F465402

General Info

Members Datasets Scaffolds Average Seq Length
575 256 1150 255

Family's Representative Sequence

Representative Sequence 3300025905|Ga0207685_10135157|Ga0207685_101351572
Length 300
Sequence MLALRRSSKNTNEPEQFTDTRSIACHDARDWRRWPELFERYWYPHRGKGSTIDEVRAYWDRHIHDLEITRHPVGSRGFFDDLDQYHFEKLHHLLRLVPFDESRGLRVLEVGCGAGVDLARFARAGATVTGVDLSASAIQLARANFDQQGLHADLRVADGEHLPFADSSFDIVYAHGVVQYTVDPQRLVDECRRVARPGALAIFQVYNRVSWLNALSKLMKVGLEHQDAPVLRKFSIAEFRRLLVGFREVRIVPERFPVRSRLHGGWKGTLYNTVFVGTFNLVPRPLVRRFGWHLLAFCRK

Samples

Sample ID Description Type Environment
1 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
168 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
169 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 5.39
Rhizosphere 94.43
Stem 0
Stem Tuber 0
Unclassified 20.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207685_10135157 3300025905 Bacteria 1099
2 MRS1b_contig_7651396 2162886011 Bacteria 1063
3 Ga0065712_10068874 3300005290 Bacteria 8719
4 Ga0065712_10238736 3300005290 Unclassified 990
5 Ga0065715_10116053 3300005293 Bacteria 2393
6 Ga0065715_10167994 3300005293 Bacteria 1568
7 Ga0065707_10089218 3300005295 Bacteria 4435
8 Ga0070658_10032010 3300005327 Unclassified 4227
9 Ga0070658_10569954 3300005327 Unclassified 980
10 Ga0070676_10056797 3300005328 Unclassified 2314
11 Ga0070676_10076543 3300005328 Bacteria 2020
12 Ga0070683_100002741 3300005329 Bacteria 14070
13 Ga0070690_100051938 3300005330 Bacteria 2619
14 Ga0070690_100172906 3300005330 Bacteria 1488
15 Ga0070670_100025795 3300005331 Bacteria 5058
16 Ga0070670_100133928 3300005331 Bacteria 2141
17 Ga0070670_100207825 3300005331 Bacteria 1702
18 Ga0070677_10145889 3300005333 Bacteria 1097
19 Ga0068869_100097033 3300005334 Bacteria 2225
20 Ga0068869_100216276 3300005334 Archaea 1517
21 Ga0070666_10047357 3300005335 Bacteria 2886
22 Ga0070666_10064976 3300005335 Bacteria 2475
23 Ga0070680_100096019 3300005336 Bacteria 2458
24 Ga0068868_100026034 3300005338 Bacteria 4455
25 Ga0068868_100105685 3300005338 Unclassified 2283
26 Ga0068868_100117448 3300005338 Bacteria 2167
27 Ga0070660_100012967 3300005339 Bacteria 5964
28 Ga0070660_100055386 3300005339 Bacteria 3064
29 Ga0070689_100158250 3300005340 Bacteria 1830
30 Ga0070691_10000430 3300005341 Bacteria 15481
31 Ga0070687_100072485 3300005343 Bacteria 1854
32 Ga0070687_100080259 3300005343 Unclassified 1778
33 Ga0070661_100016198 3300005344 Bacteria 5265
34 Ga0070661_100086643 3300005344 Unclassified 2316
35 Ga0070661_100259111 3300005344 Unclassified 1344
36 Ga0070668_100050645 3300005347 Bacteria 3198
37 Ga0070668_100081220 3300005347 Unclassified 2541
38 Ga0070669_100001159 3300005353 Bacteria 19254
39 Ga0070669_100017176 3300005353 Bacteria 5163
40 Ga0070669_100089300 3300005353 Bacteria 2308
41 Ga0070669_100164650 3300005353 Bacteria 1725
42 Ga0070669_100203850 3300005353 Bacteria 1558
43 Ga0070675_100000124 3300005354 Bacteria 45633
44 Ga0070675_100030819 3300005354 Bacteria 4331
45 Ga0070671_100038886 3300005355 Bacteria 3948
46 Ga0070674_100007706 3300005356 Bacteria 6358
47 Ga0070674_100034728 3300005356 Bacteria 3371
48 Ga0070674_100256070 3300005356 Bacteria 1377
49 Ga0070674_100427014 3300005356 Bacteria 1089
50 Ga0070673_100074196 3300005364 Bacteria 2741
51 Ga0070673_100101750 3300005364 Unclassified 2368
52 Ga0070673_100268683 3300005364 Bacteria 1492
53 Ga0070673_100400794 3300005364 Bacteria 1227
54 Ga0070659_100044358 3300005366 Unclassified 3481
55 Ga0070659_100108743 3300005366 Bacteria 2237
56 Ga0070667_100020047 3300005367 Bacteria 5551
57 Ga0070667_100170343 3300005367 Unclassified 1922
58 Ga0070714_100185827 3300005435 Bacteria 1893
59 Ga0070713_100013721 3300005436 Bacteria 5991
60 Ga0070701_10005342 3300005438 Bacteria 5293
61 Ga0070701_10165618 3300005438 Bacteria 1284
62 Ga0070705_100025745 3300005440 Bacteria 3193
63 Ga0070705_100070303 3300005440 Bacteria 2114
64 Ga0070705_100240135 3300005440 Bacteria 1266
65 Ga0070700_100003743 3300005441 Bacteria 7867
66 Ga0070700_100082760 3300005441 Bacteria 2076
67 Ga0070694_100013123 3300005444 Bacteria 5169
68 Ga0070694_100043189 3300005444 Bacteria 3014
69 Ga0070708_100826278 3300005445 Bacteria 871
70 Ga0070663_100167446 3300005455 Bacteria 1696
71 Ga0070678_100022200 3300005456 Bacteria 4200
72 Ga0070678_100146133 3300005456 Bacteria 1898
73 Ga0070678_100472286 3300005456 Unclassified 1102
74 Ga0070662_100111666 3300005457 Unclassified 2083
75 Ga0070662_100196868 3300005457 Bacteria 1597
76 Ga0070662_100473273 3300005457 Bacteria 1042
77 Ga0070681_10071016 3300005458 Bacteria 3446
78 Ga0070681_10327668 3300005458 Unclassified 1441
79 Ga0068867_100311148 3300005459 Bacteria 1302
80 Ga0070706_100198705 3300005467 Unclassified 1873
81 Ga0070707_100050472 3300005468 Bacteria 3988
82 Ga0070707_100059881 3300005468 Bacteria 3652
83 Ga0070707_100192076 3300005468 Unclassified 1991
84 Ga0070698_100418744 3300005471 Bacteria 1274
85 Ga0070699_100002365 3300005518 Bacteria 16923
86 Ga0070699_100041128 3300005518 Unclassified 4001
87 Ga0070699_100454903 3300005518 Bacteria 1161
88 Ga0070684_100000084 3300005535 Bacteria 61595
89 Ga0070697_100028737 3300005536 Bacteria 4454
90 Ga0068853_100280838 3300005539 Bacteria 1535
91 Ga0070672_100012845 3300005543 Bacteria 5899
92 Ga0070672_100218747 3300005543 Bacteria 1597
93 Ga0070686_100000823 3300005544 Bacteria 17935
94 Ga0070686_100042846 3300005544 Bacteria 2837
95 Ga0070686_100095884 3300005544 Bacteria 1994
96 Ga0070686_100126175 3300005544 Bacteria 1764
97 Ga0070695_100080773 3300005545 Bacteria 2150
98 Ga0070696_100005285 3300005546 Bacteria 8618
99 Ga0070696_100009986 3300005546 Bacteria 6349
100 Ga0070696_100147238 3300005546 Bacteria 1726
101 Ga0070665_100004836 3300005548 Bacteria 13994
102 Ga0070665_100005573 3300005548 Bacteria 12945
103 Ga0070665_100012698 3300005548 Bacteria 8482
104 Ga0070665_100016931 3300005548 Bacteria 7309
105 Ga0070665_100087564 3300005548 Unclassified 3120
106 Ga0070704_100037363 3300005549 Bacteria 3317
107 Ga0070704_100112574 3300005549 Bacteria 2074
108 Ga0070704_100265111 3300005549 Bacteria 1417
