F465405

General Info

Members Datasets Scaffolds Average Seq Length
575 278 1150 334

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10178420|Ga0207693_101784202
Length 399
Sequence MTTRPVLESNVWTMRVRSSAMTAAGVLAPDANTPRRTRNRFSGPPRTADERNVGISAEVDVDVVGVVPSWAAWKKGPVRRVALVEEPHLRVLDGCASVYELAKSAILGGSKLGDLAKRRLTSERLEYDLVYGGKSEWQMLPPIDHPEEPTRCMISGTGLTHLGSARDRQSMHAAAKDEMTDSMKMFQSGKEGGRPDPGQIGIPPEWFYKGTGTTLRAHGQALDIPWYAEDGGEEAEVAGLYVIGPNGTPHRVGMAGGNEFSDHRFEKTNYLNLAGSKLRTCALGPELVLDPQFSSVPVQVEIERDSRILWSGTFRTGESEMCHSLRNLEHHHFKFEAHRRPGDVHVHFFGTDCLSFGAGIRLGNGDTIQVAFEGFGRPLRNVVHMSKSEAVPIEVNSLG

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
157 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 3.13
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 9.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10178420 3300025915 Bacteria 1671
2 MBSR1b_contig_7070244 2162886012 Bacteria 2039
3 rootH2_10202145 3300003320 Bacteria 2269
4 Ga0065715_10027140 3300005293 Bacteria 2125
5 Ga0065715_10090698 3300005293 Bacteria 6592
6 Ga0065707_10000566 3300005295 Bacteria 26530
7 Ga0070658_10003728 3300005327 Bacteria 12466
8 Ga0070683_100002076 3300005329 Bacteria 15816
9 Ga0070683_100009033 3300005329 Bacteria 8505
10 Ga0070683_100021235 3300005329 Bacteria 5792
11 Ga0070683_100055760 3300005329 Bacteria 3668
12 Ga0070683_100189837 3300005329 Bacteria 1951
13 Ga0070683_100265266 3300005329 Bacteria 1633
14 Ga0070683_100432186 3300005329 Bacteria 1256
15 Ga0070690_100021524 3300005330 Bacteria 3938
16 Ga0070670_100002622 3300005331 Bacteria 14852
17 Ga0070670_100165320 3300005331 Bacteria 1918
18 Ga0068869_100003330 3300005334 Bacteria 9817
19 Ga0068869_100043424 3300005334 Bacteria 3228
20 Ga0070666_10059657 3300005335 Bacteria 2581
21 Ga0070680_100028433 3300005336 Bacteria 4484
22 Ga0070680_100147763 3300005336 Bacteria 1972
23 Ga0068868_100000995 3300005338 Bacteria 19323
24 Ga0068868_100019961 3300005338 Bacteria 5027
25 Ga0068868_100192128 3300005338 Bacteria 1698
26 Ga0070660_100021389 3300005339 Bacteria 4770
27 Ga0070689_100009175 3300005340 Bacteria 7004
28 Ga0070689_100034736 3300005340 Bacteria 3847
29 Ga0070689_100218053 3300005340 Unclassified 1564
30 Ga0070661_100053750 3300005344 Bacteria 2948
31 Ga0070661_100079166 3300005344 Bacteria 2424
32 Ga0070669_100059018 3300005353 Bacteria 2817
33 Ga0070669_100147245 3300005353 Bacteria 1820
34 Ga0070675_100123179 3300005354 Unclassified 2204
35 Ga0070671_100073781 3300005355 Bacteria 2850
36 Ga0070673_100028858 3300005364 Unclassified 4131
37 Ga0070673_100214323 3300005364 Bacteria 1664
38 Ga0070688_100244455 3300005365 Bacteria 1275
39 Ga0070688_100271203 3300005365 Bacteria 1216
40 Ga0070659_100042570 3300005366 Unclassified 3551
41 Ga0070659_100069454 3300005366 Bacteria 2796
42 Ga0070659_100100097 3300005366 Bacteria 2332
43 Ga0070667_100094587 3300005367 Bacteria 2575
44 Ga0070667_100392223 3300005367 Bacteria 1262
45 Ga0070709_10000744 3300005434 Bacteria 18437
46 Ga0070709_10113504 3300005434 Bacteria 1825
47 Ga0070714_100000027 3300005435 Bacteria 141750
48 Ga0070714_100218030 3300005435 Bacteria 1752
49 Ga0070713_100000070 3300005436 Bacteria 64658
50 Ga0070713_100001120 3300005436 Bacteria 17094
51 Ga0070713_100001548 3300005436 Bacteria 14706
52 Ga0070713_100004604 3300005436 Bacteria 9296
53 Ga0070713_100054173 3300005436 Bacteria 3327
54 Ga0070713_100102191 3300005436 Bacteria 2485
55 Ga0070713_100287497 3300005436 Bacteria 1510
56 Ga0070713_100342638 3300005436 Bacteria 1385
57 Ga0070710_10029145 3300005437 Bacteria 2959
58 Ga0070701_10095010 3300005438 Bacteria 1641
59 Ga0070711_100000078 3300005439 Bacteria 54188
60 Ga0070711_100021517 3300005439 Bacteria 4172
61 Ga0070711_100027208 3300005439 Bacteria 3753
62 Ga0070711_100043713 3300005439 Bacteria 3036
63 Ga0070711_100090184 3300005439 Bacteria 2207
64 Ga0070705_100101973 3300005440 Bacteria 1814
65 Ga0070705_100221533 3300005440 Bacteria 1310
66 Ga0070700_100076156 3300005441 Bacteria 2154
67 Ga0070708_100066456 3300005445 Bacteria 3237
68 Ga0070663_100003913 3300005455 Bacteria 8682
69 Ga0070663_100082716 3300005455 Bacteria 2362
70 Ga0070662_100022197 3300005457 Bacteria 4341
71 Ga0070662_100118001 3300005457 Bacteria 2030
72 Ga0070681_10009094 3300005458 Bacteria 9761
73 Ga0070681_10019874 3300005458 Bacteria 6729
74 Ga0070681_10036358 3300005458 Bacteria 4945
75 Ga0070681_10057750 3300005458 Bacteria 3861
76 Ga0068867_100055216 3300005459 Bacteria 2936
77 Ga0068867_100239977 3300005459 Bacteria 1469
78 Ga0068867_100249413 3300005459 Bacteria 1443
79 Ga0070685_10012018 3300005466 Bacteria 4539
80 Ga0070685_10127898 3300005466 Bacteria 1585
81 Ga0070707_100012174 3300005468 Bacteria 8030
82 Ga0070707_100182024 3300005468 Bacteria 2048
83 Ga0070707_100389191 3300005468 Bacteria 1354
84 Ga0070679_100015002 3300005530 Bacteria 7445
85 Ga0070679_100015901 3300005530 Bacteria 7242
86 Ga0070679_100119700 3300005530 Bacteria 2618
87 Ga0070679_100123613 3300005530 Bacteria 2571
88 Ga0070679_100126150 3300005530 Bacteria 2542
89 Ga0070684_100001217 3300005535 Bacteria 18491
90 Ga0070684_100001586 3300005535 Bacteria 16405
91 Ga0070684_100078393 3300005535 Bacteria 2919
92 Ga0070684_100140998 3300005535 Bacteria 2180
93 Ga0070672_100192765 3300005543 Bacteria 1702
94 Ga0070686_100250000 3300005544 Bacteria 1295
95 Ga0070695_100026261 3300005545 Bacteria 3601
96 Ga0070695_100085011 3300005545 Bacteria 2100
