ga0495614_0002457 3300048089 Bacteria 8238
410 Ga0495626_0004630 3300048091 Bacteria 8364
411 Ga0495626_0005307 3300048091 Bacteria 7599
412 Ga0495626_0009099 3300048091 Bacteria 5388
413 Ga0496101_0063990 3300048904 Bacteria 2678
414 Ga0496102_0178071 3300048905 Bacteria 2003
415 Ga0496103_0073604 3300048906 Bacteria 2140
416 Ga0496104_0000005 3300048907 Bacteria 620360
417 Ga0496104_0000039 3300048907 Bacteria 177103
418 Ga0496104_0162562 3300048907 Bacteria 2141
419 Ga0496105_0000084 3300048908 Bacteria 67834
420 Ga0496105_0138863 3300048908 Bacteria 2001
421 Ga0496107_0126992 3300048910 Bacteria 1881
422 Ga0496110_0014675 3300048913 Bacteria 6512
423 Ga0496111_0243464 3300048914 Bacteria 1335
424 Ga0496112_0183096 3300048915 Bacteria 2058
425 Ga0496115_0000002 3300048918 Bacteria 365286
426 Ga0496115_0001466 3300048918 Bacteria 16927
427 Ga0496116_0006867 3300048919 Bacteria 10221
428 Ga0496116_0050117 3300048919 Bacteria 2784
429 Ga0496117_0000065 3300048920 Bacteria 254215
430 Ga0496117_0000132 3300048920 Bacteria 162117
431 Ga0496117_0005145 3300048920 Bacteria 13954
432 Ga0496117_0005767 3300048920 Bacteria 12864
433 Ga0496118_0000033 3300048921 Bacteria 326357
434 Ga0496118_0000099 3300048921 Bacteria 160412
435 Ga0496118_0001414 3300048921 Bacteria 36205
436 Ga0496118_0002596 3300048921 Bacteria 24061
437 Ga0496118_0012948 3300048921 Bacteria 7941
438 Ga0496118_0019844 3300048921 Bacteria 5991
439 Ga0496119_0000632 3300048922 Bacteria 47533
440 Ga0496120_0000204 3300048923 Bacteria 101626
441 Ga0496121_0010790 3300048924 Bacteria 10239
442 Ga0496121_0014412 3300048924 Bacteria 8392
443 Ga0496121_0016990 3300048924 Bacteria 7469
444 Ga0496121_0020731 3300048924 Bacteria 6482
445 Ga0496121_0022148 3300048924 Bacteria 6181
446 Ga0496121_0036345 3300048924 Bacteria 4390
447 Ga0496121_0064268 3300048924 Bacteria 2993
448 Ga0496122_0000988 3300048925 Bacteria 50798
449 Ga0496122_0004429 3300048925 Bacteria 17454
450 Ga0496122_0006616 3300048925 Bacteria 13219
451 Ga0496122_0007439 3300048925 Bacteria 12169
452 Ga0496122_0008475 3300048925 Bacteria 11078
453 Ga0496122_0022864 3300048925 Bacteria 5536
454 Ga0496122_0029656 3300048925 Bacteria 4607
455 Ga0496122_0080849 3300048925 Bacteria 2264
456 Ga0496123_0000198 3300048926 Bacteria 122508
457 Ga0496123_0002480 3300048926 Bacteria 22780
458 Ga0496123_0005655 3300048926 Bacteria 12483
459 Ga0496123_0009138 3300048926 Bacteria 8966
460 Ga0496123_0010362 3300048926 Bacteria 8251
461 Ga0496123_0010932 3300048926 Bacteria 7941
462 Ga0496123_0016750 3300048926 Bacteria 5931
463 Ga0496124_0000056 3300048927 Bacteria 250907
464 Ga0496124_0003538 3300048927 Bacteria 19006
465 Ga0496124_0010857 3300048927 Bacteria 9170
466 Ga0496124_0010977 3300048927 Bacteria 9105
467 Ga0496124_0012500 3300048927 Bacteria 8372
468 Ga0496124_0065735 3300048927 Bacteria 3023
469 Ga0496124_0094045 3300048927 Bacteria 2439
470 Ga0496124_0145162 3300048927 Bacteria 1868
471 Ga0496125_0000132 3300048928 Bacteria 162176
472 Ga0496125_0001680 3300048928 Bacteria 30949
473 Ga0496125_0007623 3300048928 Bacteria 11483
474 Ga0496125_0009473 3300048928 Bacteria 9998
475 Ga0496125_0016718 3300048928 Bacteria 7034
476 Ga0496125_0018243 3300048928 Bacteria 6669
477 Ga0496125_0099301 3300048928 Bacteria 2151
478 Ga0496126_0000052 3300048929 Bacteria 312383
479 Ga0496126_0000331 3300048929 Bacteria 100914
480 Ga0496126_0010423 3300048929 Bacteria 9742
481 Ga0496126_0019753 3300048929 Bacteria 6630
482 Ga0495678_000004 3300049459 Bacteria 532920
483 Ga0495678_000070 3300049459 Bacteria 131437
484 Ga0495678_000105 3300049459 Bacteria 103599
485 Ga0495678_000313 3300049459 Bacteria 51964
486 Ga0495678_001671 3300049459 Bacteria 16865
487 Ga0495678_001884 3300049459 Bacteria 15250
488 Ga0495682_0001637 3300049460 Bacteria 11532
489 Ga0495682_0003245 3300049460 Bacteria 7292
490 Ga0495682_0022451 3300049460 Bacteria 2359
491 Ga0501031_0015989 3300049568 Bacteria 4872
492 Ga0501031_0018350 3300049568 Bacteria 4555
493 Ga0501032_0032701 3300049569 Bacteria 3564
494 Ga0501032_0036064 3300049569 Bacteria 3377
495 Ga0501033_0035695 3300049570 Bacteria 3727
496 Ga0501034_0000045 3300049571 Bacteria 226186
497 Ga0501034_0002724 3300049571 Bacteria 20800
498 Ga0501036_0003405 3300049572 Bacteria 12711
499 Ga0501037_0002556 3300049573 Bacteria 13155
500 Ga0501038_0004389 3300049574 Bacteria 13121
501 Ga0501043_0001464 3300049579 Bacteria 20639
502 Ga0501043_0075041 3300049579 Bacteria 2656
503 Ga0501046_0000106 3300049580 Bacteria 89243
504 Ga0501047_0000523 3300049581 Bacteria 41561
505 Ga0501047_0371817 3300049581 Bacteria 1264
506 Ga0501073_0000737 3300049589 Bacteria 23177
507 Ga0501080_0011421 3300049742 Bacteria 8133
508 Ga0501035_0038098 3300049822 Bacteria 4353
509 Ga0501035_0212616 3300049822 Bacteria 1654
510 nmdc:mga03683_818_c1 3300050489 Bacteria 8910
511 nmdc:mga00v17_129_c1 3300050491 Bacteria 44201
512 nmdc:mga00v17_5685_c1 3300050491 Bacteria 6584
513 nmdc:mga00v17_7470_c1 3300050491 Bacteria 5834
514 nmdc:mga0yw44_33685_c1 3300050492 Bacteria 2995
515 nmdc:mga0k408_10692_c1 3300050493 Bacteria 4972
516 Ga0500659_0002064 3300053135 Bacteria 12308
517 Ga0500586_000049 3300053145 Bacteria 20851