109 Ga0070704_100285723 3300005549 Unclassified 1369
110 Ga0068855_100020352 3300005563 Bacteria 7959
111 Ga0070664_100000177 3300005564 Bacteria 44970
112 Ga0070664_100043878 3300005564 Bacteria 3775
113 Ga0070664_100323769 3300005564 Bacteria 1397
114 Ga0068857_100240031 3300005577 Unclassified 1659
115 Ga0068857_100652342 3300005577 Unclassified 997
116 Ga0068854_100059245 3300005578 Bacteria 2767
117 Ga0068854_100059891 3300005578 Bacteria 2752
118 Ga0068856_100089237 3300005614 Unclassified 3066
119 Ga0070702_100005051 3300005615 Bacteria 6097
120 Ga0068852_100102678 3300005616 Bacteria 2584
121 Ga0068859_100059664 3300005617 Bacteria 3844
122 Ga0068859_100166961 3300005617 Bacteria 2281
123 Ga0068864_100008489 3300005618 Bacteria 8476
124 Ga0068864_100093435 3300005618 Bacteria 2657
125 Ga0068864_100271076 3300005618 Bacteria 1581
126 Ga0068866_10281849 3300005718 Archaea 1030
127 Ga0068861_100013691 3300005719 Bacteria 5680
128 Ga0068861_100087783 3300005719 Bacteria 2448
129 Ga0068861_100167777 3300005719 Bacteria 1817
130 Ga0068861_100187732 3300005719 Bacteria 1725
131 Ga0068851_10135952 3300005834 Bacteria 1333
132 Ga0068863_100000208 3300005841 Bacteria 62544
133 Ga0068863_100076615 3300005841 Unclassified 3164
134 Ga0068858_100001993 3300005842 Bacteria 20883
135 Ga0068858_100055097 3300005842 Unclassified 3676
136 Ga0068858_100104069 3300005842 Bacteria 2649
137 Ga0068858_100313623 3300005842 Bacteria 1498
138 Ga0068858_100328469 3300005842 Bacteria 1463
139 Ga0068860_100050584 3300005843 Unclassified 3955
140 Ga0068860_100234717 3300005843 Bacteria 1783
141 Ga0068860_100326378 3300005843 Unclassified 1507
142 Ga0068860_100358536 3300005843 Unclassified 1436
143 Ga0068862_100013096 3300005844 Bacteria 6859
144 Ga0068862_100081176 3300005844 Bacteria 2813
145 Ga0068862_100090736 3300005844 Bacteria 2660
146 Ga0068862_100653661 3300005844 Bacteria 1014
147 Ga0081539_10025254 3300005985 Bacteria 3832
148 Ga0070715_10045324 3300006163 Bacteria 1864
149 Ga0097621_100016376 3300006237 Bacteria 5604
150 Ga0097621_100016993 3300006237 Bacteria 5516
151 Ga0097621_100034149 3300006237 Bacteria 4055
152 Ga0097621_100035677 3300006237 Bacteria 3975
153 Ga0097621_100095148 3300006237 Bacteria 2498
154 Ga0097621_100384598 3300006237 Bacteria 1254
155 Ga0097621_100484732 3300006237 Bacteria 1118
156 Ga0097621_100518228 3300006237 Unclassified 1082
157 Ga0068871_100022739 3300006358 Unclassified 4838
158 Ga0068871_100132801 3300006358 Bacteria 2112
159 Ga0075428_100091131 3300006844 Bacteria 3325
160 Ga0075428_100222150 3300006844 Unclassified 2040
161 Ga0075428_100288065 3300006844 Bacteria 1767
162 Ga0075430_100139900 3300006846 Bacteria 2016
163 Ga0075430_100227818 3300006846 Unclassified 1546
164 Ga0075430_100376315 3300006846 Bacteria 1172
165 Ga0075431_100197616 3300006847 Unclassified 2059
166 Ga0075433_10016896 3300006852 Bacteria 6031
167 Ga0075433_10048177 3300006852 Bacteria 3706
168 Ga0075433_10597996 3300006852 Unclassified 968
169 Ga0075434_100001642 3300006871 Bacteria 19025
170 Ga0075434_100002076 3300006871 Bacteria 17393
171 Ga0075434_100002153 3300006871 Bacteria 17151
172 Ga0075434_100002944 3300006871 Bacteria 15137
173 Ga0075434_100067952 3300006871 Bacteria 3550
174 Ga0075434_100247769 3300006871 Bacteria 1801
175 Ga0075434_100495827 3300006871 Unclassified 1242
176 Ga0075429_100322859 3300006880 Bacteria 1351
177 Ga0068865_100008845 3300006881 Bacteria 6227
178 Ga0068865_100046452 3300006881 Unclassified 2979
179 Ga0068865_100154057 3300006881 Bacteria 1746
180 Ga0068865_100444924 3300006881 Bacteria 1070
181 Ga0075436_100004558 3300006914 Bacteria 9488
182 Ga0075436_100007050 3300006914 Bacteria 7695
183 Ga0075436_100198773 3300006914 Bacteria 1419
184 Ga0097620_100059663 3300006931 Bacteria 3844
185 Ga0097620_100166963 3300006931 Bacteria 2281
186 Ga0075435_100000008 3300007076 Bacteria 115376
187 Ga0075435_100001847 3300007076 Bacteria 13744
188 Ga0075435_100005198 3300007076 Bacteria 9053
189 Ga0075435_100032205 3300007076 Bacteria 4139
190 Ga0075435_100086428 3300007076 Bacteria 2582
191 Ga0075435_100111621 3300007076 Unclassified 2274
192 Ga0075435_100239206 3300007076 Bacteria 1544
193 Ga0075435_100615090 3300007076 Unclassified 942
194 Ga0105240_10365682 3300009093 Unclassified 1633
195 Ga0111539_10000073 3300009094 Bacteria 100413
196 Ga0111539_10003812 3300009094 Bacteria 19843
197 Ga0111539_10022119 3300009094 Bacteria 7815
198 Ga0111539_10032658 3300009094 Bacteria 6320
199 Ga0111539_10034345 3300009094 Bacteria 6151
200 Ga0105245_10006578 3300009098 Bacteria 10201
201 Ga0105245_10019988 3300009098 Bacteria 5870
202 Ga0105247_10017898 3300009101 Bacteria 4251
203 Ga0105247_10024790 3300009101 Bacteria 3616
204 Ga0105247_10191046 3300009101 Bacteria 1371
205 Ga0114129_10000186 3300009147 Bacteria 69381
206 Ga0114129_10000233 3300009147 Bacteria 62134
207 Ga0114129_10002876 3300009147 Bacteria 24089
208 Ga0114129_10003773 3300009147 Bacteria 21371
209 Ga0114129_10020889 3300009147 Bacteria 9302
210 Ga0114129_10037879 3300009147 Bacteria 6805
211 Ga0114129_10179197 3300009147 Bacteria 2885
212 Ga0114129_10372368 3300009147 Bacteria 1887
213 Ga0114129_10622278 3300009147 Bacteria 1396
214 Ga0105243_10108532 3300009148 Unclassified 2317
215 Ga0105243_10247524 3300009148 Bacteria 1590
216 Ga0105243_10347912 3300009148 Bacteria 1360
217 Ga0105243_10539054 3300009148 Bacteria 1113
218 Ga0105243_10845821 3300009148 Unclassified 906
219 Ga0105241_10486819 3300009174 Bacteria 1097
220 Ga0105242_10009432 3300009176 Bacteria 7481
221 Ga0105242_10062391 3300009176 Unclassified 3067
222 Ga0105242_10082476 3300009176 Bacteria 2691
223 Ga0105242_10147679 3300009176 Unclassified 2047
224 Ga0105242_10240169 3300009176 Bacteria 1628
225 Ga0105242_10268085 3300009176 Unclassified 1545
226 Ga0105242_10811086 3300009176 Bacteria 927
227 Ga0105248_10034728 3300009177 Bacteria 5642
228 Ga0105248_10045382 3300009177 Unclassified 4928
229 Ga0105248_10047072 3300009177 Bacteria 4836
230 Ga0105248_10049751 3300009177 Bacteria 4700
231 Ga0105248_10073106 3300009177 Bacteria 3853
