F465431

General Info

Members Datasets Scaffolds Average Seq Length
575 270 1150 269

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0045553|Ga0495629_0045553_1177_2073
Length 298
Sequence LPAPERDEPRLDGARQEREVSKPLLVVDGDSLAHRAYHALPKSMRSATGLPSGALVGFANFLLRLWQSEEPRAVLVGWDCVGKPTYRSEAFPAYQSGRVFDPELLEQLDLLPELVRAMGFAAAKQPGYEADDFLASAVAHEEKRGGTSLVATSDRDSFQLVSELTTVLQPVKGVSELARIGPAQVRERYGVEPEQVPDFIALRGDPSDKLPGARGVGPKTAASILGEYGTLEAALEAGRFSAEAEDLRLYRRMAQLDASAPLPSLADQTPKWAGASSLSQSWGLGNLAGRLELLAREG

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
160 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
161 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 19.83
Rhizosphere 78.78
Stem 0
Stem Tuber 0
Unclassified 6.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0045553 3300046459 Bacteria 3077
2 Ga0070658_10018904 3300005327 Bacteria 5520
3 Ga0070683_100004726 3300005329 Bacteria 11260
4 Ga0070683_100010003 3300005329 Bacteria 8134
5 Ga0070690_100050070 3300005330 Bacteria 2665
6 Ga0070690_100134711 3300005330 Unclassified 1672
7 Ga0070680_100040367 3300005336 Bacteria 3778
8 Ga0070680_100123011 3300005336 Bacteria 2167
9 Ga0070680_100133282 3300005336 Unclassified 2080
10 Ga0070682_100003272 3300005337 Bacteria 8986
11 Ga0070682_100130299 3300005337 Bacteria 1701
12 Ga0068868_100006553 3300005338 Bacteria 8245
13 Ga0068868_100351967 3300005338 Bacteria 1262
14 Ga0068868_100357087 3300005338 Bacteria 1253
15 Ga0070660_100006529 3300005339 Bacteria 8091
16 Ga0070660_100029940 3300005339 Bacteria 4081
17 Ga0070660_100045610 3300005339 Bacteria 3357
18 Ga0070660_100211440 3300005339 Unclassified 1575
19 Ga0070689_100010913 3300005340 Bacteria 6491
20 Ga0070691_10138511 3300005341 Bacteria 1238
21 Ga0070661_100285649 3300005344 Bacteria 1281
22 Ga0070692_10035696 3300005345 Bacteria 2518
23 Ga0070671_100054421 3300005355 Bacteria 3328
24 Ga0070671_100240998 3300005355 Bacteria 1535
25 Ga0070674_100007084 3300005356 Bacteria 6593
26 Ga0070688_100057258 3300005365 Bacteria 2449
27 Ga0070703_10006097 3300005406 Bacteria 3375
28 Ga0070709_10005401 3300005434 Bacteria 6921
29 Ga0070709_10065683 3300005434 Bacteria 2324
30 Ga0070714_100030031 3300005435 Bacteria 4522
31 Ga0070714_100078840 3300005435 Bacteria 2863
32 Ga0070713_100014717 3300005436 Bacteria 5820
33 Ga0070710_10002439 3300005437 Bacteria 8805
34 Ga0070710_10002489 3300005437 Bacteria 8728
35 Ga0070710_10033631 3300005437 Bacteria 2785
36 Ga0070711_100052325 3300005439 Bacteria 2810
37 Ga0070700_100003209 3300005441 Bacteria 8404
38 Ga0070700_100076860 3300005441 Bacteria 2145
39 Ga0070694_100124236 3300005444 Unclassified 1856
40 Ga0070708_100198389 3300005445 Bacteria 1878
41 Ga0070663_100004406 3300005455 Bacteria 8275
42 Ga0070663_100013128 3300005455 Bacteria 5266
43 Ga0070678_100017524 3300005456 Bacteria 4615
44 Ga0070678_100050861 3300005456 Bacteria 3000
45 Ga0070662_100081941 3300005457 Bacteria 2405
46 Ga0070681_10038994 3300005458 Bacteria 4763
47 Ga0070681_10039844 3300005458 Bacteria 4710
48 Ga0070681_10189976 3300005458 Bacteria 1973
49 Ga0068867_100012894 3300005459 Bacteria 5914
50 Ga0070685_10008552 3300005466 Bacteria 5266
51 Ga0070706_100180644 3300005467 Bacteria 1970
52 Ga0070707_100002052 3300005468 Bacteria 19287
53 Ga0070707_100003196 3300005468 Bacteria 15507
54 Ga0070707_100007352 3300005468 Bacteria 10231
55 Ga0070707_100025535 3300005468 Bacteria 5605
56 Ga0070698_100057843 3300005471 Bacteria 3922
57 Ga0070679_100052125 3300005530 Bacteria 4076
58 Ga0070679_100259794 3300005530 Bacteria 1692
59 Ga0070684_100004520 3300005535 Bacteria 10592
60 Ga0070684_100016975 3300005535 Bacteria 5965
61 Ga0070684_100149575 3300005535 Bacteria 2114
62 Ga0070684_100403442 3300005535 Bacteria 1261
63 Ga0070697_100198587 3300005536 Bacteria 1704
64 Ga0068853_100003440 3300005539 Bacteria 12112
65 Ga0070686_100008254 3300005544 Bacteria 5830
66 Ga0070686_100171890 3300005544 Bacteria 1533
67 Ga0070686_100235834 3300005544 Bacteria 1329
68 Ga0070695_100141044 3300005545 Bacteria 1671
69 Ga0070696_100051397 3300005546 Bacteria 2866
70 Ga0070696_100160948 3300005546 Bacteria 1654
71 Ga0070693_100046905 3300005547 Bacteria 2456
72 Ga0070693_100056869 3300005547 Bacteria 2259
73 Ga0070693_100132898 3300005547 Bacteria 1558
74 Ga0068855_100039066 3300005563 Bacteria 5635
75 Ga0068855_100308813 3300005563 Bacteria 1750
76 Ga0068855_100868666 3300005563 Unclassified 955
77 Ga0070664_100080493 3300005564 Bacteria 2806
78 Ga0068856_100011940 3300005614 Bacteria 8411
79 Ga0068856_100099003 3300005614 Bacteria 2906
80 Ga0068856_100107312 3300005614 Bacteria 2788
81 Ga0068856_100534522 3300005614 Bacteria 1193
82 Ga0070702_100020082 3300005615 Bacteria 3495
83 Ga0070702_100044347 3300005615 Bacteria 2510
84 Ga0068852_100032908 3300005616 Bacteria 4299
85 Ga0068864_100329090 3300005618 Unclassified 1437
86 Ga0068866_10013132 3300005718 Bacteria 3624
87 Ga0068861_100329670 3300005719 Bacteria 1332
88 Ga0068860_100351925 3300005843 Unclassified 1450
89 Ga0081455_10086444 3300005937 Bacteria 2554
90 Ga0081455_10128475 3300005937 Bacteria 1985
91 Ga0081538_10000093 3300005981 Bacteria 86826
92 Ga0081538_10012890 3300005981 Bacteria 6664
93 Ga0081538_10043903 3300005981 Bacteria 2798
94 Ga0081538_10077184 3300005981 Unclassified 1795
95 Ga0081539_10000994 3300005985 Bacteria 52643
96 Ga0070717_10009184 3300006028 Bacteria 7430
97 Ga0075365_10050756 3300006038 Bacteria 2737