97 Ga0070665_100030207 3300005548 Bacteria 5454
98 Ga0070665_100057848 3300005548 Unclassified 3887
99 Ga0070704_100014502 3300005549 Bacteria 4924
100 Ga0070704_100148528 3300005549 Bacteria 1840
101 Ga0070704_100329105 3300005549 Unclassified 1283
102 Ga0068855_100030253 3300005563 Bacteria 6477
103 Ga0068855_100086662 3300005563 Bacteria 3621
104 Ga0068855_100097177 3300005563 Bacteria 3392
105 Ga0068855_100178082 3300005563 Bacteria 2405
106 Ga0070664_100001824 3300005564 Bacteria 17055
107 Ga0070664_100002910 3300005564 Bacteria 13857
108 Ga0070664_100108634 3300005564 Bacteria 2419
109 Ga0070664_100444579 3300005564 Bacteria 1189
110 Ga0068857_100001376 3300005577 Bacteria 19181
111 Ga0068857_100223243 3300005577 Bacteria 1721
112 Ga0068854_100023685 3300005578 Unclassified 4196
113 Ga0068856_100000179 3300005614 Bacteria 66149
114 Ga0068856_100000347 3300005614 Bacteria 50484
115 Ga0068856_100015481 3300005614 Bacteria 7370
116 Ga0068859_100001235 3300005617 Bacteria 26117
117 Ga0068859_100001734 3300005617 Bacteria 22220
118 Ga0068859_100050144 3300005617 Bacteria 4193
119 Ga0068864_100000129 3300005618 Bacteria 73206
120 Ga0068866_10007078 3300005718 Bacteria 4689
121 Ga0068861_100071680 3300005719 Bacteria 2686
122 Ga0068851_10073933 3300005834 Bacteria 1768
123 Ga0068863_100153232 3300005841 Bacteria 2206
124 Ga0068863_100205388 3300005841 Bacteria 1896
125 Ga0068858_100006877 3300005842 Bacteria 11055
126 Ga0068860_100031048 3300005843 Bacteria 5137
127 Ga0068860_100165532 3300005843 Unclassified 2134
128 Ga0068862_100110110 3300005844 Bacteria 2417
129 Ga0068862_100139162 3300005844 Bacteria 2153
130 Ga0081455_10020926 3300005937 Bacteria 6147
131 Ga0081455_10025764 3300005937 Bacteria 5423
132 Ga0081455_10062203 3300005937 Bacteria 3138
133 Ga0081540_1092659 3300005983 Unclassified 1325
134 Ga0070717_10000016 3300006028 Bacteria 205932
135 Ga0070717_10001262 3300006028 Bacteria 17276
136 Ga0070717_10002582 3300006028 Bacteria 12784
137 Ga0070717_10008871 3300006028 Bacteria 7530
138 Ga0070717_10040294 3300006028 Unclassified 3804
139 Ga0070717_10111227 3300006028 Unclassified 2337
140 Ga0070717_10115371 3300006028 Bacteria 2295
141 Ga0075364_10122556 3300006051 Bacteria 1741
142 Ga0070716_100000711 3300006173 Bacteria 14216
143 Ga0070716_100007470 3300006173 Bacteria 5386
144 Ga0070716_100008365 3300006173 Bacteria 5132
145 Ga0070712_100000038 3300006175 Bacteria 67408
146 Ga0070712_100000288 3300006175 Bacteria 28406
147 Ga0070712_100000292 3300006175 Bacteria 28152
148 Ga0070712_100015439 3300006175 Bacteria 4921
149 Ga0075367_10055260 3300006178 Bacteria 2356
150 Ga0075366_10022264 3300006195 Bacteria 3685
151 Ga0097621_100031210 3300006237 Unclassified 4227
152 Ga0097621_100129185 3300006237 Bacteria 2149
153 Ga0097621_100394278 3300006237 Unclassified 1238
154 Ga0068871_100000439 3300006358 Bacteria 28672
155 Ga0068871_100031589 3300006358 Unclassified 4177
156 Ga0068871_100178064 3300006358 Bacteria 1826
157 Ga0068871_100486479 3300006358 Bacteria 1111
158 Ga0075428_100625058 3300006844 Bacteria 1149
159 Ga0075431_100102076 3300006847 Bacteria 2960
160 Ga0075431_100311298 3300006847 Bacteria 1589
161 Ga0075431_100359906 3300006847 Bacteria 1462
162 Ga0075431_100437342 3300006847 Bacteria 1305
163 Ga0075433_10158786 3300006852 Unclassified 2012
164 Ga0075433_10191114 3300006852 Unclassified 1821
165 Ga0075433_10373389 3300006852 Unclassified 1259
166 Ga0075434_100004219 3300006871 Bacteria 12887
167 Ga0075434_100004262 3300006871 Bacteria 12828
168 Ga0075434_100016801 3300006871 Bacteria 7042
169 Ga0075434_100034351 3300006871 Bacteria 5007
170 Ga0075434_100280761 3300006871 Bacteria 1685
171 Ga0068865_100112554 3300006881 Bacteria 2011
172 Ga0075436_100040655 3300006914 Bacteria 3208
173 Ga0097620_100001235 3300006931 Bacteria 26117
174 Ga0097620_100001734 3300006931 Bacteria 22220
175 Ga0097620_100050143 3300006931 Bacteria 4193
176 Ga0075435_100007470 3300007076 Bacteria 7792
177 Ga0105240_10046652 3300009093 Bacteria 5489
178 Ga0105240_10076065 3300009093 Bacteria 4140
179 Ga0105240_10091111 3300009093 Bacteria 3726
180 Ga0105240_10100151 3300009093 Bacteria 3526
181 Ga0105240_10107750 3300009093 Bacteria 3377
182 Ga0111539_10016693 3300009094 Bacteria 9100
183 Ga0111539_10259126 3300009094 Unclassified 2025
184 Ga0111539_10272882 3300009094 Bacteria 1968
185 Ga0105245_10003276 3300009098 Bacteria 14530
186 Ga0105245_10233963 3300009098 Bacteria 1778
187 Ga0105245_10240834 3300009098 Unclassified 1753
188 Ga0105245_10248582 3300009098 Bacteria 1727
189 Ga0105245_10298680 3300009098 Bacteria 1579
190 Ga0105247_10010482 3300009101 Bacteria 5603
191 Ga0105247_10097623 3300009101 Bacteria 1874
192 Ga0105243_10011140 3300009148 Bacteria 6802
193 Ga0105241_10018618 3300009174 Bacteria 5110
194 Ga0105241_10184085 3300009174 Bacteria 1734
195 Ga0105241_10213275 3300009174 Bacteria 1619
196 Ga0105241_10506790 3300009174 Unclassified 1077
197 Ga0105248_10009525 3300009177 Bacteria 10690
198 Ga0105248_10110376 3300009177 Bacteria 3101
199 Ga0105248_10201513 3300009177 Bacteria 2242
200 Ga0105237_10051350 3300009545 Bacteria 4141
201 Ga0105237_10232606 3300009545 Bacteria 1844
202 Ga0105237_10596354 3300009545 Bacteria 1112
203 Ga0105238_10029170 3300009551 Bacteria 5621
204 Ga0105238_10038354 3300009551 Bacteria 4866
205 Ga0105238_10094075 3300009551 Bacteria 2984