518 Ga0500586_000607 3300053145 Bacteria 7277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0000006 Ga0495686_0000006_37927_39222 349
2 3300048907 Ga0496104_0000039 Ga0496104_0000039_93391_94686 349
3 3300048927 Ga0496124_0145162 Ga0496124_0145162_773_1849 350
4 3300050493 nmdc:mga0k408_10692_c1 nmdc:mga0k408_10692_c1_2233_3420 362
5 3300048924 Ga0496121_0016990 Ga0496121_0016990_12_1118 365
6 3300048924 Ga0496121_0020731 Ga0496121_0020731_12_1118 365
7 3300050491 nmdc:mga00v17_5685_c1 nmdc:mga00v17_5685_c1_574_1830 367
8 3300025924 Ga0207694_10296854 Ga0207694_102968541 368
9 3300009545 Ga0105237_10078783 Ga0105237_100787832 370
10 3300013306 Ga0163162_10025637 Ga0163162_100256373 370
11 3300025914 Ga0207671_10081813 Ga0207671_100818132 370
12 3300047317 Ga0495604_0017522 Ga0495604_0017522_1941_3194 370
13 3300006038 Ga0075365_10033667 Ga0075365_100336672 373
14 3300006051 Ga0075364_10008169 Ga0075364_100081697 373
15 3300006177 Ga0075362_10003784 Ga0075362_100037844 373
16 3300009093 Ga0105240_10010295 Ga0105240_1001029517 373
17 3300025913 Ga0207695_10021399 Ga0207695_100213992 373
18 3300049822 Ga0501035_0212616 Ga0501035_0212616_40_1320 373
19 3300050489 nmdc:mga03683_818_c1 nmdc:mga03683_818_c1_2006_3226 373
20 3300050491 nmdc:mga00v17_7470_c1 nmdc:mga00v17_7470_c1_3330_4550 373
21 3300050492 nmdc:mga0yw44_33685_c1 nmdc:mga0yw44_33685_c1_1625_2845 373
22 3300047472 Ga0495686_0001600 Ga0495686_0001600_3065_4225 375
23 3300002738 JGI25154J39366_1001065 JGI25154J39366_10010659 376
24 3300015261 Ga0182006_1000026 Ga0182006_1000026215 376
25 3300025246 Ga0209646_1000010 Ga0209646_100001020 376
26 3300031616 Ga0307508_10052854 Ga0307508_100528544 376
27 3300046453 Ga0495627_000007 Ga0495627_000007_454797_455951 376
28 3300046522 Ga0495643_0011229 Ga0495643_0011229_990_2192 376
29 3300046522 Ga0495643_0027735 Ga0495643_0027735_132_1286 376
30 3300046538 Ga0495609_0000380 Ga0495609_0000380_3989_5143 376
31 3300046810 Ga0495660_0000496 Ga0495660_0000496_10255_11409 376
32 3300046810 Ga0495660_0003195 Ga0495660_0003195_3978_5132 376
33 3300047470 Ga0495681_0006542 Ga0495681_0006542_2866_4020 376
34 3300049459 Ga0495678_000004 Ga0495678_000004_404466_405620 376
35 3300049569 Ga0501032_0036064 Ga0501032_0036064_2048_3355 376
36 3300049589 Ga0501073_0000737 Ga0501073_0000737_14413_15720 376
37 3300049742 Ga0501080_0011421 Ga0501080_0011421_2222_3529 376
38 iso_pu_bacteria 2600255292 2601670122 376
39 iso_pu_bacteria 2857547612 2857552901 376
40 3300046810 Ga0495660_0004248 Ga0495660_0004248_5455_6693 377
41 3300049568 Ga0501031_0015989 Ga0501031_0015989_113_1399 377
42 3300049571 Ga0501034_0002724 Ga0501034_0002724_4886_6196 377
43 3300049572 Ga0501036_0003405 Ga0501036_0003405_519_1829 377
44 3300049573 Ga0501037_0002556 Ga0501037_0002556_7300_8610 377
45 3300049574 Ga0501038_0004389 Ga0501038_0004389_4635_5945 377
46 3300049579 Ga0501043_0001464 Ga0501043_0001464_15136_16446 377
47 3300049580 Ga0501046_0000106 Ga0501046_0000106_14693_16003 377
48 3300049581 Ga0501047_0000523 Ga0501047_0000523_31723_33033 377
49 3300048927 Ga0496124_0000056 Ga0496124_0000056_125755_126945 378
50 3300003856 Ga0058692_1000014 Ga0058692_1000014177 379
51 3300005272 Ga0065703_1000120 Ga0065703_100012032 379
52 3300005289 Ga0065704_10006065 Ga0065704_100060651 379
53 3300005548 Ga0070665_100180444 Ga0070665_1001804442 379
54 3300009036 Ga0105244_10045369 Ga0105244_100453691 379
55 3300009036 Ga0105244_10102552 Ga0105244_101025521 379
56 3300009093 Ga0105240_10155309 Ga0105240_101553092 379
57 3300009101 Ga0105247_10000502 Ga0105247_1000050218 379
58 3300009148 Ga0105243_10000163 Ga0105243_1000016356 379
59 3300025711 Ga0207696_1001811 Ga0207696_10018113 379
60 3300025728 Ga0207655_1000822 Ga0207655_100082217 379
61 3300025728 Ga0207655_1001110 Ga0207655_100111019 379
62 3300025735 Ga0207713_1002154 Ga0207713_10021545 379
63 3300025900 Ga0207710_10000009 Ga0207710_10000009453 379
64 3300025913 Ga0207695_10054758 Ga0207695_100547583 379
65 3300025923 Ga0207681_10001205 Ga0207681_100012052 379
66 3300025935 Ga0207709_10000001 Ga0207709_100000012004 379
67 3300027312 Ga0209371_1000040 Ga0209371_1000040114 379
68 3300030500 Ga0268256_1000041 Ga0268256_1000041200 379
69 3300046525 Ga0495663_0002101 Ga0495663_0002101_146_1366 379
70 3300014497 Ga0182008_10000390 Ga0182008_1000039023 380
71 3300015261 Ga0182006_1000097 Ga0182006_100009789 380
72 3300015262 Ga0182007_10000095 Ga0182007_1000009557 380
73 3300015265 Ga0182005_1000038 Ga0182005_100003887 380
74 3300017792 Ga0163161_10026647 Ga0163161_100266473 380
75 3300046512 Ga0495610_0004537 Ga0495610_0004537_2885_4123 380
76 3300046530 Ga0495654_0014693 Ga0495654_0014693_1881_3032 380
77 3300046558 Ga0495633_0037345 Ga0495633_0037345_36_1187 380
78 3300048914 Ga0496111_0243464 Ga0496111_0243464_100_1251 380
79 3300048919 Ga0496116_0050117 Ga0496116_0050117_282_1433 380
80 3300048920 Ga0496117_0000132 Ga0496117_0000132_89075_90226 380
81 3300048921 Ga0496118_0000099 Ga0496118_0000099_89075_90226 380
82 3300048925 Ga0496122_0004429 Ga0496122_0004429_4531_5682 380
83 3300048926 Ga0496123_0005655 Ga0496123_0005655_6382_7533 380
84 3300048927 Ga0496124_0010857 Ga0496124_0010857_4681_5910 380