98 Ga0070715_10000693 3300006163 Bacteria 9038
99 Ga0070715_10017900 3300006163 Bacteria 2690
100 Ga0070716_100036196 3300006173 Bacteria 2720
101 Ga0070716_100046478 3300006173 Bacteria 2443
102 Ga0070712_100007859 3300006175 Bacteria 6682
103 Ga0070712_100440547 3300006175 Bacteria 1083
104 Ga0097621_100050535 3300006237 Bacteria 3381
105 Ga0097621_100353159 3300006237 Bacteria 1308
106 Ga0068871_100008441 3300006358 Bacteria 7410
107 Ga0068871_100012924 3300006358 Bacteria 6182
108 Ga0075430_100037685 3300006846 Bacteria 4098
109 Ga0075431_100028161 3300006847 Bacteria 5769
110 Ga0075433_10013158 3300006852 Bacteria 6716
111 Ga0075433_10083516 3300006852 Bacteria 2819
112 Ga0075433_10466959 3300006852 Bacteria 1112
113 Ga0075434_100019253 3300006871 Bacteria 6603
114 Ga0075434_100029828 3300006871 Bacteria 5369
115 Ga0075434_100336661 3300006871 Bacteria 1530
116 Ga0068865_100007707 3300006881 Bacteria 6634
117 Ga0075436_100058077 3300006914 Bacteria 2672
118 Ga0075436_100097630 3300006914 Bacteria 2044
119 Ga0075435_100011999 3300007076 Bacteria 6402
120 Ga0075435_100013955 3300007076 Bacteria 5991
121 Ga0075435_100102366 3300007076 Bacteria 2374
122 Ga0075435_100263902 3300007076 Bacteria 1468
123 Ga0105240_10126112 3300009093 Bacteria 3076
124 Ga0111539_10993080 3300009094 Bacteria 976
125 Ga0105245_10060649 3300009098 Bacteria 3407
126 Ga0105245_10081316 3300009098 Bacteria 2961
127 Ga0105245_10123716 3300009098 Bacteria 2419
128 Ga0105245_10184514 3300009098 Bacteria 1995
129 Ga0105245_10233203 3300009098 Bacteria 1781
130 Ga0105245_10413601 3300009098 Unclassified 1350
131 Ga0114129_10069767 3300009147 Bacteria 4899
132 Ga0114129_10710115 3300009147 Bacteria 1291
133 Ga0114129_10801318 3300009147 Bacteria 1202
134 Ga0105243_10027232 3300009148 Bacteria 4378
135 Ga0105243_10282546 3300009148 Unclassified 1496
136 Ga0105241_10046895 3300009174 Bacteria 3283
137 Ga0105241_10333249 3300009174 Bacteria 1312
138 Ga0105242_10028328 3300009176 Bacteria 4458
139 Ga0105242_10040118 3300009176 Bacteria 3772
140 Ga0105242_10178770 3300009176 Bacteria 1870
141 Ga0105242_10324489 3300009176 Bacteria 1413
142 Ga0105242_10388219 3300009176 Bacteria 1299
143 Ga0105248_10018694 3300009177 Bacteria 7662
144 Ga0105248_10340077 3300009177 Bacteria 1690
145 Ga0105237_10032092 3300009545 Bacteria 5318
146 Ga0105249_10046133 3300009553 Bacteria 3966
147 Ga0105239_10136934 3300010375 Bacteria 2726
148 Ga0105246_10126582 3300011119 Bacteria 1901
149 Ga0157374_10013759 3300013296 Bacteria 7068
150 Ga0157374_10301279 3300013296 Bacteria 1586
151 Ga0157374_10422231 3300013296 Bacteria 1332
152 Ga0157378_10005818 3300013297 Bacteria 10810
153 Ga0157378_10246002 3300013297 Bacteria 1710
154 Ga0163162_10007581 3300013306 Bacteria 10566
155 Ga0163162_10170244 3300013306 Bacteria 2303
156 Ga0157372_10005383 3300013307 Bacteria 13609
157 Ga0157372_10257303 3300013307 Bacteria 2027
158 Ga0157372_10496345 3300013307 Bacteria 1423
159 Ga0157375_10048489 3300013308 Bacteria 4155
160 Ga0163163_10213973 3300014325 Bacteria 1976
161 Ga0157380_10100925 3300014326 Bacteria 2403
162 Ga0182008_10073800 3300014497 Bacteria 1678
163 Ga0157377_10027974 3300014745 Bacteria 3031
164 Ga0157377_10298828 3300014745 Bacteria 1062
165 Ga0157379_10069466 3300014968 Bacteria 3150
166 Ga0157376_10014532 3300014969 Bacteria 5914
167 Ga0157376_10123921 3300014969 Bacteria 2295
168 Ga0157376_10333316 3300014969 Bacteria 1446
169 Ga0163161_10031691 3300017792 Bacteria 3768
170 Ga0213875_10042897 3300021388 Bacteria 2125
171 Ga0213871_10005246 3300021441 Bacteria 2657
172 Ga0207653_10066812 3300025885 Unclassified 1222
173 Ga0207692_10000183 3300025898 Bacteria 20352
174 Ga0207642_10090980 3300025899 Bacteria 1507
175 Ga0207680_10035526 3300025903 Bacteria 2862
176 Ga0207647_10103118 3300025904 Unclassified 1692
177 Ga0207685_10004369 3300025905 Bacteria 3586
178 Ga0207685_10032079 3300025905 Bacteria 1888
179 Ga0207699_10001442 3300025906 Bacteria 11280
180 Ga0207699_10042709 3300025906 Bacteria 2629
181 Ga0207654_10045266 3300025911 Bacteria 2503
182 Ga0207654_10136332 3300025911 Bacteria 1560
183 Ga0207654_10148957 3300025911 Bacteria 1500
184 Ga0207707_10051652 3300025912 Bacteria 3580
185 Ga0207707_10429889 3300025912 Bacteria 1131
186 Ga0207693_10001648 3300025915 Bacteria 19690
187 Ga0207693_10011287 3300025915 Bacteria 7233
188 Ga0207663_10001302 3300025916 Bacteria 11566
189 Ga0207663_10004527 3300025916 Bacteria 6921
190 Ga0207663_10011611 3300025916 Bacteria 4736
191 Ga0207660_10075447 3300025917 Unclassified 2464
192 Ga0207662_10130548 3300025918 Bacteria 1584
193 Ga0207657_10013886 3300025919 Bacteria 7881
194 Ga0207657_10016939 3300025919 Bacteria 7012
195 Ga0207657_10024464 3300025919 Bacteria 5588
196 Ga0207649_10270126 3300025920 Bacteria 1232
197 Ga0207652_10217086 3300025921 Bacteria 1723
198 Ga0207652_10297873 3300025921 Bacteria 1455
199 Ga0207646_10001064 3300025922 Bacteria 34921
200 Ga0207646_10007544 3300025922 Bacteria 11033
201 Ga0207646_10009177 3300025922 Bacteria 9807
202 Ga0207687_10079238 3300025927 Bacteria 2368
203 Ga0207687_10099835 3300025927 Bacteria 2134
204 Ga0207687_10129416 3300025927 Bacteria 1900
205 Ga0207687_10143649 3300025927 Bacteria 1813
206 Ga0207700_10056099 3300025928 Bacteria 2964
207 Ga0207700_10090370 3300025928 Bacteria 2416
208 Ga0207664_10006791 3300025929 Bacteria 7908
209 Ga0207664_10026928 3300025929 Bacteria 4352