206 Ga0105238_10121114 3300009551 Unclassified 2596
207 Ga0105238_10197830 3300009551 Bacteria 1985
208 Ga0105249_10027783 3300009553 Bacteria 5105
209 Ga0105239_10341664 3300010375 Bacteria 1689
210 Ga0157373_10151845 3300013100 Bacteria 1629
211 Ga0157371_10065256 3300013102 Bacteria 2578
212 Ga0157371_10093502 3300013102 Bacteria 2131
213 Ga0157371_10311390 3300013102 Bacteria 1141
214 Ga0157370_10061678 3300013104 Bacteria 3558
215 Ga0157370_10295408 3300013104 Bacteria 1496
216 Ga0157370_10394664 3300013104 Bacteria 1274
217 Ga0157369_10000131 3300013105 Bacteria 107900
218 Ga0157369_10066048 3300013105 Bacteria 3892
219 Ga0157369_10153338 3300013105 Bacteria 2435
220 Ga0157374_10000454 3300013296 Bacteria 37339
221 Ga0157374_10002950 3300013296 Bacteria 14245
222 Ga0157374_10183583 3300013296 Unclassified 2045
223 Ga0157374_10270619 3300013296 Unclassified 1675
224 Ga0157374_10405533 3300013296 Bacteria 1360
225 Ga0157378_10000009 3300013297 Bacteria 161557
226 Ga0157378_10000132 3300013297 Bacteria 71918
227 Ga0157378_10072675 3300013297 Bacteria 3091
228 Ga0163162_10008867 3300013306 Bacteria 9779
229 Ga0163162_10139776 3300013306 Bacteria 2534
230 Ga0163162_10260086 3300013306 Archaea 1867
231 Ga0157372_10000140 3300013307 Bacteria 79310
232 Ga0157372_10003387 3300013307 Bacteria 17201
233 Ga0157372_10022357 3300013307 Bacteria 6841
234 Ga0157372_10024064 3300013307 Bacteria 6607
235 Ga0157372_10127311 3300013307 Bacteria 2928
236 Ga0157372_10167813 3300013307 Bacteria 2539
237 Ga0157372_10195943 3300013307 Bacteria 2340
238 Ga0157372_10216840 3300013307 Bacteria 2218
239 Ga0157372_10270676 3300013307 Bacteria 1974
240 Ga0157372_10385577 3300013307 Unclassified 1633
241 Ga0157372_10415102 3300013307 Unclassified 1568
242 Ga0157375_10031791 3300013308 Bacteria 4997
243 Ga0157375_10527089 3300013308 Bacteria 1344
244 Ga0163163_10064869 3300014325 Bacteria 3624
245 Ga0163163_10203762 3300014325 Bacteria 2027
246 Ga0157380_10038475 3300014326 Bacteria 3714
247 Ga0157379_10008178 3300014968 Bacteria 9083
248 Ga0157379_10092734 3300014968 Bacteria 2709
249 Ga0157379_10131515 3300014968 Bacteria 2253
250 Ga0157379_10385632 3300014968 Bacteria 1286
251 Ga0157376_10005214 3300014969 Bacteria 9068
252 Ga0157376_10048210 3300014969 Bacteria 3521
253 Ga0182005_1010329 3300015265 Bacteria 2688
254 Ga0213876_10010112 3300021384 Bacteria 5070
255 Ga0224571_101336 3300022734 Bacteria 1534
256 Ga0207692_10092447 3300025898 Bacteria 1644
257 Ga0207642_10004701 3300025899 Bacteria 4411
258 Ga0207642_10013759 3300025899 Bacteria 2962
259 Ga0207710_10008244 3300025900 Bacteria 4399
260 Ga0207688_10078329 3300025901 Unclassified 1884
261 Ga0207680_10160582 3300025903 Bacteria 1506
262 Ga0207647_10006752 3300025904 Bacteria 8328
263 Ga0207647_10082297 3300025904 Bacteria 1928
264 Ga0207699_10000549 3300025906 Bacteria 18507
265 Ga0207699_10045764 3300025906 Bacteria 2556
266 Ga0207645_10009002 3300025907 Bacteria 6929
267 Ga0207645_10043444 3300025907 Bacteria 2877
268 Ga0207705_10003517 3300025909 Bacteria 11934
269 Ga0207705_10037522 3300025909 Bacteria 3468
270 Ga0207654_10106501 3300025911 Bacteria 1737
271 Ga0207707_10020215 3300025912 Bacteria 5814
272 Ga0207707_10083602 3300025912 Bacteria 2787
273 Ga0207707_10207853 3300025912 Unclassified 1706
274 Ga0207707_10340557 3300025912 Bacteria 1293
275 Ga0207695_10022632 3300025913 Bacteria 7125
276 Ga0207695_10136327 3300025913 Bacteria 2407
277 Ga0207695_10223107 3300025913 Bacteria 1791
278 Ga0207695_10235157 3300025913 Bacteria 1735
279 Ga0207671_10064106 3300025914 Bacteria 2732
280 Ga0207671_10386481 3300025914 Bacteria 1112
281 Ga0207693_10000012 3300025915 Bacteria 154708
282 Ga0207693_10000058 3300025915 Bacteria 94726
283 Ga0207693_10001160 3300025915 Bacteria 23505
284 Ga0207663_10000280 3300025916 Bacteria 22295
285 Ga0207663_10003486 3300025916 Bacteria 7701
286 Ga0207663_10035240 3300025916 Bacteria 3000
287 Ga0207663_10072038 3300025916 Bacteria 2232
288 Ga0207662_10032839 3300025918 Bacteria 3022
289 Ga0207657_10005169 3300025919 Bacteria 13686
290 Ga0207657_10008891 3300025919 Bacteria 10157
291 Ga0207649_10017361 3300025920 Bacteria 4078
292 Ga0207652_10025236 3300025921 Bacteria 4939
293 Ga0207652_10107796 3300025921 Bacteria 2468
294 Ga0207652_10136139 3300025921 Bacteria 2193
295 Ga0207646_10011611 3300025922 Bacteria 8517
296 Ga0207646_10310221 3300025922 Bacteria 1425
297 Ga0207681_10061260 3300025923 Bacteria 2586
298 Ga0207681_10237495 3300025923 Bacteria 1417
299 Ga0207694_10017121 3300025924 Bacteria 5476
300 Ga0207694_10046813 3300025924 Bacteria 3343
301 Ga0207694_10047232 3300025924 Bacteria 3330
302 Ga0207694_10164794 3300025924 Bacteria 1792
303 Ga0207650_10031670 3300025925 Bacteria 3821
304 Ga0207650_10095877 3300025925 Bacteria 2275
305 Ga0207687_10006501 3300025927 Bacteria 7720
306 Ga0207687_10014350 3300025927 Bacteria 5183
307 Ga0207700_10002138 3300025928 Bacteria 11308
308 Ga0207700_10003116 3300025928 Bacteria 9583
309 Ga0207700_10012980 3300025928 Bacteria 5398
310 Ga0207700_10036822 3300025928 Bacteria 3538
311 Ga0207700_10080225 3300025928 Bacteria 2544
312 Ga0207700_10142647 3300025928 Bacteria 1970
313 Ga0207664_10000098 3300025929 Bacteria 80444
314 Ga0207664_10032571 3300025929 Unclassified 3997
315 Ga0207664_10080991 3300025929 Bacteria 2640
316 Ga0207690_10074616 3300025932 Bacteria 2349
317 Ga0207690_10326325 3300025932 Bacteria 1208