85 3300049460 Ga0495682_0003245 Ga0495682_0003245_2267_3418 380
86 3300015265 Ga0182005_1000007 Ga0182005_1000007164 381
87 3300031251 Ga0265327_10001037 Ga0265327_1000103738 381
88 3300031711 Ga0265314_10019230 Ga0265314_100192304 381
89 3300003771 Ga0055526_1000973 Ga0055526_100097315 382
90 3300003773 Ga0055537_1000440 Ga0055537_100044018 382
91 3300003790 Ga0055528_1000860 Ga0055528_10008605 382
92 3300003794 Ga0055531_10003871 Ga0055531_100038716 382
93 3300005329 Ga0070683_100056176 Ga0070683_1000561763 382
94 3300009036 Ga0105244_10000377 Ga0105244_1000037729 382
95 3300014497 Ga0182008_10010135 Ga0182008_100101354 382
96 3300025263 Ga0209565_1000024 Ga0209565_1000024218 382
97 3300025273 Ga0209673_1000413 Ga0209673_100041339 382
98 3300025291 Ga0209675_1000039 Ga0209675_1000039229 382
99 3300025295 Ga0209564_1000411 Ga0209564_100041115 382
100 3300025304 Ga0209257_1007359 Ga0209257_10073595 382
101 3300031548 Ga0307408_100002587 Ga0307408_1000025878 382
102 3300046512 Ga0495610_0004467 Ga0495610_0004467_9056_10294 382
103 3300046518 Ga0495631_0000128 Ga0495631_0000128_4639_5877 382
104 3300048906 Ga0496103_0073604 Ga0496103_0073604_122_1279 382
105 3300048924 Ga0496121_0036345 Ga0496121_0036345_393_1604 382
106 3300048925 Ga0496122_0022864 Ga0496122_0022864_3005_4246 382
107 3300048926 Ga0496123_0002480 Ga0496123_0002480_16287_17528 382
108 3300049568 Ga0501031_0018350 Ga0501031_0018350_2412_3596 383
109 3300049569 Ga0501032_0032701 Ga0501032_0032701_1539_2723 383
110 3300049570 Ga0501033_0035695 Ga0501033_0035695_1080_2264 383
111 3300049581 Ga0501047_0371817 Ga0501047_0371817_15_1199 383
112 3300049822 Ga0501035_0038098 Ga0501035_0038098_1941_3125 383
113 3300046500 Ga0495596_0007102 Ga0495596_0007102_1327_2601 384
114 3300046528 Ga0495642_0004437 Ga0495642_0004437_1649_2842 384
115 3300046542 Ga0495597_0000067 Ga0495597_0000067_8210_9427 384
116 3300046558 Ga0495633_0006212 Ga0495633_0006212_4598_5797 384
117 3300046616 Ga0495668_0002188 Ga0495668_0002188_5291_6490 384
118 3300046660 Ga0495625_0016791 Ga0495625_0016791_2102_3340 384
119 3300046691 Ga0495670_0074271 Ga0495670_0074271_157_1356 384
120 3300046692 Ga0495671_0004504 Ga0495671_0004504_1899_3092 384
121 3300047470 Ga0495681_0002000 Ga0495681_0002000_6355_7548 384
122 3300046463 Ga0495653_0025046 Ga0495653_0025046_2605_3813 385
123 3300046500 Ga0495596_0002512 Ga0495596_0002512_4569_5765 385
124 3300046500 Ga0495596_0008228 Ga0495596_0008228_21_1217 385
125 3300046530 Ga0495654_0004469 Ga0495654_0004469_3899_5182 385
126 3300046542 Ga0495597_0004500 Ga0495597_0004500_3028_4311 385
127 3300046558 Ga0495633_0001592 Ga0495633_0001592_9115_10356 385
128 3300046616 Ga0495668_0005410 Ga0495668_0005410_3725_5008 385
129 3300046692 Ga0495671_0005746 Ga0495671_0005746_4114_5310 385
130 3300047320 Ga0495672_0016377 Ga0495672_0016377_199_1482 385
131 3300046500 Ga0495596_0006752 Ga0495596_0006752_2997_4196 386
132 3300046506 Ga0495583_0006505 Ga0495583_0006505_4463_5668 386
133 3300046518 Ga0495631_0006728 Ga0495631_0006728_724_1923 386
134 3300046522 Ga0495643_0000123 Ga0495643_0000123_55631_56863 386
135 3300046523 Ga0495644_0021512 Ga0495644_0021512_751_1950 386
136 3300046665 Ga0495661_0001847 Ga0495661_0001847_4092_5327 386
137 3300047320 Ga0495672_0000429 Ga0495672_0000429_29235_30467 386
138 3300047323 Ga0495683_0011492 Ga0495683_0011492_2853_4052 386
139 3300047443 Ga0495687_011570 Ga0495687_011570_148_1347 386
140 3300048904 Ga0496101_0063990 Ga0496101_0063990_1169_2410 386
141 3300048915 Ga0496112_0183096 Ga0496112_0183096_546_1781 386
142 3300048925 Ga0496122_0000988 Ga0496122_0000988_31891_33126 386
143 3300048926 Ga0496123_0000198 Ga0496123_0000198_4555_5790 386
144 3300048928 Ga0496125_0009473 Ga0496125_0009473_4713_5948 386
145 3300049459 Ga0495678_000313 Ga0495678_000313_31097_32329 386
146 3300049459 Ga0495678_001884 Ga0495678_001884_9274_10473 386
147 3300049460 Ga0495682_0001637 Ga0495682_0001637_5053_6252 386
148 3300050491 nmdc:mga00v17_129_c1 nmdc:mga00v17_129_c1_26138_27373 386
149 3300006051 Ga0075364_10010115 Ga0075364_100101153 387
150 3300046472 Ga0495580_0027938 Ga0495580_0027938_2070_3284 387
151 3300046473 Ga0495582_0033012 Ga0495582_0033012_747_1961 387
152 3300046517 Ga0495630_0027991 Ga0495630_0027991_783_1997 387
153 3300046519 Ga0495632_0000068 Ga0495632_0000068_7026_8222 387
154 3300046524 Ga0495648_0027319 Ga0495648_0027319_2278_3489 387
155 3300046526 Ga0495666_0094449 Ga0495666_0094449_76_1290 387
156 3300046642 Ga0495634_0070630 Ga0495634_0070630_884_2098 387
157 3300046679 Ga0495623_0003901 Ga0495623_0003901_6416_7630 387
158 3300046694 Ga0495649_0041514 Ga0495649_0041514_191_1408 387
159 3300046810 Ga0495660_0005828 Ga0495660_0005828_4749_5960 387
160 3300046810 Ga0495660_0012326 Ga0495660_0012326_59_1255 387
161 3300047317 Ga0495604_0011550 Ga0495604_0011550_4820_6034 387
162 3300047444 Ga0495675_0004233 Ga0495675_0004233_6681_7895 387
163 3300049459 Ga0495678_001671 Ga0495678_001671_9360_10556 387
164 3300003781 Ga0055536_1011470 Ga0055536_10114703 388
165 3300005548 Ga0070665_100123098 Ga0070665_1001230981 388
166 3300006051 Ga0075364_10063113 Ga0075364_100631131 388