210 Ga0207644_10072637 3300025931 Bacteria 2520
211 Ga0207690_10077819 3300025932 Bacteria 2306
212 Ga0207706_10040191 3300025933 Bacteria 4145
213 Ga0207706_10045996 3300025933 Bacteria 3865
214 Ga0207686_10109444 3300025934 Bacteria 1861
215 Ga0207686_10127633 3300025934 Bacteria 1740
216 Ga0207686_10238965 3300025934 Bacteria 1321
217 Ga0207709_10003783 3300025935 Bacteria 8887
218 Ga0207704_10002386 3300025938 Bacteria 8432
219 Ga0207665_10002182 3300025939 Bacteria 13225
220 Ga0207665_10002321 3300025939 Bacteria 12842
221 Ga0207665_10005879 3300025939 Bacteria 8162
222 Ga0207691_10035862 3300025940 Bacteria 4599
223 Ga0207711_10281878 3300025941 Bacteria 1531
224 Ga0207661_10021382 3300025944 Bacteria 4846
225 Ga0207661_10067772 3300025944 Bacteria 2903
226 Ga0207661_10540791 3300025944 Bacteria 1067
227 Ga0207667_10090738 3300025949 Bacteria 3157
228 Ga0207667_10284342 3300025949 Bacteria 1690
229 Ga0207640_10077204 3300025981 Bacteria 2263
230 Ga0207640_10264521 3300025981 Bacteria 1342
231 Ga0207658_10237555 3300025986 Unclassified 1542
232 Ga0207639_10009371 3300026041 Bacteria 6751
233 Ga0207678_10006120 3300026067 Bacteria 10700
234 Ga0207678_10021251 3300026067 Bacteria 5690
235 Ga0207708_10009375 3300026075 Bacteria 7247
236 Ga0207708_10093513 3300026075 Bacteria 2320
237 Ga0207702_10011023 3300026078 Bacteria 7543
238 Ga0207702_10013057 3300026078 Bacteria 6908
239 Ga0207702_10058148 3300026078 Bacteria 3290
240 Ga0207702_10063445 3300026078 Bacteria 3159
241 Ga0207702_10185856 3300026078 Bacteria 1916
242 Ga0207648_10004595 3300026089 Bacteria 14149
243 Ga0207674_10279056 3300026116 Bacteria 1619
244 Ga0207675_100051548 3300026118 Bacteria 3839
245 Ga0207675_100728701 3300026118 Bacteria 1002
246 Ga0207683_10000828 3300026121 Bacteria 28308
247 Ga0207683_10001893 3300026121 Bacteria 18520
248 Ga0207683_10013266 3300026121 Bacteria 7026
249 Ga0207698_10296111 3300026142 Bacteria 1504
250 Ga0207698_10540976 3300026142 Bacteria 1140
251 Ga0207428_10015376 3300027907 Bacteria 6621
252 Ga0207428_10297182 3300027907 Bacteria 1195
253 Ga0268266_10078669 3300028379 Bacteria 2870
254 Ga0265325_10032162 3300031241 Bacteria 2802
255 Ga0265327_10004441 3300031251 Bacteria 12419
256 Ga0307416_100035686 3300032002 Bacteria 3802
257 Ga0373932_0040792 3300035112 Bacteria 1338
258 Ga0373960_0052892 3300035121 Bacteria 1210
259 Ga0373943_0055954 3300035170 Bacteria 1956
260 Ga0373943_0105398 3300035170 Unclassified 1480
261 Ga0373931_0026240 3300035691 Bacteria 2964
262 Ga0373935_0118751 3300035692 Bacteria 1764
263 Ga0373947_0046543 3300035725 Bacteria 2598
264 Ga0373937_0109323 3300036401 Bacteria 2571
265 Ga0395899_0007050 3300037312 Bacteria 8697
266 Ga0395899_0008750 3300037312 Bacteria 7790
267 Ga0395899_0022670 3300037312 Bacteria 4756
268 Ga0395899_0039325 3300037312 Bacteria 3541
269 Ga0395900_0013173 3300037418 Bacteria 8452
270 Ga0395900_0017159 3300037418 Bacteria 7388
271 Ga0395900_0021595 3300037418 Bacteria 6581
272 Ga0395900_0025473 3300037418 Bacteria 6055
273 Ga0395900_0058936 3300037418 Bacteria 3953
274 Ga0395900_0066836 3300037418 Bacteria 3694
275 Ga0395900_0069838 3300037418 Bacteria 3611
276 Ga0395900_0089281 3300037418 Bacteria 3168
277 Ga0395900_0102590 3300037418 Bacteria 2938
278 Ga0395900_0111259 3300037418 Bacteria 2813
279 Ga0395900_0373006 3300037418 Bacteria 1396
280 Ga0395898_0007086 3300037466 Bacteria 11909
281 Ga0395898_0014090 3300037466 Bacteria 8216
282 Ga0395898_0014934 3300037466 Bacteria 7975
283 Ga0395898_0033656 3300037466 Bacteria 5111
284 Ga0395898_0042899 3300037466 Bacteria 4460
285 Ga0395898_0070871 3300037466 Bacteria 3369
286 Ga0395898_0166976 3300037466 Bacteria 2104
287 Ga0395898_0297910 3300037466 Bacteria 1538
288 Ga0395898_0392659 3300037466 Unclassified 1323
289 Ga0395898_0400591 3300037466 Unclassified 1308
290 Ga0395905_0020210 3300037471 Bacteria 6308
291 Ga0395905_0020806 3300037471 Bacteria 6213
292 Ga0395905_0023955 3300037471 Bacteria 5764
293 Ga0395905_0024149 3300037471 Bacteria 5737
294 Ga0395905_0027414 3300037471 Bacteria 5372
295 Ga0395905_0054407 3300037471 Bacteria 3746
296 Ga0395905_0078718 3300037471 Bacteria 3089
297 Ga0395905_0083612 3300037471 Bacteria 2990
298 Ga0395905_0096039 3300037471 Bacteria 2782
299 Ga0395905_0233297 3300037471 Bacteria 1720
300 Ga0436364_0943622 3300037853 Bacteria 6464
301 Ga0395901_0003369 3300038443 Bacteria 16101
302 Ga0395901_0006499 3300038443 Bacteria 11831
303 Ga0395901_0031585 3300038443 Bacteria 5459
304 Ga0395901_0031990 3300038443 Bacteria 5427
305 Ga0395901_0041987 3300038443 Bacteria 4740
306 Ga0395901_0088134 3300038443 Bacteria 3245
307 Ga0395901_0171025 3300038443 Bacteria 2280
308 Ga0395901_0199238 3300038443 Unclassified 2099
309 Ga0395901_0465183 3300038443 Bacteria 1292
310 Ga0436365_0264196 3300039437 Bacteria 4374
311 Ga0436365_0728831 3300039437 Unclassified 3181
312 Ga0436360_0611617 3300039438 Bacteria 12440
313 Ga0436362_1186170 3300039453 Bacteria 2533
314 Ga0439453_0001357 3300041408 Bacteria 3124
315 Ga0451853_0739805 3300041512 Bacteria 1719
316 Ga0439451_001635 3300042009 Bacteria 4450
317 Ga0450920_007189 3300042122 Bacteria 2014
318 Ga0450918_012133 3300042531 Bacteria 1502
319 Ga0466969_0000664 3300044656 Bacteria 18686
320 Ga0466965_0042297 3300044683 Bacteria 2247
321 Ga0466966_0100797 3300044684 Bacteria 1786
322 Ga0466963_0005452 3300044694 Bacteria 7452