318 Ga0207706_10041154 3300025933 Bacteria 4097
319 Ga0207670_10019783 3300025936 Bacteria 4120
320 Ga0207670_10212897 3300025936 Unclassified 1475
321 Ga0207665_10003619 3300025939 Bacteria 10327
322 Ga0207665_10005922 3300025939 Bacteria 8138
323 Ga0207665_10011313 3300025939 Bacteria 5858
324 Ga0207691_10109027 3300025940 Bacteria 2463
325 Ga0207691_10223514 3300025940 Bacteria 1632
326 Ga0207711_10003045 3300025941 Bacteria 14653
327 Ga0207711_10067029 3300025941 Unclassified 3106
328 Ga0207689_10021947 3300025942 Bacteria 5369
329 Ga0207689_10054566 3300025942 Bacteria 3291
330 Ga0207689_10204950 3300025942 Bacteria 1629
331 Ga0207661_10029779 3300025944 Bacteria 4196
332 Ga0207661_10051469 3300025944 Bacteria 3286
333 Ga0207661_10057318 3300025944 Bacteria 3132
334 Ga0207661_10073680 3300025944 Bacteria 2797
335 Ga0207661_10077970 3300025944 Bacteria 2726
336 Ga0207679_10026074 3300025945 Bacteria 4027
337 Ga0207667_10045259 3300025949 Bacteria 4662
338 Ga0207667_10118335 3300025949 Bacteria 2730
339 Ga0207667_10244947 3300025949 Bacteria 1834
340 Ga0207667_10329063 3300025949 Bacteria 1560
341 Ga0207651_10383122 3300025960 Bacteria 1192
342 Ga0207712_10008799 3300025961 Bacteria 6383
343 Ga0207668_10005700 3300025972 Bacteria 7338
344 Ga0207668_10270989 3300025972 Bacteria 1388
345 Ga0207640_10005099 3300025981 Bacteria 7142
346 Ga0207640_10038872 3300025981 Bacteria 3006
347 Ga0207658_10355779 3300025986 Bacteria 1276
348 Ga0207677_10009196 3300026023 Bacteria 5549
349 Ga0207703_10035638 3300026035 Bacteria 3955
350 Ga0207703_10225718 3300026035 Bacteria 1677
351 Ga0207703_10354199 3300026035 Unclassified 1352
352 Ga0207639_10502718 3300026041 Bacteria 1108
353 Ga0207678_10021098 3300026067 Bacteria 5709
354 Ga0207678_10032951 3300026067 Bacteria 4515
355 Ga0207678_10041612 3300026067 Bacteria 3984
356 Ga0207702_10001136 3300026078 Bacteria 27202
357 Ga0207702_10011681 3300026078 Bacteria 7313
358 Ga0207702_10013736 3300026078 Bacteria 6727
359 Ga0207702_10024096 3300026078 Bacteria 5049
360 Ga0207641_10041831 3300026088 Bacteria 3842
361 Ga0207641_10058413 3300026088 Bacteria 3283
362 Ga0207648_10041040 3300026089 Bacteria 4064
363 Ga0207648_10261632 3300026089 Bacteria 1544
364 Ga0207676_10214958 3300026095 Bacteria 1708
365 Ga0207674_10000763 3300026116 Bacteria 42020
366 Ga0207674_10003886 3300026116 Bacteria 18190
367 Ga0207674_10103405 3300026116 Bacteria 2827
368 Ga0207675_100042296 3300026118 Bacteria 4254
369 Ga0207428_10010674 3300027907 Bacteria 8192
370 Ga0207428_10113856 3300027907 Bacteria 2079
371 Ga0265356_1000013 3300028017 Bacteria 28815
372 Ga0265356_1003850 3300028017 Bacteria 1862
373 Ga0265357_1005310 3300028023 Unclassified 1188
374 Ga0268266_10000660 3300028379 Bacteria 46709
375 Ga0268266_10005793 3300028379 Bacteria 11438
376 Ga0268265_10089939 3300028380 Bacteria 2451
377 Ga0268264_10077570 3300028381 Bacteria 2830
378 Ga0268264_10086594 3300028381 Bacteria 2692
379 Ga0268264_10191456 3300028381 Bacteria 1865
380 Ga0268264_10343313 3300028381 Unclassified 1419
381 Ga0265337_1006294 3300028556 Bacteria 4600
382 Ga0265337_1008518 3300028556 Bacteria 3725
383 Ga0265337_1013101 3300028556 Bacteria 2798
384 Ga0265326_10019724 3300028558 Unclassified 1937
385 Ga0265319_1001494 3300028563 Bacteria 13918
386 Ga0265319_1007590 3300028563 Bacteria 4850
387 Ga0265319_1016918 3300028563 Bacteria 2787
388 Ga0265334_10021022 3300028573 Bacteria 2667
389 Ga0265318_10003505 3300028577 Bacteria 7862
390 Ga0265338_10003616 3300028800 Bacteria 21554
391 Ga0265338_10005972 3300028800 Bacteria 15660
392 Ga0265338_10009875 3300028800 Bacteria 11300
393 Ga0265338_10022889 3300028800 Bacteria 6447
394 Ga0265338_10023060 3300028800 Bacteria 6413
395 Ga0265338_10029368 3300028800 Bacteria 5451
396 Ga0265338_10034737 3300028800 Bacteria 4865
397 Ga0265762_1000831 3300030760 Bacteria 5497
398 Ga0265762_1005734 3300030760 Bacteria 2227
399 Ga0265760_10000017 3300031090 Bacteria 89357
400 Ga0265760_10002961 3300031090 Unclassified 4968
401 Ga0265760_10028848 3300031090 Bacteria 1629
402 Ga0265320_10000134 3300031240 Bacteria 63576
403 Ga0265320_10001451 3300031240 Bacteria 17287
404 Ga0265320_10002229 3300031240 Bacteria 13594
405 Ga0265320_10005571 3300031240 Bacteria 8067
406 Ga0265320_10030138 3300031240 Bacteria 2801
407 Ga0265340_10012385 3300031247 Bacteria 4506
408 Ga0265340_10071289 3300031247 Bacteria 1647
409 Ga0265339_10010523 3300031249 Bacteria 5743
410 Ga0265339_10012297 3300031249 Bacteria 5229
411 Ga0265339_10033067 3300031249 Bacteria 2915
412 Ga0265316_10077493 3300031344 Bacteria 2553
413 Ga0265313_10009742 3300031595 Bacteria 6192
414 Ga0265313_10038422 3300031595 Bacteria 2384
415 Ga0265313_10050688 3300031595 Bacteria 1990
416 Ga0307508_10000055 3300031616 Bacteria 126914
417 Ga0265314_10006661 3300031711 Bacteria 10153
418 Ga0265314_10014921 3300031711 Bacteria 6188
419 Ga0265314_10030259 3300031711 Bacteria 4009
420 Ga0265314_10064204 3300031711 Bacteria 2487
421 Ga0265342_10131723 3300031712 Bacteria 1400
422 Ga0307413_10063123 3300031824 Bacteria 2296
423 Ga0307407_10000097 3300031903 Bacteria 29578
424 Ga0307414_10000226 3300032004 Bacteria 37108
425 Ga0373940_0054235 3300035088 Unclassified 1133
426 Ga0373923_0038061 3300035111 Bacteria 1969
427 Ga0373936_0002594 3300035113 Bacteria 6774
428 Ga0373939_0129107 3300035114 Unclassified 900
429 Ga0373945_0110207 3300035116 Bacteria 1085