232 Ga0105248_10114481 3300009177 Unclassified 3042
233 Ga0105248_10138935 3300009177 Bacteria 2740
234 Ga0105248_10161167 3300009177 Bacteria 2530
235 Ga0105248_10164034 3300009177 Unclassified 2505
236 Ga0105248_10175000 3300009177 Unclassified 2419
237 Ga0105248_10464007 3300009177 Bacteria 1428
238 Ga0105248_10844968 3300009177 Bacteria 1033
239 Ga0105248_11277979 3300009177 Bacteria 830
240 Ga0105237_10751022 3300009545 Unclassified 982
241 Ga0105238_10734074 3300009551 Bacteria 1001
242 Ga0105249_10090583 3300009553 Bacteria 2860
243 Ga0105249_10091588 3300009553 Bacteria 2845
244 Ga0105249_10152791 3300009553 Unclassified 2224
245 Ga0105249_10244843 3300009553 Bacteria 1775
246 Ga0105249_10626591 3300009553 Bacteria 1132
247 Ga0105249_10709216 3300009553 Bacteria 1066
248 Ga0157374_10025835 3300013296 Bacteria 5279
249 Ga0157374_10560917 3300013296 Unclassified 1150
250 Ga0163162_10032215 3300013306 Bacteria 5204
251 Ga0157372_10233277 3300013307 Bacteria 2134
252 Ga0157375_10449444 3300013308 Unclassified 1454
253 Ga0157375_11256626 3300013308 Bacteria 870
254 Ga0163163_10019533 3300014325 Bacteria 6365
255 Ga0163163_10051381 3300014325 Bacteria 4065
256 Ga0163163_10074981 3300014325 Bacteria 3376
257 Ga0163163_10771490 3300014325 Bacteria 1025
258 Ga0157380_10104324 3300014326 Bacteria 2367
259 Ga0157380_10118912 3300014326 Bacteria 2235
260 Ga0157380_10215718 3300014326 Unclassified 1713
261 Ga0157380_10533128 3300014326 Unclassified 1148
262 Ga0157377_10168824 3300014745 Unclassified 1367
263 Ga0157379_10009599 3300014968 Bacteria 8427
264 Ga0157379_10043790 3300014968 Bacteria 3996
265 Ga0157379_10634523 3300014968 Bacteria 999
266 Ga0157376_10007968 3300014969 Bacteria 7601
267 Ga0157376_10022370 3300014969 Bacteria 4926
268 Ga0157376_10031444 3300014969 Bacteria 4250
269 Ga0157376_10074348 3300014969 Unclassified 2897
270 Ga0157376_10224682 3300014969 Bacteria 1741
271 Ga0163161_10079408 3300017792 Bacteria 2413
272 Ga0207697_10001244 3300025315 Bacteria 13962
273 Ga0207697_10042405 3300025315 Bacteria 1870
274 Ga0207656_10146401 3300025321 Bacteria 1116
275 Ga0207682_10077830 3300025893 Bacteria 1416
276 Ga0207642_10076886 3300025899 Unclassified 1608
277 Ga0207710_10028800 3300025900 Bacteria 2412
278 Ga0207680_10369953 3300025903 Unclassified 1009
279 Ga0207645_10003548 3300025907 Bacteria 11809
280 Ga0207645_10052332 3300025907 Unclassified 2609
281 Ga0207645_10278162 3300025907 Bacteria 1111
282 Ga0207705_10094554 3300025909 Bacteria 2192
283 Ga0207707_10272534 3300025912 Unclassified 1467
284 Ga0207695_10529192 3300025913 Bacteria 1060
285 Ga0207663_10071739 3300025916 Bacteria 2236
286 Ga0207660_10144707 3300025917 Unclassified 1820
287 Ga0207662_10022851 3300025918 Bacteria 3589
288 Ga0207657_10008607 3300025919 Bacteria 10331
289 Ga0207657_10087704 3300025919 Bacteria 2603
290 Ga0207649_10001143 3300025920 Bacteria 16056
291 Ga0207649_10063347 3300025920 Unclassified 2334
292 Ga0207646_10024766 3300025922 Bacteria 5493
293 Ga0207646_10455389 3300025922 Unclassified 1154
294 Ga0207646_10489111 3300025922 Unclassified 1109
295 Ga0207681_10009893 3300025923 Bacteria 5835
296 Ga0207681_10018867 3300025923 Bacteria 4350
297 Ga0207681_10057818 3300025923 Unclassified 2652
298 Ga0207681_10069988 3300025923 Unclassified 2442
299 Ga0207681_10141269 3300025923 Bacteria 1793
300 Ga0207694_10578594 3300025924 Bacteria 944
301 Ga0207694_10639992 3300025924 Bacteria 896
302 Ga0207650_10107616 3300025925 Bacteria 2154
303 Ga0207650_10108124 3300025925 Bacteria 2149
304 Ga0207650_10129819 3300025925 Bacteria 1971
305 Ga0207650_10286314 3300025925 Bacteria 1343
306 Ga0207659_10000371 3300025926 Bacteria 27010
307 Ga0207659_10219263 3300025926 Unclassified 1528
308 Ga0207659_10325836 3300025926 Bacteria 1268
309 Ga0207659_10571260 3300025926 Bacteria 962
310 Ga0207687_10003791 3300025927 Bacteria 10160
311 Ga0207687_10014349 3300025927 Bacteria 5183
312 Ga0207687_10134951 3300025927 Bacteria 1865
313 Ga0207687_10244741 3300025927 Bacteria 1423
314 Ga0207700_10183315 3300025928 Bacteria 1754
315 Ga0207664_10142618 3300025929 Bacteria 2028
316 Ga0207644_10107557 3300025931 Bacteria 2104
317 Ga0207644_10340404 3300025931 Unclassified 1216
318 Ga0207690_10169980 3300025932 Unclassified 1632
319 Ga0207706_10038280 3300025933 Unclassified 4255
320 Ga0207706_10070048 3300025933 Bacteria 3084
321 Ga0207706_10077972 3300025933 Bacteria 2914
322 Ga0207706_10133192 3300025933 Bacteria 2186
323 Ga0207686_10006660 3300025934 Bacteria 6230
324 Ga0207686_10051174 3300025934 Unclassified 2572
325 Ga0207686_10167803 3300025934 Unclassified 1545
326 Ga0207709_10020389 3300025935 Bacteria 3739
327 Ga0207669_10076604 3300025937 Bacteria 2124
328 Ga0207669_10093753 3300025937 Bacteria 1963
329 Ga0207669_10124163 3300025937 Bacteria 1759
330 Ga0207704_10046524 3300025938 Bacteria 2587
331 Ga0207704_10072232 3300025938 Unclassified 2193
332 Ga0207704_10129732 3300025938 Bacteria 1743
333 Ga0207704_10193484 3300025938 Unclassified 1481
334 Ga0207665_10074687 3300025939 Bacteria 2320
335 Ga0207691_10019212 3300025940 Bacteria 6469
336 Ga0207691_10231376 3300025940 Bacteria 1600
337 Ga0207691_10301196 3300025940 Bacteria 1377
338 Ga0207711_10030479 3300025941 Bacteria 4549
339 Ga0207711_10035917 3300025941 Bacteria 4203
340 Ga0207711_10114180 3300025941 Unclassified 2405
341 Ga0207711_10128160 3300025941 Unclassified 2272
342 Ga0207711_10142390 3300025941 Bacteria 2158
343 Ga0207711_10182759 3300025941 Bacteria 1908
344 Ga0207711_10201574 3300025941 Unclassified 1816
345 Ga0207711_10244530 3300025941 Bacteria 1646
346 Ga0207689_10055363 3300025942 Unclassified 3265
347 Ga0207689_10082831 3300025942 Bacteria 2638
348 Ga0207689_10316864 3300025942 Archaea 1294
349 Ga0207661_10000827 3300025944 Bacteria 20291
350 Ga0207679_10041434 3300025945 Bacteria 3302
351 Ga0207679_10201418 3300025945 Bacteria 1663
352 Ga0207667_10272998 3300025949 Unclassified 1728
353 Ga0207651_10048922 3300025960 Bacteria 2861
354 Ga0207651_10064084 3300025960 Bacteria 2570
355 Ga0207712_10051313 3300025961 Bacteria 2884
356 Ga0207712_10107013 3300025961 Bacteria 2090