323 Ga0466963_0013589 3300044694 Bacteria 5001
324 Ga0466964_0039208 3300044706 Bacteria 1907
325 Ga0466968_0006623 3300044735 Bacteria 4374
326 Ga0466970_0005126 3300044765 Bacteria 6473
327 Ga0466957_0012927 3300044842 Bacteria 4837
328 Ga0466957_0072486 3300044842 Bacteria 2132
329 Ga0466960_0107867 3300044901 Unclassified 1443
330 Ga0466960_0166832 3300044901 Bacteria 1186
331 Ga0466959_0064793 3300045049 Bacteria 2652
332 Ga0451576_0150535 3300045051 Bacteria 2427
333 Ga0466958_0002089 3300045836 Bacteria 9888
334 Ga0466958_0067688 3300045836 Bacteria 2182
335 Ga0466967_0062537 3300045976 Bacteria 3304
336 Ga0466967_0062563 3300045976 Bacteria 3304
337 Ga0466967_0118448 3300045976 Bacteria 2442
338 Ga0466967_0907091 3300045976 Bacteria 876
339 Ga0495603_0124013 3300046455 Bacteria 1505
340 Ga0495629_0047977 3300046459 Bacteria 2995
341 Ga0495629_0222154 3300046459 Unclassified 1303
342 Ga0495641_0027475 3300046461 Bacteria 2767
343 Ga0495641_0031718 3300046461 Bacteria 2522
344 Ga0495641_0096943 3300046461 Bacteria 1316
345 Ga0495641_0224497 3300046461 Bacteria 843
346 Ga0495653_0059283 3300046463 Bacteria 2906
347 Ga0495580_0277836 3300046472 Unclassified 1143
348 Ga0495582_0012788 3300046473 Bacteria 4624
349 Ga0495582_0100236 3300046473 Unclassified 1621
350 Ga0495582_0153799 3300046473 Bacteria 1307
351 Ga0495582_0169797 3300046473 Bacteria 1241
352 Ga0495662_0029216 3300046476 Bacteria 2662
353 Ga0495584_0153123 3300046491 Viruses 1171
354 Ga0495594_0092360 3300046499 Bacteria 1697
355 Ga0495594_0196451 3300046499 Bacteria 1150
356 Ga0495608_0052188 3300046511 Bacteria 2707
357 Ga0495644_0049399 3300046523 Viruses 1579
358 Ga0495663_0084130 3300046525 Viruses 1028
359 Ga0495666_0065552 3300046526 Unclassified 1732
360 Ga0495642_0023348 3300046528 Unclassified 2441
361 Ga0495665_0059957 3300046531 Bacteria 2009
362 Ga0495586_0002307 3300046535 Bacteria 10374
363 Ga0495586_0020174 3300046535 Bacteria 3550
364 Ga0495609_0073762 3300046538 Bacteria 1497
365 Ga0495667_0018788 3300046559 Bacteria 4666
366 Ga0495656_0175812 3300046615 Unclassified 1049
367 Ga0495634_0015842 3300046642 Bacteria 5403
368 Ga0495634_0062244 3300046642 Bacteria 2478
369 Ga0495635_0053979 3300046663 Bacteria 2768
370 Ga0495659_0040955 3300046664 Bacteria 1653
371 Ga0495661_0197385 3300046665 Unclassified 1056
372 Ga0495657_0001914 3300046675 Bacteria 17716
373 Ga0495647_0034635 3300046681 Bacteria 1892
374 Ga0495647_0035998 3300046681 Bacteria 1861
375 Ga0495658_0007849 3300046683 Bacteria 5285
376 Ga0495658_0103047 3300046683 Bacteria 1706
377 Ga0495658_0198860 3300046683 Bacteria 1249
378 Ga0495658_0258841 3300046683 Bacteria 1095
379 Ga0495613_0003336 3300046689 Bacteria 12005
380 Ga0495613_0110803 3300046689 Bacteria 1978
381 Ga0495613_0112556 3300046689 Bacteria 1960
382 Ga0495613_0137344 3300046689 Bacteria 1748
383 Ga0495613_0228581 3300046689 Bacteria 1304
384 Ga0495624_0034592 3300046690 Bacteria 3267
385 Ga0495624_0045657 3300046690 Bacteria 2788
386 Ga0495670_0079640 3300046691 Bacteria 1668
387 Ga0495589_0137043 3300046794 Viruses 1173
388 Ga0495581_0020479 3300047315 Bacteria 3837
389 Ga0495581_0157743 3300047315 Bacteria 1326
390 Ga0495604_0106307 3300047317 Bacteria 2053
391 Ga0495674_0008466 3300047319 Bacteria 9800
392 Ga0495676_0184448 3300047321 Bacteria 1460
393 Ga0495676_0215640 3300047321 Bacteria 1325
394 Ga0495676_0276335 3300047321 Bacteria 1138
395 Ga0495680_0087749 3300047322 Bacteria 2339
396 Ga0495680_0163404 3300047322 Bacteria 1615
397 Ga0495685_025664 3300047447 Bacteria 2027
398 Ga0495684_0000896 3300047471 Bacteria 24097
399 Ga0495593_0089785 3300047673 Bacteria 1583
400 Ga0495602_0462773 3300048088 Bacteria 893
401 Ga0496100_0017745 3300048903 Bacteria 4209
402 Ga0496100_0020349 3300048903 Bacteria 3977
403 Ga0496100_0084678 3300048903 Bacteria 2149
404 Ga0496101_0026902 3300048904 Bacteria 4000
405 Ga0496101_0037580 3300048904 Bacteria 3435
406 Ga0496101_0047048 3300048904 Bacteria 3096
407 Ga0496101_0098360 3300048904 Bacteria 2186
408 Ga0496101_0108513 3300048904 Bacteria 2087
409 Ga0496101_0240496 3300048904 Bacteria 1409
410 Ga0496102_0005249 3300048905 Bacteria 10999
411 Ga0496102_0010468 3300048905 Bacteria 7983
412 Ga0496102_0037764 3300048905 Bacteria 4358
413 Ga0496102_0048567 3300048905 Bacteria 3859
414 Ga0496102_0068958 3300048905 Bacteria 3246
415 Ga0496102_0078955 3300048905 Bacteria 3030
416 Ga0496102_0088494 3300048905 Bacteria 2863
417 Ga0496103_0011946 3300048906 Bacteria 5156
418 Ga0496103_0037065 3300048906 Bacteria 2988
419 Ga0496103_0126751 3300048906 Bacteria 1628
420 Ga0496104_0000612 3300048907 Bacteria 30591
421 Ga0496104_0004845 3300048907 Bacteria 11730
422 Ga0496104_0009019 3300048907 Bacteria 8869
423 Ga0496104_0074469 3300048907 Bacteria 3232
424 Ga0496104_0146551 3300048907 Bacteria 2267
425 Ga0496104_0173844 3300048907 Bacteria 2064
426 Ga0496104_0391151 3300048907 Unclassified 1302
427 Ga0496104_0511098 3300048907 Unclassified 1112
428 Ga0496105_0000177 3300048908 Bacteria 42234
429 Ga0496105_0003127 3300048908 Bacteria 12182
430 Ga0496105_0015048 3300048908 Bacteria 6156
431 Ga0496105_0021366 3300048908 Bacteria 5238
432 Ga0496105_0051573 3300048908 Bacteria 3398
433 Ga0496105_0059049 3300048908 Bacteria 3165
434 Ga0496105_0062910 3300048908 Bacteria 3062
435 Ga0496105_0152746 3300048908 Bacteria 1897
436 Ga0496106_0002581 3300048909 Bacteria 13485
437 Ga0496106_0003628 3300048909 Bacteria 11511