430 Ga0373954_0011513 3300035118 Bacteria 3922
431 Ga0373954_0012888 3300035118 Bacteria 3722
432 Ga0373954_0129523 3300035118 Bacteria 1228
433 Ga0373943_0000669 3300035170 Bacteria 14898
434 Ga0373943_0103456 3300035170 Unclassified 1493
435 Ga0373955_0014993 3300035172 Bacteria 3784
436 Ga0373955_0040590 3300035172 Unclassified 2490
437 Ga0373931_0001031 3300035691 Bacteria 11776
438 Ga0373931_0056382 3300035691 Unclassified 2105
439 Ga0373935_0027635 3300035692 Bacteria 3507
440 Ga0373927_0000282 3300035695 Bacteria 40021
441 Ga0373933_0084044 3300035724 Unclassified 1956
442 Ga0373947_0001632 3300035725 Bacteria 13760
443 Ga0373937_0007074 3300036401 Bacteria 9695
444 Ga0373937_0025917 3300036401 Bacteria 5296
445 Ga0373925_0002387 3300037068 Bacteria 15061
446 Ga0395900_0095002 3300037418 Bacteria 3063
447 Ga0395905_0125070 3300037471 Bacteria 2418
448 Ga0395901_0186719 3300038443 Bacteria 2174
449 Ga0436365_1710025 3300039437 Bacteria 8308
450 Ga0436363_0134232 3300039450 Bacteria 4925
451 Ga0451577_0157140 3300042876 Bacteria 2047
452 Ga0451576_0126481 3300045051 Bacteria 2663
453 Ga0451576_0501288 3300045051 Bacteria 1275
454 Ga0495592_0000012 3300046454 Bacteria 154054
455 Ga0495603_0130134 3300046455 Unclassified 1466
456 Ga0495651_0014012 3300046462 Bacteria 6201
457 Ga0495651_0015969 3300046462 Bacteria 5816
458 Ga0495650_0021709 3300046471 Bacteria 3092
459 Ga0495580_0000182 3300046472 Bacteria 47252
460 Ga0495580_0001231 3300046472 Bacteria 22586
461 Ga0495580_0001774 3300046472 Bacteria 18967
462 Ga0495582_0021845 3300046473 Bacteria 3501
463 Ga0495662_0025525 3300046476 Bacteria 2854
464 Ga0495664_0033374 3300046477 Bacteria 3025
465 Ga0495585_0029567 3300046492 Unclassified 3118
466 Ga0495594_0037380 3300046499 Unclassified 2649
467 Ga0495608_0207436 3300046511 Bacteria 1233
468 Ga0495618_0004341 3300046514 Bacteria 8722
469 Ga0495628_0003611 3300046516 Bacteria 13837
470 Ga0495628_0187673 3300046516 Bacteria 1562
471 Ga0495630_0000150 3300046517 Bacteria 54165
472 Ga0495630_0005339 3300046517 Bacteria 9063
473 Ga0495666_0029224 3300046526 Unclassified 2712
474 Ga0495666_0041066 3300046526 Bacteria 2241
475 Ga0495640_0011154 3300046533 Bacteria 6918
476 Ga0495586_0000258 3300046535 Bacteria 34737
477 Ga0495586_0010769 3300046535 Unclassified 4862
478 Ga0495645_0003809 3300046543 Bacteria 10254
479 Ga0495645_0123587 3300046543 Bacteria 1820
480 Ga0495645_0155977 3300046543 Bacteria 1582
481 Ga0495667_0036987 3300046559 Bacteria 3255
482 Ga0495667_0138596 3300046559 Bacteria 1568
483 Ga0495634_0023408 3300046642 Bacteria 4342
484 Ga0495625_0000315 3300046660 Bacteria 73951
485 Ga0495599_0001485 3300046678 Bacteria 13459
486 Ga0495658_0015852 3300046683 Bacteria 3873
487 Ga0495613_0034461 3300046689 Bacteria 3760
488 Ga0495624_0027095 3300046690 Unclassified 3755
489 Ga0495624_0174349 3300046690 Bacteria 1311
490 Ga0495581_0032505 3300047315 Unclassified 3021
491 Ga0495581_0112891 3300047315 Bacteria 1580
492 Ga0495674_0004620 3300047319 Bacteria 13235
493 Ga0495674_0006874 3300047319 Bacteria 10887
494 Ga0495674_0029207 3300047319 Bacteria 5023
495 Ga0495674_0045977 3300047319 Bacteria 3876
496 Ga0495674_0049300 3300047319 Bacteria 3722
497 Ga0495674_0095979 3300047319 Bacteria 2527
498 Ga0495674_0323339 3300047319 Bacteria 1256
499 Ga0495672_0002235 3300047320 Bacteria 18011
500 Ga0495676_0005138 3300047321 Bacteria 11991
501 Ga0495675_0018679 3300047444 Unclassified 4403
502 Ga0495675_0174470 3300047444 Unclassified 1319
503 Ga0495684_0015090 3300047471 Bacteria 5949
504 Ga0495684_0052491 3300047471 Bacteria 3111
505 Ga0495602_0028268 3300048088 Bacteria 5370
506 Ga0495602_0067819 3300048088 Bacteria 3067
507 Ga0496102_0004321 3300048905 Bacteria 12017
508 Ga0496102_0056024 3300048905 Bacteria 3595
509 Ga0496104_0281170 3300048907 Bacteria 1577
510 Ga0496105_0080123 3300048908 Bacteria 2697
511 Ga0496106_0061150 3300048909 Bacteria 2857
512 Ga0496106_0062612 3300048909 Bacteria 2825
513 Ga0496107_0051702 3300048910 Bacteria 2964
514 Ga0496107_0143594 3300048910 Bacteria 1764
515 Ga0496108_0198291 3300048911 Unclassified 1742
516 Ga0496109_0000699 3300048912 Bacteria 27907
517 Ga0496109_0002509 3300048912 Bacteria 15396
518 Ga0496109_0260105 3300048912 Bacteria 1635
519 Ga0496110_0000061 3300048913 Bacteria 53551
520 Ga0496112_0006189 3300048915 Bacteria 10470
521 Ga0496112_0049692 3300048915 Bacteria 4110
522 Ga0496114_0153627 3300048917 Bacteria 1997
523 Ga0496115_0006810 3300048918 Bacteria 8386
524 Ga0496115_0113065 3300048918 Bacteria 2231
525 Ga0496126_0044651 3300048929 Unclassified 4079
526 Ga0501032_0000027 3300049569 Bacteria 136304
527 Ga0501032_0001332 3300049569 Bacteria 19702
528 Ga0501033_0000002 3300049570 Bacteria 668574
529 Ga0501034_0001001 3300049571 Bacteria 40495
530 Ga0501034_0092359 3300049571 Bacteria 3024
531 Ga0501034_0129373 3300049571 Bacteria 2508
532 Ga0501038_0132045 3300049574 Bacteria 2049
533 Ga0501040_0102654 3300049576 Bacteria 1996
534 Ga0501043_0048128 3300049579 Unclassified 3352
535 Ga0501046_0057567 3300049580 Unclassified 3049
536 Ga0501046_0089202 3300049580 Bacteria 2374
537 Ga0501047_0005823 3300049581 Bacteria 11601
538 Ga0501047_0009307 3300049581 Bacteria 9277
539 Ga0501047_0089629 3300049581 Bacteria 2953
540 Ga0501048_0315223 3300049582 Bacteria 1114
541 Ga0501067_0201469 3300049583 Bacteria 1109
542 Ga0501070_0052004 3300049586 Bacteria 3400