357 Ga0207712_10181288 3300025961 Bacteria 1654
358 Ga0207668_10320047 3300025972 Bacteria 1287
359 Ga0207668_10654977 3300025972 Bacteria 919
360 Ga0207640_10108447 3300025981 Bacteria 1962
361 Ga0207658_10027926 3300025986 Unclassified 3970
362 Ga0207658_10586719 3300025986 Bacteria 1000
363 Ga0207677_10147659 3300026023 Unclassified 1809
364 Ga0207677_10154834 3300026023 Bacteria 1773
365 Ga0207703_10023091 3300026035 Bacteria 4885
366 Ga0207703_10051766 3300026035 Unclassified 3330
367 Ga0207703_10111073 3300026035 Bacteria 2339
368 Ga0207703_10252244 3300026035 Bacteria 1591
369 Ga0207703_10264705 3300026035 Bacteria 1555
370 Ga0207639_10312085 3300026041 Bacteria 1393
371 Ga0207678_10198689 3300026067 Bacteria 1714
372 Ga0207708_10002324 3300026075 Bacteria 13962
373 Ga0207708_10103265 3300026075 Unclassified 2208
374 Ga0207708_10247304 3300026075 Unclassified 1436
375 Ga0207702_10162460 3300026078 Bacteria 2041
376 Ga0207641_10002288 3300026088 Bacteria 17844
377 Ga0207641_10721922 3300026088 Unclassified 982
378 Ga0207648_10195635 3300026089 Bacteria 1793
379 Ga0207648_10237260 3300026089 Bacteria 1623
380 Ga0207648_10343096 3300026089 Bacteria 1345
381 Ga0207676_10013168 3300026095 Bacteria 5938
382 Ga0207676_10223022 3300026095 Bacteria 1680
383 Ga0207674_10382080 3300026116 Unclassified 1361
384 Ga0207675_100009696 3300026118 Bacteria 9009
385 Ga0207675_100083802 3300026118 Bacteria 2991
386 Ga0207675_100229924 3300026118 Bacteria 1789
387 Ga0207675_100253366 3300026118 Bacteria 1704
388 Ga0207675_100301360 3300026118 Bacteria 1561
389 Ga0207683_10013915 3300026121 Bacteria 6860
390 Ga0207683_10027316 3300026121 Bacteria 4931
391 Ga0207683_10393635 3300026121 Unclassified 1274
392 Ga0207428_10012394 3300027907 Bacteria 7491
393 Ga0207428_10049001 3300027907 Bacteria 3387
394 Ga0207428_10084815 3300027907 Unclassified 2468
395 Ga0268266_10004330 3300028379 Bacteria 13652
396 Ga0268266_10024165 3300028379 Bacteria 5171
397 Ga0268266_10033316 3300028379 Bacteria 4379
398 Ga0268265_10041096 3300028380 Bacteria 3419
399 Ga0268265_10049509 3300028380 Bacteria 3160
400 Ga0268265_10240765 3300028380 Bacteria 1596
401 Ga0268265_10426733 3300028380 Bacteria 1232
402 Ga0268264_10037757 3300028381 Unclassified 3984
403 Ga0268264_10225240 3300028381 Bacteria 1728
404 Ga0268264_10446178 3300028381 Bacteria 1253
405 Ga0268264_10470548 3300028381 Unclassified 1221
406 Ga0307408_100090437 3300031548 Bacteria 2310
407 Ga0307406_10273659 3300031901 Bacteria 1284
408 Ga0373930_0000223 3300034816 Bacteria 7108
409 Ga0373958_0015328 3300034819 Bacteria 1352
410 Ga0373959_0001651 3300034820 Bacteria 3550
411 Ga0373938_0002033 3300034957 Bacteria 3244
412 Ga0373928_0001102 3300035084 Bacteria 5343
413 Ga0373929_0001720 3300035085 Bacteria 4112
414 Ga0373951_0067887 3300035091 Bacteria 904
415 Ga0373932_0043561 3300035112 Bacteria 1306
416 Ga0373939_0026405 3300035114 Unclassified 1637
417 Ga0373941_0002830 3300035115 Bacteria 3865
418 Ga0373941_0068798 3300035115 Bacteria 1170
419 Ga0373960_0001201 3300035121 Bacteria 5660
420 Ga0373943_0212505 3300035170 Bacteria 1075
421 Ga0373955_0085025 3300035172 Bacteria 1795
422 Ga0373955_0101305 3300035172 Bacteria 1654
423 Ga0373942_0009098 3300035207 Bacteria 2320
424 Ga0373961_0002904 3300035241 Bacteria 4343
425 Ga0373931_0026730 3300035691 Bacteria 2940
426 Ga0373931_0095085 3300035691 Unclassified 1667
427 Ga0373931_0164702 3300035691 Bacteria 1302
428 Ga0373935_0191248 3300035692 Bacteria 1410
429 Ga0373937_0015382 3300036401 Bacteria 6767
430 Ga0373937_0127387 3300036401 Bacteria 2376
431 Ga0439441_025940 3300042001 Bacteria 1110
432 Ga0439435_0008841 3300042436 Unclassified 2347
433 Ga0439435_0016314 3300042436 Bacteria 1861
434 Ga0439440_0032012 3300042993 Bacteria 1247
435 Ga0453683_0308002 3300044673 Unclassified 1014
436 Ga0466963_0013267 3300044694 Bacteria 5058
437 Ga0451576_0077686 3300045051 Bacteria 3455
438 Ga0451576_0100725 3300045051 Bacteria 3004
439 Ga0451576_0549469 3300045051 Unclassified 1213
440 Ga0466967_1021948 3300045976 Bacteria 823
441 Ga0495603_0065004 3300046455 Bacteria 2150
442 Ga0495629_0117656 3300046459 Bacteria 1852
443 Ga0495651_0206903 3300046462 Bacteria 1369
444 Ga0495653_0296094 3300046463 Bacteria 1057
445 Ga0495639_0057180 3300046475 Bacteria 1782
446 Ga0495628_0567700 3300046516 Bacteria 813
447 Ga0495630_0666167 3300046517 Unclassified 797
448 Ga0495640_0175290 3300046533 Bacteria 1369
449 Ga0495640_0281450 3300046533 Bacteria 1036
450 Ga0495598_0152480 3300046537 Unclassified 808
451 Ga0495634_0065066 3300046642 Bacteria 2417
452 Ga0495657_0114839 3300046675 Unclassified 1702
453 Ga0495658_0027260 3300046683 Bacteria 3072
454 Ga0495658_0164960 3300046683 Bacteria 1368
455 Ga0495658_0253592 3300046683 Bacteria 1107
456 Ga0495581_0154748 3300047315 Bacteria 1340
457 Ga0495604_0115850 3300047317 Bacteria 1946
458 Ga0495674_0082578 3300047319 Bacteria 2755
459 Ga0495674_0175572 3300047319 Bacteria 1786
460 Ga0495680_0428149 3300047322 Unclassified 909
461 Ga0495684_0208838 3300047471 Bacteria 1437
462 Ga0496100_0090721 3300048903 Unclassified 2084
463 Ga0496102_0149663 3300048905 Bacteria 2193
464 Ga0496102_0217701 3300048905 Bacteria 1800
465 Ga0496104_0006152 3300048907 Bacteria 10536
466 Ga0496104_0020060 3300048907 Bacteria 6123
467 Ga0496104_0200668 3300048907 Bacteria 1907
468 Ga0496104_0332211 3300048907 Unclassified 1433
469 Ga0496104_0407905 3300048907 Bacteria 1271
470 Ga0496105_0024462 3300048908 Bacteria 4907
471 Ga0496105_0081507 3300048908 Bacteria 2673
472 Ga0496105_0391384 3300048908 Unclassified 1105
473 Ga0496106_0184439 3300048909 Bacteria 1657
474 Ga0496107_0065751 3300048910 Bacteria 2629
475 Ga0496107_0273602 3300048910 Bacteria 1257
476 Ga0496108_0034860 3300048911 Unclassified 4181
477 Ga0496108_0528680 3300048911 Unclassified 1030
478 Ga0496108_0645310 3300048911 Bacteria 920
479 Ga0496109_0000257 3300048912 Bacteria 51399
480 Ga0496109_0024044 3300048912 Bacteria 5413
481 Ga0496110_0029509 3300048913 Unclassified 4721
482 Ga0496110_0075158 3300048913 Bacteria 3002