438 Ga0496106_0030628 3300048909 Bacteria 4011
439 Ga0496106_0108913 3300048909 Bacteria 2155
440 Ga0496106_0231323 3300048909 Bacteria 1476
441 Ga0496106_0484550 3300048909 Bacteria 994
442 Ga0496107_0019992 3300048910 Bacteria 4728
443 Ga0496107_0032608 3300048910 Bacteria 3723
444 Ga0496107_0111518 3300048910 Bacteria 2010
445 Ga0496107_0112284 3300048910 Bacteria 2004
446 Ga0496107_0116230 3300048910 Bacteria 1969
447 Ga0496108_0010177 3300048911 Bacteria 7636
448 Ga0496108_0010665 3300048911 Bacteria 7454
449 Ga0496108_0018548 3300048911 Bacteria 5698
450 Ga0496108_0027072 3300048911 Bacteria 4730
451 Ga0496108_0030166 3300048911 Bacteria 4494
452 Ga0496108_0056017 3300048911 Bacteria 3311
453 Ga0496108_0092874 3300048911 Bacteria 2566
454 Ga0496108_0126882 3300048911 Bacteria 2191
455 Ga0496108_0143620 3300048911 Bacteria 2057
456 Ga0496108_0218086 3300048911 Bacteria 1657
457 Ga0496109_0000436 3300048912 Bacteria 36356
458 Ga0496109_0006902 3300048912 Bacteria 9578
459 Ga0496109_0014345 3300048912 Bacteria 6894
460 Ga0496109_0023308 3300048912 Bacteria 5492
461 Ga0496109_0044970 3300048912 Bacteria 4006
462 Ga0496109_0072251 3300048912 Bacteria 3169
463 Ga0496109_0109753 3300048912 Bacteria 2565
464 Ga0496109_0144369 3300048912 Bacteria 2226
465 Ga0496109_0213973 3300048912 Unclassified 1812
466 Ga0496109_0225787 3300048912 Bacteria 1761
467 Ga0496110_0001332 3300048913 Bacteria 17744
468 Ga0496110_0001447 3300048913 Bacteria 17187
469 Ga0496110_0004507 3300048913 Bacteria 10805
470 Ga0496110_0023446 3300048913 Bacteria 5249
471 Ga0496110_0050858 3300048913 Bacteria 3640
472 Ga0496110_0057604 3300048913 Bacteria 3421
473 Ga0496110_0063480 3300048913 Bacteria 3264
474 Ga0496110_0097662 3300048913 Bacteria 2632
475 Ga0496110_0100093 3300048913 Bacteria 2598
476 Ga0496110_0147160 3300048913 Bacteria 2131
477 Ga0496110_0153684 3300048913 Bacteria 2084
478 Ga0496110_0254232 3300048913 Bacteria 1599
479 Ga0496110_0323489 3300048913 Unclassified 1405
480 Ga0496111_0006604 3300048914 Bacteria 7546
481 Ga0496111_0006845 3300048914 Bacteria 7436
482 Ga0496111_0010572 3300048914 Bacteria 6200
483 Ga0496111_0044959 3300048914 Bacteria 3175
484 Ga0496111_0062449 3300048914 Bacteria 2701
485 Ga0496112_0012843 3300048915 Bacteria 7709
486 Ga0496112_0012984 3300048915 Bacteria 7677
487 Ga0496112_0017552 3300048915 Bacteria 6727
488 Ga0496112_0021771 3300048915 Bacteria 6100
489 Ga0496112_0150940 3300048915 Bacteria 2291
490 Ga0496112_0220583 3300048915 Bacteria 1852
491 Ga0496112_0296906 3300048915 Bacteria 1561
492 Ga0496112_0343163 3300048915 Bacteria 1436
493 Ga0496112_0567140 3300048915 Unclassified 1068
494 Ga0496113_0018745 3300048916 Bacteria 4826
495 Ga0496113_0032008 3300048916 Bacteria 3820
496 Ga0496113_0041376 3300048916 Bacteria 3401
497 Ga0496113_0043443 3300048916 Bacteria 3326
498 Ga0496113_0059819 3300048916 Bacteria 2871
499 Ga0496113_0229457 3300048916 Bacteria 1480
500 Ga0496113_0261773 3300048916 Bacteria 1382
501 Ga0496114_0004672 3300048917 Bacteria 10646
502 Ga0496114_0008994 3300048917 Bacteria 7917
503 Ga0496114_0009231 3300048917 Bacteria 7819
504 Ga0496114_0033486 3300048917 Bacteria 4234
505 Ga0496114_0129383 3300048917 Bacteria 2179
506 Ga0496114_0144641 3300048917 Bacteria 2060
507 Ga0496114_0419267 3300048917 Bacteria 1186
508 Ga0496115_0002509 3300048918 Bacteria 13178
509 Ga0496115_0011144 3300048918 Bacteria 6738
510 Ga0496115_0016612 3300048918 Bacteria 5608
511 Ga0496115_0021887 3300048918 Bacteria 4944
512 Ga0496115_0024753 3300048918 Bacteria 4668
513 Ga0496115_0124891 3300048918 Bacteria 2119
514 Ga0496115_0434604 3300048918 Unclassified 1062
515 Ga0501032_0030116 3300049569 Bacteria 3723
516 Ga0501033_0032200 3300049570 Bacteria 3937
517 Ga0501036_0034576 3300049572 Bacteria 4275
518 Ga0501037_0103060 3300049573 Bacteria 2058
519 Ga0501039_0014109 3300049575 Bacteria 6117
520 Ga0501040_0010807 3300049576 Bacteria 5966
521 Ga0501040_0016648 3300049576 Bacteria 4872
522 Ga0501041_0036221 3300049577 Bacteria 2990
523 Ga0501046_0004852 3300049580 Bacteria 12117
524 Ga0501046_0081319 3300049580 Bacteria 2502
525 Ga0501067_0009077 3300049583 Bacteria 5506
526 Ga0501068_0006965 3300049584 Bacteria 6251
527 Ga0501069_0019302 3300049585 Bacteria 3685
528 Ga0501070_0011072 3300049586 Bacteria 7613
529 Ga0501071_0006872 3300049587 Bacteria 7414
530 Ga0501072_0009495 3300049588 Bacteria 7397
531 Ga0501073_0092938 3300049589 Bacteria 2096
532 Ga0501074_0349039 3300049590 Unclassified 1050
533 Ga0501075_0002430 3300049591 Bacteria 12397
534 Ga0501075_0053691 3300049591 Bacteria 3031
535 Ga0501076_0040968 3300049592 Bacteria 3641
536 Ga0501077_0002422 3300049593 Bacteria 11188
537 Ga0501079_0049589 3300049741 Bacteria 3240
538 Ga0501080_0009025 3300049742 Bacteria 9075
539 Ga0501081_0003912 3300049743 Bacteria 9542
540 Ga0501083_0056374 3300049744 Bacteria 2633
541 Ga0501035_0007322 3300049822 Bacteria 10319
542 Ga0501045_0005739 3300049824 Bacteria 8596
543 nmdc:mga03683_21285_c1 3300050489 Bacteria 2497
544 nmdc:mga0k408_164825_c1 3300050493 Unclassified 1320
545 nmdc:mga05p37_245266_c1 3300050507 Bacteria 2151
546 nmdc:mga05p37_590530_c1 3300050507 Unclassified 1256
547 nmdc:mga05p37_9453_c1 3300050507 Bacteria 10644
548 nmdc:mga09592_77291_c1 3300050508 Bacteria 2832
549 nmdc:mga0qj67_201584_c1 3300050509 Bacteria 1617
550 nmdc:mga06r32_38913_c1 3300050510 Bacteria 4509