167 3300006944 Ga0099823_1000097 Ga0099823_100009732 388
168 3300009011 Ga0105251_10027421 Ga0105251_100274211 388
169 3300009092 Ga0105250_10009178 Ga0105250_100091783 388
170 3300015261 Ga0182006_1005529 Ga0182006_10055292 388
171 3300025292 Ga0209676_1000655 Ga0209676_100065520 388
172 3300025711 Ga0207696_1002185 Ga0207696_10021854 388
173 3300025728 Ga0207655_1000646 Ga0207655_100064629 388
174 3300025735 Ga0207713_1023376 Ga0207713_10233763 388
175 3300027296 Ga0209389_1000013 Ga0209389_100001340 388
176 3300039447 Ga0436361_0915026 Ga0436361_0915026_659_1870 388
177 3300042006 Ga0439432_007006 Ga0439432_007006_2737_3969 388
178 3300042142 Ga0450905_006046 Ga0450905_006046_332_1564 388
179 3300046522 Ga0495643_0000612 Ga0495643_0000612_15924_17165 388
180 3300046660 Ga0495625_0019641 Ga0495625_0019641_690_1931 388
181 3300047320 Ga0495672_0000006 Ga0495672_0000006_162869_164110 388
182 3300047472 Ga0495686_0002005 Ga0495686_0002005_4552_5793 388
183 3300048920 Ga0496117_0005145 Ga0496117_0005145_6542_7783 388
184 3300048921 Ga0496118_0001414 Ga0496118_0001414_7613_8854 388
185 3300048925 Ga0496122_0029656 Ga0496122_0029656_521_1753 388
186 3300048929 Ga0496126_0010423 Ga0496126_0010423_3111_4364 388
187 3300049571 Ga0501034_0000045 Ga0501034_0000045_151825_153057 388
188 3300053135 Ga0500659_0002064 Ga0500659_0002064_7307_8539 388
189 3300003791 Ga0055530_10000021 Ga0055530_1000002159 389
190 3300013102 Ga0157371_10000022 Ga0157371_10000022133 389
191 3300013104 Ga0157370_10005813 Ga0157370_100058133 389
192 3300014497 Ga0182008_10000013 Ga0182008_1000001325 389
193 3300015262 Ga0182007_10000004 Ga0182007_10000004254 389
194 3300017792 Ga0163161_10001217 Ga0163161_100012172 389
195 3300025298 Ga0209050_1000069 Ga0209050_1000069118 389
196 3300025735 Ga0207713_1008819 Ga0207713_10088192 389
197 3300030732 Ga0316176_1172566 Ga0316176_11725666 389
198 3300031911 Ga0307412_10064926 Ga0307412_100649261 389
199 3300032004 Ga0307414_10004927 Ga0307414_100049272 389
200 3300046452 Ga0495617_000002 Ga0495617_000002_575260_576480 389
201 3300046453 Ga0495627_002837 Ga0495627_002837_3820_5040 389
202 3300046460 Ga0495638_0000711 Ga0495638_0000711_20390_21613 389
203 3300046474 Ga0495605_0006745 Ga0495605_0006745_1318_2538 389
204 3300046491 Ga0495584_0009414 Ga0495584_0009414_24_1241 389
205 3300046491 Ga0495584_0014400 Ga0495584_0014400_24_1241 389
206 3300046500 Ga0495596_0005819 Ga0495596_0005819_465_1685 389
207 3300046501 Ga0495607_0011620 Ga0495607_0011620_3711_4931 389
208 3300046507 Ga0495606_0005924 Ga0495606_0005924_6958_8184 389
209 3300046512 Ga0495610_0005886 Ga0495610_0005886_6644_7870 389
210 3300046518 Ga0495631_0008825 Ga0495631_0008825_362_1582 389
211 3300046523 Ga0495644_0003419 Ga0495644_0003419_3480_4700 389
212 3300046524 Ga0495648_0000193 Ga0495648_0000193_2680_3900 389
213 3300046528 Ga0495642_0002852 Ga0495642_0002852_4359_5579 389
214 3300046542 Ga0495597_0002866 Ga0495597_0002866_6535_7740 389
215 3300046558 Ga0495633_0004095 Ga0495633_0004095_2065_3288 389
216 3300046616 Ga0495668_0000001 Ga0495668_0000001_86061_87293 389
217 3300046616 Ga0495668_0006070 Ga0495668_0006070_3731_4951 389
218 3300046660 Ga0495625_0006578 Ga0495625_0006578_504_1736 389
219 3300046692 Ga0495671_0004188 Ga0495671_0004188_5402_6622 389
220 3300047445 Ga0495677_0001844 Ga0495677_0001844_3394_4614 389
221 3300048907 Ga0496104_0162562 Ga0496104_0162562_700_1923 389
222 3300048908 Ga0496105_0138863 Ga0496105_0138863_752_1975 389
223 3300048913 Ga0496110_0014675 Ga0496110_0014675_5150_6385 389
224 3300048919 Ga0496116_0006867 Ga0496116_0006867_2947_4170 389
225 3300048920 Ga0496117_0000065 Ga0496117_0000065_41011_42234 389
226 3300048921 Ga0496118_0000033 Ga0496118_0000033_284124_285347 389
227 3300048921 Ga0496118_0012948 Ga0496118_0012948_345_1568 389
228 3300048921 Ga0496118_0019844 Ga0496118_0019844_4599_5822 389
229 3300048922 Ga0496119_0000632 Ga0496119_0000632_40907_42130 389
230 3300048923 Ga0496120_0000204 Ga0496120_0000204_95586_96809 389
231 3300048924 Ga0496121_0010790 Ga0496121_0010790_2975_4198 389
232 3300048924 Ga0496121_0014412 Ga0496121_0014412_4560_5783 389
233 3300048924 Ga0496121_0022148 Ga0496121_0022148_1810_3033 389
234 3300048924 Ga0496121_0064268 Ga0496121_0064268_664_1887 389
235 3300048925 Ga0496122_0006616 Ga0496122_0006616_1307_2530 389
236 3300048925 Ga0496122_0007439 Ga0496122_0007439_5553_6776 389
237 3300048925 Ga0496122_0008475 Ga0496122_0008475_3198_4421 389
238 3300048926 Ga0496123_0009138 Ga0496123_0009138_3987_5210 389
239 3300048926 Ga0496123_0010362 Ga0496123_0010362_3048_4271 389
240 3300048926 Ga0496123_0010932 Ga0496123_0010932_3289_4512 389
241 3300048926 Ga0496123_0016750 Ga0496123_0016750_105_1340 389
242 3300048927 Ga0496124_0003538 Ga0496124_0003538_13206_14441 389
243 3300048927 Ga0496124_0010977 Ga0496124_0010977_152_1375 389
244 3300048927 Ga0496124_0065735 Ga0496124_0065735_1230_2465 389
245 3300048927 Ga0496124_0094045 Ga0496124_0094045_534_1757 389
246 3300048928 Ga0496125_0000132 Ga0496125_0000132_76094_77317 389
247 3300048928 Ga0496125_0001680 Ga0496125_0001680_8930_10153 389
248 3300048928 Ga0496125_0007623 Ga0496125_0007623_7189_8412 389