483 Ga0496111_0031165 3300048914 Unclassified 3797
484 Ga0496111_0220859 3300048914 Unclassified 1408
485 Ga0496112_0000571 3300048915 Bacteria 25344
486 Ga0496112_0006387 3300048915 Bacteria 10348
487 Ga0496112_0100331 3300048915 Bacteria 2864
488 Ga0496112_0317425 3300048915 Bacteria 1503
489 Ga0496113_0074751 3300048916 Bacteria 2584
490 Ga0496114_0003091 3300048917 Bacteria 12757
491 Ga0496114_0052673 3300048917 Unclassified 3391
492 Ga0496115_0085019 3300048918 Bacteria 2580
493 Ga0501031_0098728 3300049568 Bacteria 1905
494 Ga0501033_0002679 3300049570 Bacteria 14955
495 Ga0501034_0008525 3300049571 Bacteria 10818
496 Ga0501040_0165869 3300049576 Bacteria 1563
497 Ga0501042_0028221 3300049578 Bacteria 3952
498 Ga0501042_0196588 3300049578 Bacteria 1455
499 Ga0501046_0057065 3300049580 Bacteria 3063
500 Ga0501047_0000522 3300049581 Bacteria 41607
501 Ga0501047_0006485 3300049581 Bacteria 11011
502 Ga0501047_0270977 3300049581 Bacteria 1544
503 Ga0501048_0042073 3300049582 Bacteria 3272
504 Ga0501048_0378246 3300049582 Bacteria 1011
505 Ga0501070_0381594 3300049586 Bacteria 1142
506 Ga0501071_0088276 3300049587 Bacteria 2275
507 Ga0501072_0020821 3300049588 Bacteria 5083
508 Ga0501072_0022047 3300049588 Bacteria 4942
509 Ga0501073_0020264 3300049589 Bacteria 4798
510 Ga0501073_0147399 3300049589 Bacteria 1631
511 Ga0501074_0011368 3300049590 Bacteria 6471
512 Ga0501075_0388488 3300049591 Bacteria 1064
513 Ga0501076_0012216 3300049592 Bacteria 6421
514 Ga0501077_0030268 3300049593 Unclassified 3445
515 Ga0501077_0207181 3300049593 Bacteria 1246
516 Ga0501079_0044621 3300049741 Unclassified 3421
517 Ga0501080_0025027 3300049742 Bacteria 5537
518 Ga0501080_0063361 3300049742 Bacteria 3441
519 Ga0501081_0019257 3300049743 Bacteria 4543
520 Ga0501081_0271647 3300049743 Unclassified 1240
521 Ga0501083_0022717 3300049744 Bacteria 4352
522 Ga0501044_0006835 3300049823 Bacteria 12570
523 Ga0501045_0013951 3300049824 Bacteria 5687
524 Ga0501045_0295606 3300049824 Unclassified 1205
525 nmdc:mga00v17_79546_c1 3300050491 Bacteria 1383
526 nmdc:mga05p37_13758_c1 3300050507 Bacteria 9694
527 nmdc:mga05p37_1524_c1 3300050507 Bacteria 26970
528 nmdc:mga05p37_178182_c1 3300050507 Bacteria 2588
529 nmdc:mga05p37_185615_c1 3300050507 Bacteria 2528
530 nmdc:mga05p37_20249_c1 3300050507 Bacteria 8052
531 nmdc:mga05p37_2539_c1 3300050507 Bacteria 21212
532 nmdc:mga05p37_369_c1 3300050507 Bacteria 20439
533 nmdc:mga05p37_6291_c1 3300050507 Bacteria 13969
534 nmdc:mga09592_133749_c1 3300050508 Bacteria 2135
535 nmdc:mga09592_226363_c1 3300050508 Unclassified 1620
536 nmdc:mga06r32_277575_c1 3300050510 Bacteria 1663
537 nmdc:mga06r32_34981_c1 3300050510 Bacteria 4739
538 nmdc:mga08y16_20830_c1 3300050511 Bacteria 6922
539 nmdc:mga08y16_35809_c1 3300050511 Bacteria 5213
540 nmdc:mga08y16_56108_c1 3300050511 Bacteria 4117
541 nmdc:mga08y16_57011_c1 3300050511 Bacteria 4083
542 nmdc:mga08y16_59741_c1 3300050511 Bacteria 3982
543 nmdc:mga0n895_11161_c1 3300050512 Bacteria 7996
544 nmdc:mga0n895_1216_c1 3300050512 Bacteria 19015
545 nmdc:mga0n895_383159_c1 3300050512 Bacteria 1423
546 nmdc:mga0n895_38942_c1 3300050512 Bacteria 4609
547 nmdc:mga0n895_472922_c1 3300050512 Unclassified 1264
548 nmdc:mga0n895_511617_c1 3300050512 Unclassified 1209
549 nmdc:mga0n895_96929_c1 3300050512 Bacteria 2954
550 nmdc:mga0rr50_120186_c1 3300050513 Unclassified 2090
551 nmdc:mga0rr50_236636_c1 3300050513 Bacteria 1513
552 nmdc:mga0rr50_28131_c1 3300050513 Bacteria 3948
553 nmdc:mga0rr50_285785_c1 3300050513 Unclassified 1377
554 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
555 nmdc:mga0rr50_961_c1 3300050513 Bacteria 15633
556 nmdc:mga08x19_133_c1 3300050514 Bacteria 66107
557 nmdc:mga08x19_17397_c1 3300050514 Bacteria 4398
558 nmdc:mga08x19_296010_c1 3300050514 Bacteria 1123
559 nmdc:mga08x19_320534_c1 3300050514 Bacteria 1079
560 nmdc:mga08x19_5321_c1 3300050514 Bacteria 7604
561 nmdc:mga08x19_93480_c1 3300050514 Bacteria 1987
562 nmdc:mga0a205_168250_c1 3300050515 Bacteria 2087
563 nmdc:mga0a205_17634_c1 3300050515 Bacteria 6700
564 nmdc:mga0a205_30126_c1 3300050515 Bacteria 5194
565 nmdc:mga0a205_52768_c1 3300050515 Bacteria 3924
566 nmdc:mga0a205_72315_c1 3300050515 Bacteria 3331
567 nmdc:mga0a205_75186_c1 3300050515 Bacteria 3264
568 nmdc:mga0a205_96337_c1 3300050515 Bacteria 2858
569 Ga0495601_0396016 3300053077 Unclassified 896
570 Ga0495595_0203098 3300053084 Bacteria 987
571 Ga0495619_0012277 3300053085 Bacteria 5390
572 Ga0495619_0057748 3300053085 Bacteria 2575
573 Ga0495619_0322813 3300053085 Bacteria 1069
574 Ga0501084_0002167 3300054114 Bacteria 15728
575 Ga0501084_0057709 3300054114 Unclassified 3248
576 Ga0207685_10135157
577 MRS1b_contig_7651396
578 Ga0065712_10068874
579 Ga0065712_10238736
580 Ga0065715_10116053
581 Ga0065715_10167994
582 Ga0065707_10089218
583 Ga0070658_10032010
584 Ga0070658_10569954
585 Ga0070676_10056797
586 Ga0070676_10076543
587 Ga0070683_100002741
588 Ga0070690_100051938
589 Ga0070690_100172906
590 Ga0070670_100025795
591 Ga0070670_100133928
592 Ga0070670_100207825
593 Ga0070677_10145889
594 Ga0068869_100097033
595 Ga0068869_100216276
596 Ga0070666_10047357
597 Ga0070666_10064976
598 Ga0070680_100096019
599 Ga0068868_100026034
600 Ga0068868_100105685
601 Ga0068868_100117448
602 Ga0070660_100012967
603 Ga0070660_100055386
604 Ga0070689_100158250
605 Ga0070691_10000430
606 Ga0070687_100072485
607 Ga0070687_100080259
608 Ga0070661_100016198
609 Ga0070661_100086643
610 Ga0070661_100259111
611 Ga0070668_100050645
612 Ga0070668_100081220
613 Ga0070669_100001159
614 Ga0070669_100017176
615 Ga0070669_100089300
616 Ga0070669_100164650
617 Ga0070669_100203850
618 Ga0070675_100000124
619 Ga0070675_100030819
620 Ga0070671_100038886
621 Ga0070674_100007706
622 Ga0070674_100034728
623 Ga0070674_100256070
624 Ga0070674_100427014
625 Ga0070673_100074196
626 Ga0070673_100101750
627 Ga0070673_100268683
628 Ga0070673_100400794
629 Ga0070659_100044358
630 Ga0070659_100108743
631 Ga0070667_100020047
632 Ga0070667_100170343
633 Ga0070714_100185827
634 Ga0070713_100013721
635 Ga0070701_10005342
636 Ga0070701_10165618