551 nmdc:mga06r32_419074_c1 3300050510 Bacteria 1320
552 nmdc:mga08y16_261954_c1 3300050511 Bacteria 1785
553 nmdc:mga08y16_351272_c1 3300050511 Bacteria 1515
554 nmdc:mga0n895_13310_c1 3300050512 Bacteria 7418
555 nmdc:mga0n895_333229_c1 3300050512 Bacteria 1537
556 nmdc:mga0n895_526064_c1 3300050512 Bacteria 1190
557 nmdc:mga0n895_544622_c1 3300050512 Unclassified 1166
558 nmdc:mga0n895_647446_c1 3300050512 Bacteria 1056
559 nmdc:mga0n895_6853_c1 3300050512 Bacteria 9728
560 nmdc:mga0rr50_221288_c1 3300050513 Bacteria 1563
561 nmdc:mga0rr50_224230_c1 3300050513 Bacteria 1553
562 nmdc:mga0rr50_91888_c1 3300050513 Bacteria 2365
563 nmdc:mga08x19_349257_c1 3300050514 Bacteria 1032
564 nmdc:mga08x19_82177_c1 3300050514 Bacteria 2116
565 nmdc:mga0a205_270158_c1 3300050515 Bacteria 1577
566 nmdc:mga0a205_66553_c1 3300050515 Bacteria 3481
567 Ga0495612_0116705 3300053078 Unclassified 1146
568 Ga0495595_0006893 3300053084 Bacteria 4636
569 Ga0495619_0157506 3300053085 Bacteria 1568
570 Ga0495619_0188993 3300053085 Bacteria 1425
571 Ga0501084_0058741 3300054114 Bacteria 3218
572 Ga0501084_0095337 3300054114 Bacteria 2499
573 Ga0501082_0006826 3300060353 Bacteria 9868
574 Ga0530510_0011044 3300061734 Bacteria 6334
575 Ga0530510_0047850 3300061734 Bacteria 3090
576 Ga0495629_0045553
577 Ga0070658_10018904
578 Ga0070683_100004726
579 Ga0070683_100010003
580 Ga0070690_100050070
581 Ga0070690_100134711
582 Ga0070680_100040367
583 Ga0070680_100123011
584 Ga0070680_100133282
585 Ga0070682_100003272
586 Ga0070682_100130299
587 Ga0068868_100006553
588 Ga0068868_100351967
589 Ga0068868_100357087
590 Ga0070660_100006529
591 Ga0070660_100029940
592 Ga0070660_100045610
593 Ga0070660_100211440
594 Ga0070689_100010913
595 Ga0070691_10138511
596 Ga0070661_100285649
597 Ga0070692_10035696
598 Ga0070671_100054421
599 Ga0070671_100240998
600 Ga0070674_100007084
601 Ga0070688_100057258
602 Ga0070703_10006097
603 Ga0070709_10005401
604 Ga0070709_10065683
605 Ga0070714_100030031
606 Ga0070714_100078840
607 Ga0070713_100014717
608 Ga0070710_10002439
609 Ga0070710_10002489
610 Ga0070710_10033631
611 Ga0070711_100052325
612 Ga0070700_100003209
613 Ga0070700_100076860
614 Ga0070694_100124236
615 Ga0070708_100198389
616 Ga0070663_100004406
617 Ga0070663_100013128
618 Ga0070678_100017524
619 Ga0070678_100050861
620 Ga0070662_100081941
621 Ga0070681_10038994
622 Ga0070681_10039844
623 Ga0070681_10189976
624 Ga0068867_100012894
625 Ga0070685_10008552
626 Ga0070706_100180644
627 Ga0070707_100002052
628 Ga0070707_100003196
629 Ga0070707_100007352
630 Ga0070707_100025535
631 Ga0070698_100057843
632 Ga0070679_100052125
633 Ga0070679_100259794
634 Ga0070684_100004520
635 Ga0070684_100016975
636 Ga0070684_100149575
637 Ga0070684_100403442
638 Ga0070697_100198587
639 Ga0068853_100003440
640 Ga0070686_100008254
641 Ga0070686_100171890
642 Ga0070686_100235834
643 Ga0070695_100141044
644 Ga0070696_100051397
645 Ga0070696_100160948
646 Ga0070693_100046905
647 Ga0070693_100056869
648 Ga0070693_100132898
649 Ga0068855_100039066
650 Ga0068855_100308813
651 Ga0068855_100868666
652 Ga0070664_100080493
653 Ga0068856_100011940
654 Ga0068856_100099003
655 Ga0068856_100107312
656 Ga0068856_100534522
657 Ga0070702_100020082
658 Ga0070702_100044347
659 Ga0068852_100032908
660 Ga0068864_100329090
661 Ga0068866_10013132
662 Ga0068861_100329670
663 Ga0068860_100351925
664 Ga0081455_10086444
665 Ga0081455_10128475
666 Ga0081538_10000093
667 Ga0081538_10012890
668 Ga0081538_10043903
669 Ga0081538_10077184
670 Ga0081539_10000994
671 Ga0070717_10009184
672 Ga0075365_10050756
673 Ga0070715_10000693
674 Ga0070715_10017900
675 Ga0070716_100036196
676 Ga0070716_100046478
677 Ga0070712_100007859
678 Ga0070712_100440547
679 Ga0097621_100050535
680 Ga0097621_100353159
681 Ga0068871_100008441
682 Ga0068871_100012924
683 Ga0075430_100037685
684 Ga0075431_100028161
685 Ga0075433_10013158
686 Ga0075433_10083516
687 Ga0075433_10466959
688 Ga0075434_100019253
689 Ga0075434_100029828
690 Ga0075434_100336661
691 Ga0068865_100007707
692 Ga0075436_100058077
693 Ga0075436_100097630
694 Ga0075435_100011999
695 Ga0075435_100013955
696 Ga0075435_100102366
697 Ga0075435_100263902
698 Ga0105240_10126112
699 Ga0111539_10993080
700 Ga0105245_10060649
701 Ga0105245_10081316
702 Ga0105245_10123716
703 Ga0105245_10184514
704 Ga0105245_10233203
705 Ga0105245_10413601
706 Ga0114129_10069767
707 Ga0114129_10710115
708 Ga0114129_10801318
709 Ga0105243_10027232
710 Ga0105243_10282546
711 Ga0105241_10046895
712 Ga0105241_10333249
713 Ga0105242_10028328
714 Ga0105242_10040118
715 Ga0105242_10178770
716 Ga0105242_10324489
717 Ga0105242_10388219
718 Ga0105248_10018694
719 Ga0105248_10340077
720 Ga0105237_10032092
721 Ga0105249_10046133
722 Ga0105239_10136934
723 Ga0105246_10126582
724 Ga0157374_10013759
725 Ga0157374_10301279
726 Ga0157374_10422231
727 Ga0157378_10005818
728 Ga0157378_10246002
729 Ga0163162_10007581
730 Ga0163162_10170244
731 Ga0157372_10005383
732 Ga0157372_10257303
733 Ga0157372_10496345
734 Ga0157375_10048489
735 Ga0163163_10213973
736 Ga0157380_10100925
737 Ga0182008_10073800
738 Ga0157377_10027974
739 Ga0157377_10298828
740 Ga0157379_10069466
741 Ga0157376_10014532
742 Ga0157376_10123921
743 Ga0157376_10333316
744 Ga0163161_10031691
745 Ga0213875_10042897
746 Ga0213871_10005246
747 Ga0207653_10066812
748 Ga0207692_10000183
749 Ga0207642_10090980
750 Ga0207680_10035526
751 Ga0207647_10103118
752 Ga0207685_10004369