249 3300048928 Ga0496125_0016718 Ga0496125_0016718_5584_6807 389
250 3300048928 Ga0496125_0018243 Ga0496125_0018243_59_1294 389
251 3300048929 Ga0496126_0000331 Ga0496126_0000331_99187_100410 389
252 3300003781 Ga0055536_1000444 Ga0055536_100044422 390
253 3300003781 Ga0055536_1000543 Ga0055536_100054319 390
254 3300003791 Ga0055530_10000323 Ga0055530_1000032322 390
255 3300003794 Ga0055531_10001266 Ga0055531_1000126614 390
256 3300003794 Ga0055531_10002303 Ga0055531_100023032 390
257 3300003856 Ga0058692_1007691 Ga0058692_10076913 390
258 3300013102 Ga0157371_10037745 Ga0157371_100377451 390
259 3300017792 Ga0163161_10006939 Ga0163161_100069398 390
260 3300021361 Ga0213872_10029947 Ga0213872_100299472 390
261 3300025292 Ga0209676_1000011 Ga0209676_1000011250 390
262 3300025292 Ga0209676_1000650 Ga0209676_100065012 390
263 3300025292 Ga0209676_1000724 Ga0209676_10007249 390
264 3300025298 Ga0209050_1000032 Ga0209050_1000032129 390
265 3300025299 Ga0209256_1006758 Ga0209256_10067582 390
266 3300025304 Ga0209257_1000014 Ga0209257_1000014309 390
267 3300025304 Ga0209257_1000858 Ga0209257_100085827 390
268 3300027312 Ga0209371_1000095 Ga0209371_100009552 390
269 3300030500 Ga0268256_1000116 Ga0268256_100011667 390
270 3300039447 Ga0436361_0010019 Ga0436361_0010019_1362_2585 390
271 3300041411 Ga0439466_0036358 Ga0439466_0036358_185_1606 390
272 3300042139 Ga0450904_000075 Ga0450904_000075_4749_5975 390
273 3300046453 Ga0495627_006326 Ga0495627_006326_138_1370 390
274 3300046460 Ga0495638_0010587 Ga0495638_0010587_1406_2641 390
275 3300046460 Ga0495638_0047547 Ga0495638_0047547_384_1625 390
276 3300046558 Ga0495633_0000528 Ga0495633_0000528_12654_13889 390
277 3300048905 Ga0496102_0178071 Ga0496102_0178071_464_1693 390
278 3300048920 Ga0496117_0005767 Ga0496117_0005767_4329_5561 390
279 3300048921 Ga0496118_0002596 Ga0496118_0002596_3373_4605 390
280 3300048927 Ga0496124_0012500 Ga0496124_0012500_1705_2937 390
281 3300048929 Ga0496126_0019753 Ga0496126_0019753_4438_5670 390
282 3300053145 Ga0500586_000049 Ga0500586_000049_18775_20010 390
283 iso_pu_bacteria 2551306352 2552746404 390
284 iso_pu_bacteria 2639762793 2640733360 390
285 iso_pu_bacteria 2671180694 2673821575 390
286 iso_pu_bacteria 2675903507 2678230392 390
287 iso_pu_bacteria 2744054655 2745161370 390
288 iso_pu_bacteria 2773857761 2774389052 390
289 iso_pu_bacteria 2773857770 2774439251 390
290 iso_pu_bacteria 2916699645 2916701747 390
291 iso_pu_bacteria 2919182534 2919185312 390
292 3300003781 Ga0055536_1025964 Ga0055536_10259641 391
293 3300003794 Ga0055531_10014955 Ga0055531_100149554 391
294 3300006946 Ga0079104_1000167 Ga0079104_100016743 391
295 3300009092 Ga0105250_10000700 Ga0105250_100007003 391
296 3300009148 Ga0105243_10009598 Ga0105243_100095986 391
297 3300025292 Ga0209676_1012468 Ga0209676_10124684 391
298 3300025298 Ga0209050_1006468 Ga0209050_10064685 391
299 3300025304 Ga0209257_1003880 Ga0209257_10038802 391
300 3300025711 Ga0207696_1002705 Ga0207696_10027052 391
301 3300025935 Ga0207709_10000143 Ga0207709_1000014336 391
302 3300027111 Ga0209281_1000017 Ga0209281_1000017337 391
303 3300046492 Ga0495585_0000946 Ga0495585_0000946_20044_21288 391
304 3300046518 Ga0495631_0014922 Ga0495631_0014922_381_1625 391
305 3300046665 Ga0495661_0000602 Ga0495661_0000602_3185_4429 391
306 3300046691 Ga0495670_0004077 Ga0495670_0004077_5709_6953 391
307 3300047445 Ga0495677_0030502 Ga0495677_0030502_590_1834 391
308 3300047470 Ga0495681_0011916 Ga0495681_0011916_3204_4448 391
309 3300002987 JGI25159J45721_1001688 JGI25159J45721_10016884 392
310 3300005262 Ga0065165_1000005 Ga0065165_10000059 392
311 3300025284 Ga0209130_1000046 Ga0209130_1000046144 392
312 3300048091 Ga0495626_0009099 Ga0495626_0009099_1487_2692 392
313 iso_pu_bacteria 2593339198 2595315420 392
314 iso_pu_bacteria 2738541297 2738829214 392
315 iso_pu_bacteria 2738541357 2739153010 392
316 iso_pu_bacteria 2738543003 2739194930 392
317 iso_pu_bacteria 2738543026 2739321406 392
318 iso_pu_bacteria 2738543029 2739340038 392
319 iso_pu_bacteria 2889049205 2889049836 392
320 3300046507 Ga0495606_0000777 Ga0495606_0000777_29492_30718 393
321 3300048918 Ga0496115_0001466 Ga0496115_0001466_6200_7450 393
322 iso_pu_bacteria 2984568884 2984572486 393
323 3300005616 Ga0068852_100294492 Ga0068852_1002944922 394
324 3300006946 Ga0079104_1010157 Ga0079104_10101572 394
325 3300027682 Ga0209971_1009826 Ga0209971_10098262 394
326 3300031344 Ga0265316_10042875 Ga0265316_100428751 394
327 3300037312 Ga0395899_0038892 Ga0395899_0038892_641_1876 394
328 3300037471 Ga0395905_0016308 Ga0395905_0016308_541_1776 394
329 3300046512 Ga0495610_0000003 Ga0495610_0000003_605789_606994 394
330 3300046524 Ga0495648_0010068 Ga0495648_0010068_2911_4116 394
331 3300046692 Ga0495671_0000001 Ga0495671_0000001_62344_63549 394
332 3300048928 Ga0496125_0099301 Ga0496125_0099301_533_1771 394
333 iso_pu_bacteria 2808606418 2809146698 394
334 iso_pu_bacteria 2857576091 2857576101 394
335 iso_pu_bacteria 2919513703 2919514719 394
336 iso_pu_bacteria 2919675420 2919676764 394
337 iso_pu_bacteria 8052494512 8052496528 394
338 iso_pu_bacteria 8054929484 8054930408 394
339 3300005347 Ga0070668_100052987 Ga0070668_1000529871 395