637 Ga0070705_100025745
638 Ga0070705_100070303
639 Ga0070705_100240135
640 Ga0070700_100003743
641 Ga0070700_100082760
642 Ga0070694_100013123
643 Ga0070694_100043189
644 Ga0070708_100826278
645 Ga0070663_100167446
646 Ga0070678_100022200
647 Ga0070678_100146133
648 Ga0070678_100472286
649 Ga0070662_100111666
650 Ga0070662_100196868
651 Ga0070662_100473273
652 Ga0070681_10071016
653 Ga0070681_10327668
654 Ga0068867_100311148
655 Ga0070706_100198705
656 Ga0070707_100050472
657 Ga0070707_100059881
658 Ga0070707_100192076
659 Ga0070698_100418744
660 Ga0070699_100002365
661 Ga0070699_100041128
662 Ga0070699_100454903
663 Ga0070684_100000084
664 Ga0070697_100028737
665 Ga0068853_100280838
666 Ga0070672_100012845
667 Ga0070672_100218747
668 Ga0070686_100000823
669 Ga0070686_100042846
670 Ga0070686_100095884
671 Ga0070686_100126175
672 Ga0070695_100080773
673 Ga0070696_100005285
674 Ga0070696_100009986
675 Ga0070696_100147238
676 Ga0070665_100004836
677 Ga0070665_100005573
678 Ga0070665_100012698
679 Ga0070665_100016931
680 Ga0070665_100087564
681 Ga0070704_100037363
682 Ga0070704_100112574
683 Ga0070704_100265111
684 Ga0070704_100285723
685 Ga0068855_100020352
686 Ga0070664_100000177
687 Ga0070664_100043878
688 Ga0070664_100323769
689 Ga0068857_100240031
690 Ga0068857_100652342
691 Ga0068854_100059245
692 Ga0068854_100059891
693 Ga0068856_100089237
694 Ga0070702_100005051
695 Ga0068852_100102678
696 Ga0068859_100059664
697 Ga0068859_100166961
698 Ga0068864_100008489
699 Ga0068864_100093435
700 Ga0068864_100271076
701 Ga0068866_10281849
702 Ga0068861_100013691
703 Ga0068861_100087783
704 Ga0068861_100167777
705 Ga0068861_100187732
706 Ga0068851_10135952
707 Ga0068863_100000208
708 Ga0068863_100076615
709 Ga0068858_100001993
710 Ga0068858_100055097
711 Ga0068858_100104069
712 Ga0068858_100313623
713 Ga0068858_100328469
714 Ga0068860_100050584
715 Ga0068860_100234717
716 Ga0068860_100326378
717 Ga0068860_100358536
718 Ga0068862_100013096
719 Ga0068862_100081176
720 Ga0068862_100090736
721 Ga0068862_100653661
722 Ga0081539_10025254
723 Ga0070715_10045324
724 Ga0097621_100016376
725 Ga0097621_100016993
726 Ga0097621_100034149
727 Ga0097621_100035677
728 Ga0097621_100095148
729 Ga0097621_100384598
730 Ga0097621_100484732
731 Ga0097621_100518228
732 Ga0068871_100022739
733 Ga0068871_100132801
734 Ga0075428_100091131
735 Ga0075428_100222150
736 Ga0075428_100288065
737 Ga0075430_100139900
738 Ga0075430_100227818
739 Ga0075430_100376315
740 Ga0075431_100197616
741 Ga0075433_10016896
742 Ga0075433_10048177
743 Ga0075433_10597996
744 Ga0075434_100001642
745 Ga0075434_100002076
746 Ga0075434_100002153
747 Ga0075434_100002944
748 Ga0075434_100067952
749 Ga0075434_100247769
750 Ga0075434_100495827
751 Ga0075429_100322859
752 Ga0068865_100008845
753 Ga0068865_100046452
754 Ga0068865_100154057
755 Ga0068865_100444924
756 Ga0075436_100004558
757 Ga0075436_100007050
758 Ga0075436_100198773
759 Ga0097620_100059663
760 Ga0097620_100166963
761 Ga0075435_100000008
762 Ga0075435_100001847
763 Ga0075435_100005198
764 Ga0075435_100032205
765 Ga0075435_100086428
766 Ga0075435_100111621
767 Ga0075435_100239206
768 Ga0075435_100615090
769 Ga0105240_10365682
770 Ga0111539_10000073
771 Ga0111539_10003812
772 Ga0111539_10022119
773 Ga0111539_10032658
774 Ga0111539_10034345
775 Ga0105245_10006578
776 Ga0105245_10019988
777 Ga0105247_10017898
778 Ga0105247_10024790
779 Ga0105247_10191046
780 Ga0114129_10000186
781 Ga0114129_10000233
782 Ga0114129_10002876
783 Ga0114129_10003773
784 Ga0114129_10020889
785 Ga0114129_10037879
786 Ga0114129_10179197
787 Ga0114129_10372368
788 Ga0114129_10622278
789 Ga0105243_10108532
790 Ga0105243_10247524
791 Ga0105243_10347912
792 Ga0105243_10539054
793 Ga0105243_10845821
794 Ga0105241_10486819
795 Ga0105242_10009432
796 Ga0105242_10062391
797 Ga0105242_10082476
798 Ga0105242_10147679
799 Ga0105242_10240169
800 Ga0105242_10268085
801 Ga0105242_10811086
802 Ga0105248_10034728
803 Ga0105248_10045382
804 Ga0105248_10047072
805 Ga0105248_10049751
806 Ga0105248_10073106
807 Ga0105248_10114481
808 Ga0105248_10138935
809 Ga0105248_10161167
810 Ga0105248_10164034
811 Ga0105248_10175000
812 Ga0105248_10464007
813 Ga0105248_10844968
814 Ga0105248_11277979
815 Ga0105237_10751022
816 Ga0105238_10734074
817 Ga0105249_10090583
818 Ga0105249_10091588
819 Ga0105249_10152791
820 Ga0105249_10244843
821 Ga0105249_10626591
822 Ga0105249_10709216
823 Ga0157374_10025835
824 Ga0157374_10560917
825 Ga0163162_10032215
826 Ga0157372_10233277
827 Ga0157375_10449444
828 Ga0157375_11256626
829 Ga0163163_10019533
830 Ga0163163_10051381
831 Ga0163163_10074981
832 Ga0163163_10771490
833 Ga0157380_10104324
834 Ga0157380_10118912
835 Ga0157380_10215718
836 Ga0157380_10533128
837 Ga0157377_10168824
838 Ga0157379_10009599
839 Ga0157379_10043790
840 Ga0157379_10634523
841 Ga0157376_10007968
842 Ga0157376_10022370
843 Ga0157376_10031444
844 Ga0157376_10074348
845 Ga0157376_10224682
846 Ga0163161_10079408
847 Ga0207697_10001244
848 Ga0207697_10042405
849 Ga0207656_10146401
850 Ga0207682_10077830
851 Ga0207642_10076886
852 Ga0207710_10028800
853 Ga0207680_10369953
854 Ga0207645_10003548
855 Ga0207645_10052332
856 Ga0207645_10278162
857 Ga0207705_10094554
858 Ga0207707_10272534
859 Ga0207695_10529192
860 Ga0207663_10071739
861 Ga0207660_10144707
862 Ga0207662_10022851
863 Ga0207657_10008607
864 Ga0207657_10087704
865 Ga0207649_10001143
866 Ga0207649_10063347
867 Ga0207646_10024766
868 Ga0207646_10455389
869 Ga0207646_10489111
870 Ga0207681_10009893
871 Ga0207681_10018867
872 Ga0207681_10057818
873 Ga0207681_10069988
874 Ga0207681_10141269
875 Ga0207694_10578594
876 Ga0207694_10639992
877 Ga0207650_10107616
878 Ga0207650_10108124
879 Ga0207650_10129819
880 Ga0207650_10286314
881 Ga0207659_10000371
882 Ga0207659_10219263
883 Ga0207659_10325836
884 Ga0207659_10571260
885 Ga0207687_10003791
886 Ga0207687_10014349
887 Ga0207687_10134951
888 Ga0207687_10244741
889 Ga0207700_10183315
890 Ga0207664_10142618
891 Ga0207644_10107557
892 Ga0207644_10340404
893 Ga0207690_10169980
894 Ga0207706_10038280
895 Ga0207706_10070048
896 Ga0207706_10077972