543 Ga0501076_0199964 3300049592 Bacteria 1631
544 Ga0501079_0305435 3300049741 Bacteria 1245
545 Ga0501080_0007661 3300049742 Bacteria 9764
546 Ga0501083_0069033 3300049744 Bacteria 2352
547 Ga0501083_0153013 3300049744 Bacteria 1510
548 Ga0501035_0000475 3300049822 Bacteria 45010
549 Ga0501035_0315424 3300049822 Unclassified 1315
550 Ga0501044_0000080 3300049823 Bacteria 116837
551 Ga0501044_0000704 3300049823 Bacteria 40368
552 nmdc:mga00v17_100701_c1 3300050491 Bacteria 1823
553 nmdc:mga0k408_75421_c1 3300050493 Bacteria 1970
554 nmdc:mga06z11_74034_c1 3300050494 Bacteria 1810
555 nmdc:mga05p37_19475_c1 3300050507 Bacteria 8209
556 nmdc:mga06r32_101896_c1 3300050510 Bacteria 2818
557 nmdc:mga06r32_236137_c1 3300050510 Bacteria 1816
558 nmdc:mga06r32_266005_c1 3300050510 Bacteria 1702
559 nmdc:mga08y16_160311_c1 3300050511 Bacteria 2337
560 nmdc:mga08y16_7180_c1 3300050511 Bacteria 11689
561 nmdc:mga0n895_245116_c1 3300050512 Bacteria 1819
562 nmdc:mga0n895_36484_c1 3300050512 Unclassified 4747
563 nmdc:mga0n895_43753_c1 3300050512 Bacteria 4364
564 nmdc:mga0n895_53059_c1 3300050512 Bacteria 3982
565 nmdc:mga0rr50_57659_c1 3300050513 Bacteria 2906
566 nmdc:mga0a205_131917_c1 3300050515 Bacteria 2399
567 nmdc:mga0a205_439533_c1 3300050515 Unclassified 1165
568 nmdc:mga0a205_93555_c1 3300050515 Bacteria 2904
569 Ga0500555_004465 3300053103 Bacteria 3972
570 Ga0500568_0002084 3300053139 Bacteria 12122
571 Ga0500616_0000924 3300053153 Bacteria 32088
572 Ga0500645_000688 3300053730 Bacteria 21110
573 Ga0500599_002616 3300053736 Bacteria 2169
574 Ga0501084_0008214 3300054114 Bacteria 8611
575 Ga0501082_0035853 3300060353 Bacteria 4275
576 Ga0207693_10178420
577 MBSR1b_contig_7070244
578 rootH2_10202145
579 Ga0065715_10027140
580 Ga0065715_10090698
581 Ga0065707_10000566
582 Ga0070658_10003728
583 Ga0070683_100002076
584 Ga0070683_100009033
585 Ga0070683_100021235
586 Ga0070683_100055760
587 Ga0070683_100189837
588 Ga0070683_100265266
589 Ga0070683_100432186
590 Ga0070690_100021524
591 Ga0070670_100002622
592 Ga0070670_100165320
593 Ga0068869_100003330
594 Ga0068869_100043424
595 Ga0070666_10059657
596 Ga0070680_100028433
597 Ga0070680_100147763
598 Ga0068868_100000995
599 Ga0068868_100019961
600 Ga0068868_100192128
601 Ga0070660_100021389
602 Ga0070689_100009175
603 Ga0070689_100034736
604 Ga0070689_100218053
605 Ga0070661_100053750
606 Ga0070661_100079166
607 Ga0070669_100059018
608 Ga0070669_100147245
609 Ga0070675_100123179
610 Ga0070671_100073781
611 Ga0070673_100028858
612 Ga0070673_100214323
613 Ga0070688_100244455
614 Ga0070688_100271203
615 Ga0070659_100042570
616 Ga0070659_100069454
617 Ga0070659_100100097
618 Ga0070667_100094587
619 Ga0070667_100392223
620 Ga0070709_10000744
621 Ga0070709_10113504
622 Ga0070714_100000027
623 Ga0070714_100218030
624 Ga0070713_100000070
625 Ga0070713_100001120
626 Ga0070713_100001548
627 Ga0070713_100004604
628 Ga0070713_100054173
629 Ga0070713_100102191
630 Ga0070713_100287497
631 Ga0070713_100342638
632 Ga0070710_10029145
633 Ga0070701_10095010
634 Ga0070711_100000078
635 Ga0070711_100021517
636 Ga0070711_100027208
637 Ga0070711_100043713
638 Ga0070711_100090184
639 Ga0070705_100101973
640 Ga0070705_100221533
641 Ga0070700_100076156
642 Ga0070708_100066456
643 Ga0070663_100003913
644 Ga0070663_100082716
645 Ga0070662_100022197
646 Ga0070662_100118001
647 Ga0070681_10009094
648 Ga0070681_10019874
649 Ga0070681_10036358
650 Ga0070681_10057750
651 Ga0068867_100055216
652 Ga0068867_100239977
653 Ga0068867_100249413
654 Ga0070685_10012018
655 Ga0070685_10127898
656 Ga0070707_100012174
657 Ga0070707_100182024
658 Ga0070707_100389191
659 Ga0070679_100015002
660 Ga0070679_100015901
661 Ga0070679_100119700
662 Ga0070679_100123613
663 Ga0070679_100126150
664 Ga0070684_100001217
665 Ga0070684_100001586
666 Ga0070684_100078393
667 Ga0070684_100140998
668 Ga0070672_100192765
669 Ga0070686_100250000
670 Ga0070695_100026261
671 Ga0070695_100085011
672 Ga0070665_100030207
673 Ga0070665_100057848
674 Ga0070704_100014502
675 Ga0070704_100148528
676 Ga0070704_100329105
677 Ga0068855_100030253
678 Ga0068855_100086662
679 Ga0068855_100097177
680 Ga0068855_100178082
681 Ga0070664_100001824
682 Ga0070664_100002910
683 Ga0070664_100108634
684 Ga0070664_100444579
685 Ga0068857_100001376
686 Ga0068857_100223243
687 Ga0068854_100023685
688 Ga0068856_100000179
689 Ga0068856_100000347
690 Ga0068856_100015481
691 Ga0068859_100001235
692 Ga0068859_100001734
693 Ga0068859_100050144
694 Ga0068864_100000129
695 Ga0068866_10007078
696 Ga0068861_100071680
697 Ga0068851_10073933
698 Ga0068863_100153232
699 Ga0068863_100205388
700 Ga0068858_100006877
701 Ga0068860_100031048
702 Ga0068860_100165532
703 Ga0068862_100110110
704 Ga0068862_100139162
705 Ga0081455_10020926
706 Ga0081455_10025764
707 Ga0081455_10062203
708 Ga0081540_1092659
709 Ga0070717_10000016
710 Ga0070717_10001262
711 Ga0070717_10002582
712 Ga0070717_10008871
713 Ga0070717_10040294
714 Ga0070717_10111227
715 Ga0070717_10115371
716 Ga0075364_10122556
717 Ga0070716_100000711
718 Ga0070716_100007470
719 Ga0070716_100008365
720 Ga0070712_100000038
721 Ga0070712_100000288
722 Ga0070712_100000292
723 Ga0070712_100015439
724 Ga0075367_10055260
725 Ga0075366_10022264
726 Ga0097621_100031210
727 Ga0097621_100129185
728 Ga0097621_100394278
729 Ga0068871_100000439
730 Ga0068871_100031589
731 Ga0068871_100178064