340 3300005547 Ga0070693_100015318 Ga0070693_1000153181 395
341 3300005618 Ga0068864_100170091 Ga0068864_1001700912 395
342 3300006237 Ga0097621_100098237 Ga0097621_1000982372 395
343 3300006358 Ga0068871_100120401 Ga0068871_1001204013 395
344 3300009177 Ga0105248_10071149 Ga0105248_100711493 395
345 3300013306 Ga0163162_10035513 Ga0163162_100355132 395
346 3300014969 Ga0157376_10066806 Ga0157376_100668063 395
347 3300025903 Ga0207680_10145788 Ga0207680_101457882 395
348 3300025925 Ga0207650_10248764 Ga0207650_102487641 395
349 3300025941 Ga0207711_10080412 Ga0207711_100804123 395
350 3300025942 Ga0207689_10251638 Ga0207689_102516381 395
351 3300025949 Ga0207667_10135978 Ga0207667_101359782 395
352 3300026089 Ga0207648_10029800 Ga0207648_100298003 395
353 3300026121 Ga0207683_10017243 Ga0207683_100172431 395
354 3300028381 Ga0268264_10040409 Ga0268264_100404091 395
355 3300046660 Ga0495625_0020788 Ga0495625_0020788_3432_4649 395
356 3300048910 Ga0496107_0126992 Ga0496107_0126992_518_1753 395
357 3300048918 Ga0496115_0000002 Ga0496115_0000002_218631_219839 395
358 3300048929 Ga0496126_0000052 Ga0496126_0000052_165802_167010 395
359 iso_pu_bacteria 2511231024 2511377173 395
360 iso_pu_bacteria 2576861471 2578458334 395
361 iso_pu_bacteria 2643221563 2643834152 395
362 iso_pu_bacteria 2643221608 2644055078 395
363 iso_pu_bacteria 2765235841 2765584723 395
364 iso_pu_bacteria 2842711865 2842717779 395
365 iso_pu_bacteria 2852649853 2852650672 395
366 iso_pu_bacteria 2885080285 2885081559 395
367 iso_pu_bacteria 2939622612 2939623670 395
368 iso_pu_bacteria 2941475908 2941475942 395
369 3300005335 Ga0070666_10013299 Ga0070666_100132992 396
370 3300005439 Ga0070711_100047669 Ga0070711_1000476692 396
371 3300005459 Ga0068867_100287819 Ga0068867_1002878191 396
372 3300005539 Ga0068853_100068815 Ga0068853_1000688152 396
373 3300005843 Ga0068860_100006646 Ga0068860_1000066464 396
374 3300009176 Ga0105242_10006291 Ga0105242_100062914 396
375 3300013306 Ga0163162_10062232 Ga0163162_100622323 396
376 3300013308 Ga0157375_10000107 Ga0157375_1000010788 396
377 3300014969 Ga0157376_10139449 Ga0157376_101394491 396
378 3300046452 Ga0495617_000041 Ga0495617_000041_61456_62667 396
379 3300046460 Ga0495638_0018141 Ga0495638_0018141_3094_4305 396
380 3300046471 Ga0495650_0000156 Ga0495650_0000156_48700_49911 396
381 3300046471 Ga0495650_0017029 Ga0495650_0017029_2060_3271 396
382 3300046492 Ga0495585_0002065 Ga0495585_0002065_6787_7998 396
383 3300046530 Ga0495654_0009350 Ga0495654_0009350_1786_2997 396
384 3300046616 Ga0495668_0000718 Ga0495668_0000718_22173_23384 396
385 3300046692 Ga0495671_0049342 Ga0495671_0049342_652_1863 396
386 3300046810 Ga0495660_0006150 Ga0495660_0006150_1435_2646 396
387 3300047446 Ga0495679_032135 Ga0495679_032135_224_1435 396
388 3300047469 Ga0495673_0000016 Ga0495673_0000016_560938_562149 396
389 3300048907 Ga0496104_0000005 Ga0496104_0000005_393058_394269 396
390 3300048908 Ga0496105_0000084 Ga0496105_0000084_24925_26136 396
391 3300048925 Ga0496122_0080849 Ga0496122_0080849_527_1738 396
392 3300053145 Ga0500586_000607 Ga0500586_000607_527_1738 396
393 iso_pu_bacteria 2524023250 2524610071 396
394 iso_pu_bacteria 2643221645 2644251152 396
395 iso_pu_bacteria 2857442823 2857443413 396
396 iso_pu_bacteria 2857553236 2857554449 396
397 iso_pu_bacteria 2932410948 2932413632 396
398 iso_pu_bacteria 2932416698 2932417692 396
399 iso_pu_bacteria 2939589442 2939591741 396
400 iso_pu_bacteria 2974307012 2974308731 396
401 iso_pu_bacteria 2977247770 2977249467 396
402 iso_pu_bacteria 2984514374 2984516062 396
403 iso_pu_bacteria 3007315729 3007319743 396
404 3300005617 Ga0068859_100105454 Ga0068859_1001054542 397
405 3300010375 Ga0105239_10051630 Ga0105239_100516303 397
406 3300013105 Ga0157369_10000653 Ga0157369_1000065326 397
407 3300014969 Ga0157376_10016081 Ga0157376_100160814 397
408 3300025913 Ga0207695_10004908 Ga0207695_100049088 397
409 3300025914 Ga0207671_10042268 Ga0207671_100422682 397
410 3300026041 Ga0207639_10005209 Ga0207639_100052093 397
411 3300036401 Ga0373937_0029112 Ga0373937_0029112_668_1882 397
412 3300037471 Ga0395905_0085602 Ga0395905_0085602_1298_2521 397
413 3300046460 Ga0495638_0044745 Ga0495638_0044745_980_2203 397
414 3300046472 Ga0495580_0023251 Ga0495580_0023251_2379_3593 397
415 3300046473 Ga0495582_0011407 Ga0495582_0011407_2982_4196 397
416 3300046475 Ga0495639_0022458 Ga0495639_0022458_349_1563 397
417 3300046522 Ga0495643_0080484 Ga0495643_0080484_312_1511 397
418 3300046524 Ga0495648_0009406 Ga0495648_0009406_3941_5140 397
419 3300046538 Ga0495609_0002456 Ga0495609_0002456_864_2117 397
420 3300046683 Ga0495658_0033448 Ga0495658_0033448_1544_2758 397
421 3300047443 Ga0495687_000537 Ga0495687_000537_39396_40595 397
422 iso_pu_bacteria 2643221664 2644354667 397
423 iso_pu_bacteria 2884215851 2884218647 397
424 3300003322 rootL2_10103549 rootL2_101035492 398
425 3300025295 Ga0209564_1000068 Ga0209564_100006870 398
426 3300046457 Ga0495590_0002397 Ga0495590_0002397_5233_6441 398
427 3300046473 Ga0495582_0027916 Ga0495582_0027916_618_1913 398
428 3300046506 Ga0495583_0010415 Ga0495583_0010415_2503_3708 398
429 3300046507 Ga0495606_0051981 Ga0495606_0051981_780_1988 398