753 Ga0207685_10032079
754 Ga0207699_10001442
755 Ga0207699_10042709
756 Ga0207654_10045266
757 Ga0207654_10136332
758 Ga0207654_10148957
759 Ga0207707_10051652
760 Ga0207707_10429889
761 Ga0207693_10001648
762 Ga0207693_10011287
763 Ga0207663_10001302
764 Ga0207663_10004527
765 Ga0207663_10011611
766 Ga0207660_10075447
767 Ga0207662_10130548
768 Ga0207657_10013886
769 Ga0207657_10016939
770 Ga0207657_10024464
771 Ga0207649_10270126
772 Ga0207652_10217086
773 Ga0207652_10297873
774 Ga0207646_10001064
775 Ga0207646_10007544
776 Ga0207646_10009177
777 Ga0207687_10079238
778 Ga0207687_10099835
779 Ga0207687_10129416
780 Ga0207687_10143649
781 Ga0207700_10056099
782 Ga0207700_10090370
783 Ga0207664_10006791
784 Ga0207664_10026928
785 Ga0207644_10072637
786 Ga0207690_10077819
787 Ga0207706_10040191
788 Ga0207706_10045996
789 Ga0207686_10109444
790 Ga0207686_10127633
791 Ga0207686_10238965
792 Ga0207709_10003783
793 Ga0207704_10002386
794 Ga0207665_10002182
795 Ga0207665_10002321
796 Ga0207665_10005879
797 Ga0207691_10035862
798 Ga0207711_10281878
799 Ga0207661_10021382
800 Ga0207661_10067772
801 Ga0207661_10540791
802 Ga0207667_10090738
803 Ga0207667_10284342
804 Ga0207640_10077204
805 Ga0207640_10264521
806 Ga0207658_10237555
807 Ga0207639_10009371
808 Ga0207678_10006120
809 Ga0207678_10021251
810 Ga0207708_10009375
811 Ga0207708_10093513
812 Ga0207702_10011023
813 Ga0207702_10013057
814 Ga0207702_10058148
815 Ga0207702_10063445
816 Ga0207702_10185856
817 Ga0207648_10004595
818 Ga0207674_10279056
819 Ga0207675_100051548
820 Ga0207675_100728701
821 Ga0207683_10000828
822 Ga0207683_10001893
823 Ga0207683_10013266
824 Ga0207698_10296111
825 Ga0207698_10540976
826 Ga0207428_10015376
827 Ga0207428_10297182
828 Ga0268266_10078669
829 Ga0265325_10032162
830 Ga0265327_10004441
831 Ga0307416_100035686
832 Ga0373932_0040792
833 Ga0373960_0052892
834 Ga0373943_0055954
835 Ga0373943_0105398
836 Ga0373931_0026240
837 Ga0373935_0118751
838 Ga0373947_0046543
839 Ga0373937_0109323
840 Ga0395899_0007050
841 Ga0395899_0008750
842 Ga0395899_0022670
843 Ga0395899_0039325
844 Ga0395900_0013173
845 Ga0395900_0017159
846 Ga0395900_0021595
847 Ga0395900_0025473
848 Ga0395900_0058936
849 Ga0395900_0066836
850 Ga0395900_0069838
851 Ga0395900_0089281
852 Ga0395900_0102590
853 Ga0395900_0111259
854 Ga0395900_0373006
855 Ga0395898_0007086
856 Ga0395898_0014090
857 Ga0395898_0014934
858 Ga0395898_0033656
859 Ga0395898_0042899
860 Ga0395898_0070871
861 Ga0395898_0166976
862 Ga0395898_0297910
863 Ga0395898_0392659
864 Ga0395898_0400591
865 Ga0395905_0020210
866 Ga0395905_0020806
867 Ga0395905_0023955
868 Ga0395905_0024149
869 Ga0395905_0027414
870 Ga0395905_0054407
871 Ga0395905_0078718
872 Ga0395905_0083612
873 Ga0395905_0096039
874 Ga0395905_0233297
875 Ga0436364_0943622
876 Ga0395901_0003369
877 Ga0395901_0006499
878 Ga0395901_0031585
879 Ga0395901_0031990
880 Ga0395901_0041987
881 Ga0395901_0088134
882 Ga0395901_0171025
883 Ga0395901_0199238
884 Ga0395901_0465183
885 Ga0436365_0264196
886 Ga0436365_0728831
887 Ga0436360_0611617
888 Ga0436362_1186170
889 Ga0439453_0001357
890 Ga0451853_0739805
891 Ga0439451_001635
892 Ga0450920_007189
893 Ga0450918_012133
894 Ga0466969_0000664
895 Ga0466965_0042297
896 Ga0466966_0100797
897 Ga0466963_0005452
898 Ga0466963_0013589
899 Ga0466964_0039208
900 Ga0466968_0006623
901 Ga0466970_0005126
902 Ga0466957_0012927
903 Ga0466957_0072486
904 Ga0466960_0107867
905 Ga0466960_0166832
906 Ga0466959_0064793
907 Ga0451576_0150535
908 Ga0466958_0002089
909 Ga0466958_0067688
910 Ga0466967_0062537
911 Ga0466967_0062563
912 Ga0466967_0118448
913 Ga0466967_0907091
914 Ga0495603_0124013
915 Ga0495629_0047977
916 Ga0495629_0222154
917 Ga0495641_0027475
918 Ga0495641_0031718
919 Ga0495641_0096943
920 Ga0495641_0224497
921 Ga0495653_0059283
922 Ga0495580_0277836
923 Ga0495582_0012788
924 Ga0495582_0100236
925 Ga0495582_0153799
926 Ga0495582_0169797
927 Ga0495662_0029216
928 Ga0495584_0153123
929 Ga0495594_0092360
930 Ga0495594_0196451
931 Ga0495608_0052188
932 Ga0495644_0049399
933 Ga0495663_0084130
934 Ga0495666_0065552
935 Ga0495642_0023348
936 Ga0495665_0059957
937 Ga0495586_0002307
938 Ga0495586_0020174
939 Ga0495609_0073762
940 Ga0495667_0018788
941 Ga0495656_0175812
942 Ga0495634_0015842
943 Ga0495634_0062244
944 Ga0495635_0053979
945 Ga0495659_0040955
946 Ga0495661_0197385
947 Ga0495657_0001914
948 Ga0495647_0034635
949 Ga0495647_0035998
950 Ga0495658_0007849
951 Ga0495658_0103047
952 Ga0495658_0198860
953 Ga0495658_0258841
954 Ga0495613_0003336
955 Ga0495613_0110803
956 Ga0495613_0112556
957 Ga0495613_0137344
958 Ga0495613_0228581
959 Ga0495624_0034592
960 Ga0495624_0045657
961 Ga0495670_0079640
962 Ga0495589_0137043
963 Ga0495581_0020479
964 Ga0495581_0157743
965 Ga0495604_0106307
966 Ga0495674_0008466
967 Ga0495676_0184448
968 Ga0495676_0215640
969 Ga0495676_0276335
970 Ga0495680_0087749
971 Ga0495680_0163404
972 Ga0495685_025664
973 Ga0495684_0000896
974 Ga0495593_0089785
975 Ga0495602_0462773
976 Ga0496100_0017745
977 Ga0496100_0020349
978 Ga0496100_0084678
979 Ga0496101_0026902
980 Ga0496101_0037580
981 Ga0496101_0047048
982 Ga0496101_0098360
983 Ga0496101_0108513
984 Ga0496101_0240496
985 Ga0496102_0005249
986 Ga0496102_0010468
987 Ga0496102_0037764
988 Ga0496102_0048567
989 Ga0496102_0068958
990 Ga0496102_0078955
991 Ga0496102_0088494
992 Ga0496103_0011946
993 Ga0496103_0037065
994 Ga0496103_0126751
995 Ga0496104_0000612