897 Ga0207706_10133192
898 Ga0207686_10006660
899 Ga0207686_10051174
900 Ga0207686_10167803
901 Ga0207709_10020389
902 Ga0207669_10076604
903 Ga0207669_10093753
904 Ga0207669_10124163
905 Ga0207704_10046524
906 Ga0207704_10072232
907 Ga0207704_10129732
908 Ga0207704_10193484
909 Ga0207665_10074687
910 Ga0207691_10019212
911 Ga0207691_10231376
912 Ga0207691_10301196
913 Ga0207711_10030479
914 Ga0207711_10035917
915 Ga0207711_10114180
916 Ga0207711_10128160
917 Ga0207711_10142390
918 Ga0207711_10182759
919 Ga0207711_10201574
920 Ga0207711_10244530
921 Ga0207689_10055363
922 Ga0207689_10082831
923 Ga0207689_10316864
924 Ga0207661_10000827
925 Ga0207679_10041434
926 Ga0207679_10201418
927 Ga0207667_10272998
928 Ga0207651_10048922
929 Ga0207651_10064084
930 Ga0207712_10051313
931 Ga0207712_10107013
932 Ga0207712_10181288
933 Ga0207668_10320047
934 Ga0207668_10654977
935 Ga0207640_10108447
936 Ga0207658_10027926
937 Ga0207658_10586719
938 Ga0207677_10147659
939 Ga0207677_10154834
940 Ga0207703_10023091
941 Ga0207703_10051766
942 Ga0207703_10111073
943 Ga0207703_10252244
944 Ga0207703_10264705
945 Ga0207639_10312085
946 Ga0207678_10198689
947 Ga0207708_10002324
948 Ga0207708_10103265
949 Ga0207708_10247304
950 Ga0207702_10162460
951 Ga0207641_10002288
952 Ga0207641_10721922
953 Ga0207648_10195635
954 Ga0207648_10237260
955 Ga0207648_10343096
956 Ga0207676_10013168
957 Ga0207676_10223022
958 Ga0207674_10382080
959 Ga0207675_100009696
960 Ga0207675_100083802
961 Ga0207675_100229924
962 Ga0207675_100253366
963 Ga0207675_100301360
964 Ga0207683_10013915
965 Ga0207683_10027316
966 Ga0207683_10393635
967 Ga0207428_10012394
968 Ga0207428_10049001
969 Ga0207428_10084815
970 Ga0268266_10004330
971 Ga0268266_10024165
972 Ga0268266_10033316
973 Ga0268265_10041096
974 Ga0268265_10049509
975 Ga0268265_10240765
976 Ga0268265_10426733
977 Ga0268264_10037757
978 Ga0268264_10225240
979 Ga0268264_10446178
980 Ga0268264_10470548
981 Ga0307408_100090437
982 Ga0307406_10273659
983 Ga0373930_0000223
984 Ga0373958_0015328
985 Ga0373959_0001651
986 Ga0373938_0002033
987 Ga0373928_0001102
988 Ga0373929_0001720
989 Ga0373951_0067887
990 Ga0373932_0043561
991 Ga0373939_0026405
992 Ga0373941_0002830
993 Ga0373941_0068798
994 Ga0373960_0001201
995 Ga0373943_0212505
996 Ga0373955_0085025
997 Ga0373955_0101305
998 Ga0373942_0009098
999 Ga0373961_0002904
1000 Ga0373931_0026730
1001 Ga0373931_0095085
1002 Ga0373931_0164702
1003 Ga0373935_0191248
1004 Ga0373937_0015382
1005 Ga0373937_0127387
1006 Ga0439441_025940
1007 Ga0439435_0008841
1008 Ga0439435_0016314
1009 Ga0439440_0032012
1010 Ga0453683_0308002
1011 Ga0466963_0013267
1012 Ga0451576_0077686
1013 Ga0451576_0100725
1014 Ga0451576_0549469
1015 Ga0466967_1021948
1016 Ga0495603_0065004
1017 Ga0495629_0117656
1018 Ga0495651_0206903
1019 Ga0495653_0296094
1020 Ga0495639_0057180
1021 Ga0495628_0567700
1022 Ga0495630_0666167
1023 Ga0495640_0175290
1024 Ga0495640_0281450
1025 Ga0495598_0152480
1026 Ga0495634_0065066
1027 Ga0495657_0114839
1028 Ga0495658_0027260
1029 Ga0495658_0164960
1030 Ga0495658_0253592
1031 Ga0495581_0154748
1032 Ga0495604_0115850
1033 Ga0495674_0082578
1034 Ga0495674_0175572
1035 Ga0495680_0428149
1036 Ga0495684_0208838
1037 Ga0496100_0090721
1038 Ga0496102_0149663
1039 Ga0496102_0217701
1040 Ga0496104_0006152
1041 Ga0496104_0020060
1042 Ga0496104_0200668
1043 Ga0496104_0332211
1044 Ga0496104_0407905
1045 Ga0496105_0024462
1046 Ga0496105_0081507
1047 Ga0496105_0391384
1048 Ga0496106_0184439
1049 Ga0496107_0065751
1050 Ga0496107_0273602
1051 Ga0496108_0034860
1052 Ga0496108_0528680
1053 Ga0496108_0645310
1054 Ga0496109_0000257
1055 Ga0496109_0024044
1056 Ga0496110_0029509
1057 Ga0496110_0075158
1058 Ga0496111_0031165
1059 Ga0496111_0220859
1060 Ga0496112_0000571
1061 Ga0496112_0006387
1062 Ga0496112_0100331
1063 Ga0496112_0317425
1064 Ga0496113_0074751
1065 Ga0496114_0003091
1066 Ga0496114_0052673
1067 Ga0496115_0085019
1068 Ga0501031_0098728
1069 Ga0501033_0002679
1070 Ga0501034_0008525
1071 Ga0501040_0165869
1072 Ga0501042_0028221
1073 Ga0501042_0196588
1074 Ga0501046_0057065
1075 Ga0501047_0000522
1076 Ga0501047_0006485
1077 Ga0501047_0270977
1078 Ga0501048_0042073
1079 Ga0501048_0378246
1080 Ga0501070_0381594
1081 Ga0501071_0088276
1082 Ga0501072_0020821
1083 Ga0501072_0022047
1084 Ga0501073_0020264
1085 Ga0501073_0147399
1086 Ga0501074_0011368
1087 Ga0501075_0388488
1088 Ga0501076_0012216
1089 Ga0501077_0030268
1090 Ga0501077_0207181
1091 Ga0501079_0044621
1092 Ga0501080_0025027
1093 Ga0501080_0063361
1094 Ga0501081_0019257
1095 Ga0501081_0271647
1096 Ga0501083_0022717
1097 Ga0501044_0006835
1098 Ga0501045_0013951
1099 Ga0501045_0295606
1100 nmdc:mga00v17_79546_c1
1101 nmdc:mga05p37_13758_c1
1102 nmdc:mga05p37_1524_c1
1103 nmdc:mga05p37_178182_c1
1104 nmdc:mga05p37_185615_c1
1105 nmdc:mga05p37_20249_c1
1106 nmdc:mga05p37_2539_c1
1107 nmdc:mga05p37_369_c1
1108 nmdc:mga05p37_6291_c1
1109 nmdc:mga09592_133749_c1
1110 nmdc:mga09592_226363_c1
1111 nmdc:mga06r32_277575_c1
1112 nmdc:mga06r32_34981_c1
1113 nmdc:mga08y16_20830_c1
1114 nmdc:mga08y16_35809_c1
1115 nmdc:mga08y16_56108_c1
1116 nmdc:mga08y16_57011_c1
1117 nmdc:mga08y16_59741_c1
1118 nmdc:mga0n895_11161_c1
1119 nmdc:mga0n895_1216_c1
1120 nmdc:mga0n895_383159_c1
1121 nmdc:mga0n895_38942_c1
1122 nmdc:mga0n895_472922_c1
1123 nmdc:mga0n895_511617_c1
1124 nmdc:mga0n895_96929_c1
1125 nmdc:mga0rr50_120186_c1
1126 nmdc:mga0rr50_236636_c1
1127 nmdc:mga0rr50_28131_c1
1128 nmdc:mga0rr50_285785_c1
1129 nmdc:mga0rr50_3_c1
1130 nmdc:mga0rr50_961_c1
1131 nmdc:mga08x19_133_c1
1132 nmdc:mga08x19_17397_c1
1133 nmdc:mga08x19_296010_c1
1134 nmdc:mga08x19_320534_c1
1135 nmdc:mga08x19_5321_c1
1136 nmdc:mga08x19_93480_c1
1137 nmdc:mga0a205_168250_c1
1138 nmdc:mga0a205_17634_c1
1139 nmdc:mga0a205_30126_c1
1140 nmdc:mga0a205_52768_c1
1141 nmdc:mga0a205_72315_c1
1142 nmdc:mga0a205_75186_c1
1143 nmdc:mga0a205_96337_c1
1144 Ga0495601_0396016
1145 Ga0495595_0203098
1146 Ga0495619_0012277
1147 Ga0495619_0057748
1148 Ga0495619_0322813
1149 Ga0501084_0002167
1150 Ga0501084_0057709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