430 3300046513 Ga0495616_0035503 Ga0495616_0035503_610_1905 398
431 3300046518 Ga0495631_0006308 Ga0495631_0006308_775_1980 398
432 3300046524 Ga0495648_0001612 Ga0495648_0001612_18679_19884 398
433 3300046528 Ga0495642_0002275 Ga0495642_0002275_298_1593 398
434 3300046530 Ga0495654_0006835 Ga0495654_0006835_423_1628 398
435 3300046648 Ga0495611_0017878 Ga0495611_0017878_561_1856 398
436 3300046664 Ga0495659_0041617 Ga0495659_0041617_214_1419 398
437 3300046665 Ga0495661_0047386 Ga0495661_0047386_630_1925 398
438 3300046689 Ga0495613_0022795 Ga0495613_0022795_3129_4439 398
439 3300046692 Ga0495671_0007451 Ga0495671_0007451_89_1294 398
440 3300047315 Ga0495581_0010853 Ga0495581_0010853_61_1371 398
441 3300047321 Ga0495676_0000092 Ga0495676_0000092_56400_57671 398
442 3300047445 Ga0495677_0011833 Ga0495677_0011833_1786_3096 398
443 3300047446 Ga0495679_030806 Ga0495679_030806_153_1358 398
444 3300047447 Ga0495685_001039 Ga0495685_001039_1663_2868 398
445 3300048089 Ga0495614_0002457 Ga0495614_0002457_6685_7980 398
446 3300048091 Ga0495626_0005307 Ga0495626_0005307_821_2026 398
447 3300049459 Ga0495678_000105 Ga0495678_000105_2788_3993 398
448 iso_pu_bacteria 2721755523 2722881621 398
449 iso_pu_bacteria 2738541280 2738739862 398
450 iso_pu_bacteria 2738541300 2738844356 398
451 iso_pu_bacteria 2738543018 2739274084 398
452 iso_pu_bacteria 2738543030 2739343128 398
453 iso_pu_bacteria 2839138175 2839144374 398
454 3300017792 Ga0163161_10016788 Ga0163161_100167881 399
455 3300027111 Ga0209281_1003314 Ga0209281_10033144 399
456 3300046455 Ga0495603_0010538 Ga0495603_0010538_4300_5514 399
457 3300046457 Ga0495590_0000025 Ga0495590_0000025_150641_151849 399
458 3300046458 Ga0495591_004009 Ga0495591_004009_4085_5293 399
459 3300046458 Ga0495591_010207 Ga0495591_010207_2375_3583 399
460 3300046474 Ga0495605_0005636 Ga0495605_0005636_2448_3656 399
461 3300046491 Ga0495584_0000238 Ga0495584_0000238_3836_5044 399
462 3300046491 Ga0495584_0036003 Ga0495584_0036003_664_1872 399
463 3300046492 Ga0495585_0000812 Ga0495585_0000812_3048_4259 399
464 3300046492 Ga0495585_0036784 Ga0495585_0036784_59_1267 399
465 3300046492 Ga0495585_0107215 Ga0495585_0107215_75_1283 399
466 3300046499 Ga0495594_0007313 Ga0495594_0007313_3034_4248 399
467 3300046500 Ga0495596_0024858 Ga0495596_0024858_382_1590 399
468 3300046501 Ga0495607_0000811 Ga0495607_0000811_24481_25689 399
469 3300046506 Ga0495583_0000520 Ga0495583_0000520_3720_4928 399
470 3300046512 Ga0495610_0001963 Ga0495610_0001963_10598_11806 399
471 3300046513 Ga0495616_0004348 Ga0495616_0004348_1399_2613 399
472 3300046513 Ga0495616_0062265 Ga0495616_0062265_58_1266 399
473 3300046518 Ga0495631_0000871 Ga0495631_0000871_13258_14466 399
474 3300046519 Ga0495632_0003587 Ga0495632_0003587_3708_4922 399
475 3300046519 Ga0495632_0045572 Ga0495632_0045572_642_1850 399
476 3300046520 Ga0495637_0000019 Ga0495637_0000019_63593_64801 399
477 3300046522 Ga0495643_0010698 Ga0495643_0010698_1588_2796 399
478 3300046528 Ga0495642_0006340 Ga0495642_0006340_1255_2463 399
479 3300046528 Ga0495642_0009593 Ga0495642_0009593_1940_3148 399
480 3300046530 Ga0495654_0005433 Ga0495654_0005433_5537_6751 399
481 3300046538 Ga0495609_0003906 Ga0495609_0003906_3416_4651 399
482 3300046538 Ga0495609_0081175 Ga0495609_0081175_151_1359 399
483 3300046542 Ga0495597_0000738 Ga0495597_0000738_19418_20638 399
484 3300046542 Ga0495597_0001580 Ga0495597_0001580_11625_12860 399
485 3300046558 Ga0495633_0003379 Ga0495633_0003379_3614_4822 399
486 3300046616 Ga0495668_0010723 Ga0495668_0010723_1320_2528 399
487 3300046616 Ga0495668_0017490 Ga0495668_0017490_2409_3617 399
488 3300046648 Ga0495611_0000724 Ga0495611_0000724_13228_14436 399
489 3300046648 Ga0495611_0008372 Ga0495611_0008372_2753_4054 399
490 3300046648 Ga0495611_0037631 Ga0495611_0037631_759_1967 399
491 3300046665 Ga0495661_0083799 Ga0495661_0083799_418_1626 399
492 3300046684 Ga0495669_0002499 Ga0495669_0002499_1266_2480 399
493 3300046684 Ga0495669_0008965 Ga0495669_0008965_2743_3951 399
494 3300046684 Ga0495669_0009574 Ga0495669_0009574_120_1421 399
495 3300046684 Ga0495669_0039753 Ga0495669_0039753_537_1745 399
496 3300046694 Ga0495649_0000196 Ga0495649_0000196_49080_50288 399
497 3300046794 Ga0495589_0000079 Ga0495589_0000079_84074_85294 399
498 3300046794 Ga0495589_0012412 Ga0495589_0012412_1461_2669 399
499 3300046794 Ga0495589_0039330 Ga0495589_0039330_256_1464 399
500 3300046810 Ga0495660_0007544 Ga0495660_0007544_4821_6029 399
501 3300047320 Ga0495672_0000041 Ga0495672_0000041_124756_125964 399
502 3300047323 Ga0495683_0001072 Ga0495683_0001072_13244_14452 399
503 3300047323 Ga0495683_0097806 Ga0495683_0097806_56_1264 399
504 3300047443 Ga0495687_000133 Ga0495687_000133_4389_5609 399
505 3300047445 Ga0495677_0000367 Ga0495677_0000367_14446_15654 399
506 3300047446 Ga0495679_013486 Ga0495679_013486_283_1491 399
507 3300047447 Ga0495685_022108 Ga0495685_022108_833_2041 399
508 3300047472 Ga0495686_0000279 Ga0495686_0000279_13216_14424 399
509 3300047472 Ga0495686_0019374 Ga0495686_0019374_74_1282 399
510 3300048091 Ga0495626_0004630 Ga0495626_0004630_2788_3996 399
511 3300049459 Ga0495678_000070 Ga0495678_000070_18548_19756 399