732 Ga0068871_100486479
733 Ga0075428_100625058
734 Ga0075431_100102076
735 Ga0075431_100311298
736 Ga0075431_100359906
737 Ga0075431_100437342
738 Ga0075433_10158786
739 Ga0075433_10191114
740 Ga0075433_10373389
741 Ga0075434_100004219
742 Ga0075434_100004262
743 Ga0075434_100016801
744 Ga0075434_100034351
745 Ga0075434_100280761
746 Ga0068865_100112554
747 Ga0075436_100040655
748 Ga0097620_100001235
749 Ga0097620_100001734
750 Ga0097620_100050143
751 Ga0075435_100007470
752 Ga0105240_10046652
753 Ga0105240_10076065
754 Ga0105240_10091111
755 Ga0105240_10100151
756 Ga0105240_10107750
757 Ga0111539_10016693
758 Ga0111539_10259126
759 Ga0111539_10272882
760 Ga0105245_10003276
761 Ga0105245_10233963
762 Ga0105245_10240834
763 Ga0105245_10248582
764 Ga0105245_10298680
765 Ga0105247_10010482
766 Ga0105247_10097623
767 Ga0105243_10011140
768 Ga0105241_10018618
769 Ga0105241_10184085
770 Ga0105241_10213275
771 Ga0105241_10506790
772 Ga0105248_10009525
773 Ga0105248_10110376
774 Ga0105248_10201513
775 Ga0105237_10051350
776 Ga0105237_10232606
777 Ga0105237_10596354
778 Ga0105238_10029170
779 Ga0105238_10038354
780 Ga0105238_10094075
781 Ga0105238_10121114
782 Ga0105238_10197830
783 Ga0105249_10027783
784 Ga0105239_10341664
785 Ga0157373_10151845
786 Ga0157371_10065256
787 Ga0157371_10093502
788 Ga0157371_10311390
789 Ga0157370_10061678
790 Ga0157370_10295408
791 Ga0157370_10394664
792 Ga0157369_10000131
793 Ga0157369_10066048
794 Ga0157369_10153338
795 Ga0157374_10000454
796 Ga0157374_10002950
797 Ga0157374_10183583
798 Ga0157374_10270619
799 Ga0157374_10405533
800 Ga0157378_10000009
801 Ga0157378_10000132
802 Ga0157378_10072675
803 Ga0163162_10008867
804 Ga0163162_10139776
805 Ga0163162_10260086
806 Ga0157372_10000140
807 Ga0157372_10003387
808 Ga0157372_10022357
809 Ga0157372_10024064
810 Ga0157372_10127311
811 Ga0157372_10167813
812 Ga0157372_10195943
813 Ga0157372_10216840
814 Ga0157372_10270676
815 Ga0157372_10385577
816 Ga0157372_10415102
817 Ga0157375_10031791
818 Ga0157375_10527089
819 Ga0163163_10064869
820 Ga0163163_10203762
821 Ga0157380_10038475
822 Ga0157379_10008178
823 Ga0157379_10092734
824 Ga0157379_10131515
825 Ga0157379_10385632
826 Ga0157376_10005214
827 Ga0157376_10048210
828 Ga0182005_1010329
829 Ga0213876_10010112
830 Ga0224571_101336
831 Ga0207692_10092447
832 Ga0207642_10004701
833 Ga0207642_10013759
834 Ga0207710_10008244
835 Ga0207688_10078329
836 Ga0207680_10160582
837 Ga0207647_10006752
838 Ga0207647_10082297
839 Ga0207699_10000549
840 Ga0207699_10045764
841 Ga0207645_10009002
842 Ga0207645_10043444
843 Ga0207705_10003517
844 Ga0207705_10037522
845 Ga0207654_10106501
846 Ga0207707_10020215
847 Ga0207707_10083602
848 Ga0207707_10207853
849 Ga0207707_10340557
850 Ga0207695_10022632
851 Ga0207695_10136327
852 Ga0207695_10223107
853 Ga0207695_10235157
854 Ga0207671_10064106
855 Ga0207671_10386481
856 Ga0207693_10000012
857 Ga0207693_10000058
858 Ga0207693_10001160
859 Ga0207663_10000280
860 Ga0207663_10003486
861 Ga0207663_10035240
862 Ga0207663_10072038
863 Ga0207662_10032839
864 Ga0207657_10005169
865 Ga0207657_10008891
866 Ga0207649_10017361
867 Ga0207652_10025236
868 Ga0207652_10107796
869 Ga0207652_10136139
870 Ga0207646_10011611
871 Ga0207646_10310221
872 Ga0207681_10061260
873 Ga0207681_10237495
874 Ga0207694_10017121
875 Ga0207694_10046813
876 Ga0207694_10047232
877 Ga0207694_10164794
878 Ga0207650_10031670
879 Ga0207650_10095877
880 Ga0207687_10006501
881 Ga0207687_10014350
882 Ga0207700_10002138
883 Ga0207700_10003116
884 Ga0207700_10012980
885 Ga0207700_10036822
886 Ga0207700_10080225
887 Ga0207700_10142647
888 Ga0207664_10000098
889 Ga0207664_10032571
890 Ga0207664_10080991
891 Ga0207690_10074616
892 Ga0207690_10326325
893 Ga0207706_10041154
894 Ga0207670_10019783
895 Ga0207670_10212897
896 Ga0207665_10003619
897 Ga0207665_10005922
898 Ga0207665_10011313
899 Ga0207691_10109027
900 Ga0207691_10223514
901 Ga0207711_10003045
902 Ga0207711_10067029
903 Ga0207689_10021947
904 Ga0207689_10054566
905 Ga0207689_10204950
906 Ga0207661_10029779
907 Ga0207661_10051469
908 Ga0207661_10057318
909 Ga0207661_10073680
910 Ga0207661_10077970
911 Ga0207679_10026074
912 Ga0207667_10045259
913 Ga0207667_10118335
914 Ga0207667_10244947
915 Ga0207667_10329063
916 Ga0207651_10383122
917 Ga0207712_10008799
918 Ga0207668_10005700
919 Ga0207668_10270989
920 Ga0207640_10005099
921 Ga0207640_10038872
922 Ga0207658_10355779
923 Ga0207677_10009196
924 Ga0207703_10035638
925 Ga0207703_10225718
926 Ga0207703_10354199
927 Ga0207639_10502718
928 Ga0207678_10021098
929 Ga0207678_10032951
930 Ga0207678_10041612
931 Ga0207702_10001136
932 Ga0207702_10011681
933 Ga0207702_10013736
934 Ga0207702_10024096
935 Ga0207641_10041831
936 Ga0207641_10058413
937 Ga0207648_10041040
938 Ga0207648_10261632
939 Ga0207676_10214958
940 Ga0207674_10000763
941 Ga0207674_10003886
942 Ga0207674_10103405
943 Ga0207675_100042296
944 Ga0207428_10010674
945 Ga0207428_10113856
946 Ga0265356_1000013
947 Ga0265356_1003850
948 Ga0265357_1005310
949 Ga0268266_10000660
950 Ga0268266_10005793
951 Ga0268265_10089939
952 Ga0268264_10077570
953 Ga0268264_10086594
954 Ga0268264_10191456
955 Ga0268264_10343313
956 Ga0265337_1006294
957 Ga0265337_1008518
958 Ga0265337_1013101
959 Ga0265326_10019724
960 Ga0265319_1001494
961 Ga0265319_1007590
962 Ga0265319_1016918
963 Ga0265334_10021022
964 Ga0265318_10003505
965 Ga0265338_10003616
966 Ga0265338_10005972