996 Ga0496104_0004845
997 Ga0496104_0009019
998 Ga0496104_0074469
999 Ga0496104_0146551
1000 Ga0496104_0173844
1001 Ga0496104_0391151
1002 Ga0496104_0511098
1003 Ga0496105_0000177
1004 Ga0496105_0003127
1005 Ga0496105_0015048
1006 Ga0496105_0021366
1007 Ga0496105_0051573
1008 Ga0496105_0059049
1009 Ga0496105_0062910
1010 Ga0496105_0152746
1011 Ga0496106_0002581
1012 Ga0496106_0003628
1013 Ga0496106_0030628
1014 Ga0496106_0108913
1015 Ga0496106_0231323
1016 Ga0496106_0484550
1017 Ga0496107_0019992
1018 Ga0496107_0032608
1019 Ga0496107_0111518
1020 Ga0496107_0112284
1021 Ga0496107_0116230
1022 Ga0496108_0010177
1023 Ga0496108_0010665
1024 Ga0496108_0018548
1025 Ga0496108_0027072
1026 Ga0496108_0030166
1027 Ga0496108_0056017
1028 Ga0496108_0092874
1029 Ga0496108_0126882
1030 Ga0496108_0143620
1031 Ga0496108_0218086
1032 Ga0496109_0000436
1033 Ga0496109_0006902
1034 Ga0496109_0014345
1035 Ga0496109_0023308
1036 Ga0496109_0044970
1037 Ga0496109_0072251
1038 Ga0496109_0109753
1039 Ga0496109_0144369
1040 Ga0496109_0213973
1041 Ga0496109_0225787
1042 Ga0496110_0001332
1043 Ga0496110_0001447
1044 Ga0496110_0004507
1045 Ga0496110_0023446
1046 Ga0496110_0050858
1047 Ga0496110_0057604
1048 Ga0496110_0063480
1049 Ga0496110_0097662
1050 Ga0496110_0100093
1051 Ga0496110_0147160
1052 Ga0496110_0153684
1053 Ga0496110_0254232
1054 Ga0496110_0323489
1055 Ga0496111_0006604
1056 Ga0496111_0006845
1057 Ga0496111_0010572
1058 Ga0496111_0044959
1059 Ga0496111_0062449
1060 Ga0496112_0012843
1061 Ga0496112_0012984
1062 Ga0496112_0017552
1063 Ga0496112_0021771
1064 Ga0496112_0150940
1065 Ga0496112_0220583
1066 Ga0496112_0296906
1067 Ga0496112_0343163
1068 Ga0496112_0567140
1069 Ga0496113_0018745
1070 Ga0496113_0032008
1071 Ga0496113_0041376
1072 Ga0496113_0043443
1073 Ga0496113_0059819
1074 Ga0496113_0229457
1075 Ga0496113_0261773
1076 Ga0496114_0004672
1077 Ga0496114_0008994
1078 Ga0496114_0009231
1079 Ga0496114_0033486
1080 Ga0496114_0129383
1081 Ga0496114_0144641
1082 Ga0496114_0419267
1083 Ga0496115_0002509
1084 Ga0496115_0011144
1085 Ga0496115_0016612
1086 Ga0496115_0021887
1087 Ga0496115_0024753
1088 Ga0496115_0124891
1089 Ga0496115_0434604
1090 Ga0501032_0030116
1091 Ga0501033_0032200
1092 Ga0501036_0034576
1093 Ga0501037_0103060
1094 Ga0501039_0014109
1095 Ga0501040_0010807
1096 Ga0501040_0016648
1097 Ga0501041_0036221
1098 Ga0501046_0004852
1099 Ga0501046_0081319
1100 Ga0501067_0009077
1101 Ga0501068_0006965
1102 Ga0501069_0019302
1103 Ga0501070_0011072
1104 Ga0501071_0006872
1105 Ga0501072_0009495
1106 Ga0501073_0092938
1107 Ga0501074_0349039
1108 Ga0501075_0002430
1109 Ga0501075_0053691
1110 Ga0501076_0040968
1111 Ga0501077_0002422
1112 Ga0501079_0049589
1113 Ga0501080_0009025
1114 Ga0501081_0003912
1115 Ga0501083_0056374
1116 Ga0501035_0007322
1117 Ga0501045_0005739
1118 nmdc:mga03683_21285_c1
1119 nmdc:mga0k408_164825_c1
1120 nmdc:mga05p37_245266_c1
1121 nmdc:mga05p37_590530_c1
1122 nmdc:mga05p37_9453_c1
1123 nmdc:mga09592_77291_c1
1124 nmdc:mga0qj67_201584_c1
1125 nmdc:mga06r32_38913_c1
1126 nmdc:mga06r32_419074_c1
1127 nmdc:mga08y16_261954_c1
1128 nmdc:mga08y16_351272_c1
1129 nmdc:mga0n895_13310_c1
1130 nmdc:mga0n895_333229_c1
1131 nmdc:mga0n895_526064_c1
1132 nmdc:mga0n895_544622_c1
1133 nmdc:mga0n895_647446_c1
1134 nmdc:mga0n895_6853_c1
1135 nmdc:mga0rr50_221288_c1
1136 nmdc:mga0rr50_224230_c1
1137 nmdc:mga0rr50_91888_c1
1138 nmdc:mga08x19_349257_c1
1139 nmdc:mga08x19_82177_c1
1140 nmdc:mga0a205_270158_c1
1141 nmdc:mga0a205_66553_c1
1142 Ga0495612_0116705
1143 Ga0495595_0006893
1144 Ga0495619_0157506
1145 Ga0495619_0188993
1146 Ga0501084_0058741
1147 Ga0501084_0095337
1148 Ga0501082_0006826
1149 Ga0530510_0011044
1150 Ga0530510_0047850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

23

190

0.94

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

191

273

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c33-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease 0.9084 1 264
6c35-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d148n 0.9028 1 264
6c34-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease mutant d125n 0.902 1 264
6c36-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d208n 0.9019 1 264
6c33-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease 0.8925 1 264
ID Description Score Start End Superfamily
af_A8MQG8_313_403_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.934 166 232 1.10.150.20
af_P9WNU5_7_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9323 2 162 3.40.50.1010
af_P9WNU3_1_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9184 1 162 3.40.50.1010
af_Q2FXN9_1_169_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9123 1 160 3.40.50.1010
af_Q2FYJ1_1_174_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9118 2 162 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A537TLQ8-F1-model_v4 5'-3' exonuclease 0.9889 2 266 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A1E3W9X2-F1-model_v4 5'-3' exonuclease domain-containing protein 0.9865 36 268 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7W1BQ95-F1-model_v4 5'-3' exonuclease domain-containing protein 0.9829 1 268 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7Y5XXC8-F1-model_v4 DNA polymerase I 0.9827 2 221 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7W1BQ95-F1-model_v4 5'-3' exonuclease domain-containing protein 0.9793 1 268 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map