108

203

0.98

PF13649

Methyltransf_25

Methyltransferase domain

107

198

0.96

PF13847

Methyltransf_31

Methyltransferase domain

101

240

0.91

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

89

214

0.9

PF08242

Methyltransf_12

Methyltransferase domain

108

201

0.87

PF07021

MetW

Methionine biosynthesis protein MetW

88

237

0.81

PF13489

Methyltransf_23

Methyltransferase domain

82

246

0.77

PF05175

MTS

Methyltransferase small domain

91

174

0.77

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

90

204

0.76

PF05724

TPMT

Thiopurine S-methyltransferase (TPMT)

77

225

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ftp-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.8245 60 118
6zxw-assembly1.cif.gz_G structure of archaeoglobus fulgidus trm11-trm112 m2g10 trna methyltransferase complex bound to sinefungin 0.8072 59 257
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.8021 59 257
2nxn-assembly1.cif.gz_A t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 0.7998 46 257
4bo6-assembly1.cif.gz_D crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2,3-dihydroindol-1-yl-(2- thiophen-3-yl-1,3-thiazol-4-yl)methanone at 2.8a resolution 0.7997 60 118
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.933 59 117 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9316 57 115 3.40.50.150
af_A4HXF2_86_160_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9209 60 106 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.901 60 164 3.40.50.150
af_P9WJZ1_37_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8633 38 202 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7K1AFZ5-F1-model_v4 Methyltransferase domain-containing protein 0.9748 59 129 GO:0001510
GO:0003723
GO:0006355
GO:0008173
AF-A0A3A0A6D1-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9653 9 257 GO:0008757
AF-A0A3A0A6D1-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9323 9 257 GO:0008757
AF-A0A822AU19-F1-model_v4 Methyltransferase type 12 domain-containing protein 0.9044 1 176 GO:0008168
AF-A0A6J4NC81-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.8862 3 186 GO:0008168
GO:0032259

Map