512 3300049460 Ga0495682_0022451 Ga0495682_0022451_788_1996 399
513 iso_pu_bacteria 2738541276 2738716923 399
514 iso_pu_bacteria 2894023352 2894024776 399
515 3300005262 Ga0065165_1003002 Ga0065165_10030024 400
516 3300046518 Ga0495631_0058772 Ga0495631_0058772_339_1640 400
517 3300046558 Ga0495633_0004064 Ga0495633_0004064_1158_2399 400
518 3300046616 Ga0495668_0030721 Ga0495668_0030721_1556_2827 400
519 3300046660 Ga0495625_0003436 Ga0495625_0003436_2754_3986 400
520 3300046684 Ga0495669_0001110 Ga0495669_0001110_8156_9436 400
521 3300047472 Ga0495686_0000479 Ga0495686_0000479_4656_5870 400
522 iso_pu_bacteria 2643221603 2644031374 400
523 3300046542 Ga0495597_0085746 Ga0495597_0085746_45_1274 401
524 3300046692 Ga0495671_0000331 Ga0495671_0000331_20949_22178 401
525 3300047320 Ga0495672_0006417 Ga0495672_0006417_7724_8953 401
526 3300049579 Ga0501043_0075041 Ga0501043_0075041_102_1346 401
527 3300014325 Ga0163163_10003683 Ga0163163_100036838 402
528 iso_pu_bacteria 2939631187 2939634047 402
529 3300005327 Ga0070658_10085130 Ga0070658_100851302 405
530 3300005466 Ga0070685_10001399 Ga0070685_1000139915 405
531 3300009093 Ga0105240_10001002 Ga0105240_100010022 405
532 3300009545 Ga0105237_10142936 Ga0105237_101429362 405
533 3300009551 Ga0105238_10027161 Ga0105238_100271614 405
534 3300025913 Ga0207695_10000040 Ga0207695_10000040156 405
535 3300025924 Ga0207694_10016455 Ga0207694_100164553 405
536 3300001904 JGI24736J21556_1013011 JGI24736J21556_10130111 406
537 3300005331 Ga0070670_100009223 Ga0070670_1000092233 406
538 3300005335 Ga0070666_10001416 Ga0070666_100014167 406
539 3300005455 Ga0070663_100024233 Ga0070663_1000242333 406
540 3300005457 Ga0070662_100002992 Ga0070662_1000029925 406
541 3300005459 Ga0068867_100058751 Ga0068867_1000587512 406
542 3300005548 Ga0070665_100002074 Ga0070665_1000020742 406
543 3300005563 Ga0068855_100219355 Ga0068855_1002193552 406
544 3300005578 Ga0068854_100001668 Ga0068854_1000016687 406
545 3300005614 Ga0068856_100163854 Ga0068856_1001638542 406
546 3300005616 Ga0068852_100021482 Ga0068852_1000214821 406
547 3300005834 Ga0068851_10007699 Ga0068851_100076996 406
548 3300005842 Ga0068858_100011561 Ga0068858_1000115612 406
549 3300006881 Ga0068865_100052282 Ga0068865_1000522823 406
550 3300009093 Ga0105240_10255603 Ga0105240_102556032 406
551 3300009174 Ga0105241_10010307 Ga0105241_100103072 406
552 3300009176 Ga0105242_10107905 Ga0105242_101079053 406
553 3300009177 Ga0105248_10402198 Ga0105248_104021981 406
554 3300009551 Ga0105238_10030988 Ga0105238_100309881 406
555 3300009553 Ga0105249_10012965 Ga0105249_100129651 406
556 3300013307 Ga0157372_10123800 Ga0157372_101238002 406
557 3300025261 Ga0209233_1000759 Ga0209233_10007593 406
558 3300025904 Ga0207647_10000269 Ga0207647_1000026927 406
559 3300025911 Ga0207654_10023484 Ga0207654_100234842 406
560 3300025913 Ga0207695_10006253 Ga0207695_100062537 406
561 3300025914 Ga0207671_10006578 Ga0207671_100065783 406
562 3300025920 Ga0207649_10071702 Ga0207649_100717022 406
563 3300025924 Ga0207694_10006754 Ga0207694_100067542 406
564 3300025933 Ga0207706_10003257 Ga0207706_1000325714 406
565 3300025949 Ga0207667_10074390 Ga0207667_100743901 406
566 3300025961 Ga0207712_10000364 Ga0207712_1000036429 406
567 3300025986 Ga0207658_10001525 Ga0207658_1000152510 406
568 3300026023 Ga0207677_10134254 Ga0207677_101342542 406
569 3300026035 Ga0207703_10002227 Ga0207703_100022273 406
570 3300026041 Ga0207639_10000308 Ga0207639_100003084 406
571 3300026067 Ga0207678_10006904 Ga0207678_100069044 406
572 3300026078 Ga0207702_10016777 Ga0207702_100167773 406
573 3300026089 Ga0207648_10076713 Ga0207648_100767132 406
574 3300026116 Ga0207674_10054318 Ga0207674_100543183 406
575 3300026142 Ga0207698_10009909 Ga0207698_100099094 406
576 3300028379 Ga0268266_10000008 Ga0268266_10000008247 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

299

470

0.9

PF07690

MFS_1

Major Facilitator Superfamily

94

432

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8508 23 398
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8424 23 398
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8387 20 406
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8293 23 398
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8266 26 398
ID Description Score Start End Superfamily
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9936 221 401 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9793 22 206 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.967 221 401 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.949 22 206 1.20.1250.20
af_Q01818_292_487_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9245 26 198 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2T5Y5H1-F1-model_v4 deleted 0.9761 24 403
AF-A0A3A9JEU6-F1-model_v4 MFS transporter 0.9752 24 405 GO:0005886
GO:0022857
AF-R7H0R1-F1-model_v4 Fosmidomycin resistance protein 0.9725 24 400 GO:0005886
GO:0022857
AF-A0A0M8MHA8-F1-model_v4 Fosmidomycin resistance protein 0.9719 24 401 GO:0005886
GO:0022857
AF-W0Q9S4-F1-model_v4 Antibiotic MFS transporter 0.9697 24 400 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
87.54 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map