967 Ga0265338_10009875
968 Ga0265338_10022889
969 Ga0265338_10023060
970 Ga0265338_10029368
971 Ga0265338_10034737
972 Ga0265762_1000831
973 Ga0265762_1005734
974 Ga0265760_10000017
975 Ga0265760_10002961
976 Ga0265760_10028848
977 Ga0265320_10000134
978 Ga0265320_10001451
979 Ga0265320_10002229
980 Ga0265320_10005571
981 Ga0265320_10030138
982 Ga0265340_10012385
983 Ga0265340_10071289
984 Ga0265339_10010523
985 Ga0265339_10012297
986 Ga0265339_10033067
987 Ga0265316_10077493
988 Ga0265313_10009742
989 Ga0265313_10038422
990 Ga0265313_10050688
991 Ga0307508_10000055
992 Ga0265314_10006661
993 Ga0265314_10014921
994 Ga0265314_10030259
995 Ga0265314_10064204
996 Ga0265342_10131723
997 Ga0307413_10063123
998 Ga0307407_10000097
999 Ga0307414_10000226
1000 Ga0373940_0054235
1001 Ga0373923_0038061
1002 Ga0373936_0002594
1003 Ga0373939_0129107
1004 Ga0373945_0110207
1005 Ga0373954_0011513
1006 Ga0373954_0012888
1007 Ga0373954_0129523
1008 Ga0373943_0000669
1009 Ga0373943_0103456
1010 Ga0373955_0014993
1011 Ga0373955_0040590
1012 Ga0373931_0001031
1013 Ga0373931_0056382
1014 Ga0373935_0027635
1015 Ga0373927_0000282
1016 Ga0373933_0084044
1017 Ga0373947_0001632
1018 Ga0373937_0007074
1019 Ga0373937_0025917
1020 Ga0373925_0002387
1021 Ga0395900_0095002
1022 Ga0395905_0125070
1023 Ga0395901_0186719
1024 Ga0436365_1710025
1025 Ga0436363_0134232
1026 Ga0451577_0157140
1027 Ga0451576_0126481
1028 Ga0451576_0501288
1029 Ga0495592_0000012
1030 Ga0495603_0130134
1031 Ga0495651_0014012
1032 Ga0495651_0015969
1033 Ga0495650_0021709
1034 Ga0495580_0000182
1035 Ga0495580_0001231
1036 Ga0495580_0001774
1037 Ga0495582_0021845
1038 Ga0495662_0025525
1039 Ga0495664_0033374
1040 Ga0495585_0029567
1041 Ga0495594_0037380
1042 Ga0495608_0207436
1043 Ga0495618_0004341
1044 Ga0495628_0003611
1045 Ga0495628_0187673
1046 Ga0495630_0000150
1047 Ga0495630_0005339
1048 Ga0495666_0029224
1049 Ga0495666_0041066
1050 Ga0495640_0011154
1051 Ga0495586_0000258
1052 Ga0495586_0010769
1053 Ga0495645_0003809
1054 Ga0495645_0123587
1055 Ga0495645_0155977
1056 Ga0495667_0036987
1057 Ga0495667_0138596
1058 Ga0495634_0023408
1059 Ga0495625_0000315
1060 Ga0495599_0001485
1061 Ga0495658_0015852
1062 Ga0495613_0034461
1063 Ga0495624_0027095
1064 Ga0495624_0174349
1065 Ga0495581_0032505
1066 Ga0495581_0112891
1067 Ga0495674_0004620
1068 Ga0495674_0006874
1069 Ga0495674_0029207
1070 Ga0495674_0045977
1071 Ga0495674_0049300
1072 Ga0495674_0095979
1073 Ga0495674_0323339
1074 Ga0495672_0002235
1075 Ga0495676_0005138
1076 Ga0495675_0018679
1077 Ga0495675_0174470
1078 Ga0495684_0015090
1079 Ga0495684_0052491
1080 Ga0495602_0028268
1081 Ga0495602_0067819
1082 Ga0496102_0004321
1083 Ga0496102_0056024
1084 Ga0496104_0281170
1085 Ga0496105_0080123
1086 Ga0496106_0061150
1087 Ga0496106_0062612
1088 Ga0496107_0051702
1089 Ga0496107_0143594
1090 Ga0496108_0198291
1091 Ga0496109_0000699
1092 Ga0496109_0002509
1093 Ga0496109_0260105
1094 Ga0496110_0000061
1095 Ga0496112_0006189
1096 Ga0496112_0049692
1097 Ga0496114_0153627
1098 Ga0496115_0006810
1099 Ga0496115_0113065
1100 Ga0496126_0044651
1101 Ga0501032_0000027
1102 Ga0501032_0001332
1103 Ga0501033_0000002
1104 Ga0501034_0001001
1105 Ga0501034_0092359
1106 Ga0501034_0129373
1107 Ga0501038_0132045
1108 Ga0501040_0102654
1109 Ga0501043_0048128
1110 Ga0501046_0057567
1111 Ga0501046_0089202
1112 Ga0501047_0005823
1113 Ga0501047_0009307
1114 Ga0501047_0089629
1115 Ga0501048_0315223
1116 Ga0501067_0201469
1117 Ga0501070_0052004
1118 Ga0501076_0199964
1119 Ga0501079_0305435
1120 Ga0501080_0007661
1121 Ga0501083_0069033
1122 Ga0501083_0153013
1123 Ga0501035_0000475
1124 Ga0501035_0315424
1125 Ga0501044_0000080
1126 Ga0501044_0000704
1127 nmdc:mga00v17_100701_c1
1128 nmdc:mga0k408_75421_c1
1129 nmdc:mga06z11_74034_c1
1130 nmdc:mga05p37_19475_c1
1131 nmdc:mga06r32_101896_c1
1132 nmdc:mga06r32_236137_c1
1133 nmdc:mga06r32_266005_c1
1134 nmdc:mga08y16_160311_c1
1135 nmdc:mga08y16_7180_c1
1136 nmdc:mga0n895_245116_c1
1137 nmdc:mga0n895_36484_c1
1138 nmdc:mga0n895_43753_c1
1139 nmdc:mga0n895_53059_c1
1140 nmdc:mga0rr50_57659_c1
1141 nmdc:mga0a205_131917_c1
1142 nmdc:mga0a205_439533_c1
1143 nmdc:mga0a205_93555_c1
1144 Ga0500555_004465
1145 Ga0500568_0002084
1146 Ga0500616_0000924
1147 Ga0500645_000688
1148 Ga0500599_002616
1149 Ga0501084_0008214
1150 Ga0501082_0035853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.8305 3 320
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8212 3 320
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.8197 3 320
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8106 3 320
2q19-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase apo form 0.8086 3 321
ID Description Score Start End Superfamily
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8438 77 320 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8326 77 320 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7714 87 320 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7537 72 317 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7537 87 320 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A359LRW9-F1-model_v4 GguC protein 0.9895 116 332 GO:0003824
AF-A0A317I7K1-F1-model_v4 FAH family protein 0.9854 137 320 GO:0003824
AF-A0A359LRW9-F1-model_v4 GguC protein 0.985 116 332 GO:0003824
AF-A0A3D4GW42-F1-model_v4 GguC protein 0.981 142 332 GO:0003824
AF-A0A3D4GW42-F1-model_v4 GguC protein 0.9759 142 332 GO:0003824

Map