F465322

General Info

Members Datasets Scaffolds Average Seq Length
574 445 201 747

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000569|Ga0395905_0000569_19939_22416
Length 825
Sequence MSCCAPGAESGADEGRTLPSSEELWLASKPLGDGRRQTDLSVPDVHCGACIATIEDALNKLPEVERARVNLSTRRVSIVWHDTLEGMKTDPVRLAEAIAATGYSLNLFQDVDTGSDRLRNDYLRAVAIAGFAAANIMLLSVSVWSGADAATRDLFHWISAMIAAPVLIYAGRFFYRSAWNALKHGHTNMDVPISLAVTLSYAMSLWETIHHGEHAWFDATVSLLFFLLIGRTLDHLMRDRARAAVVGLARLSPRGATVIASDGSGDYRPVEDIRPGDRLAIAAGERIPVDSRVLSGTSDIDWSIVNGESAPQPAATGARLLAGTLNLTGGLTVEATAEAKNSFLAEIITLMEAAEGGKARYRRIADRAARLYSPAVHLLALISLLGWGILGGDWKQAVLVAISVLIITCPCALGLAVPVVQVIAAGRLYRSGIMVKDGSAMERLAEATMVLFDKTGTLTMGRPQLVNAGEIDPHTLAIAAGLAEHSRHPLSRAIAAAAQVRAQFQEVREIPGAGLVAKDDEGVWRLGSRVSAGVIACDAPPSALPGISPSRGEXXXRAVSPKSSAESPARNSSLRQEAGPMPLSPLVGEMPGRAEGGNTSANPAVPDHSDHSESVLSLNGTPIATFRFEDRLRPHAIETIRTLSREKLSPGILSGDREPVVAAIGRRLGIASWTSGLDPQGKVSAVEQAAANGARVLMVGDGINDAPALRSAHVSIAPSTAADIGKQAADFVFMRDGLDAVWEAIDISRRAGHLIRENFALAIAYNIVAVPVAIAGYATPLVAAIAMSTSSIIVVVNSLRLNLDRGEKVLGTAADISPNVEVLSV

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
17 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
18 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
19 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
20 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
21 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
22 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
23 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
24 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
25 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
26 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
27 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
28 2516143018 Ensifer sp. BR816 Isolate Nodule
29 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
30 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
31 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
32 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
33 2519899620 Rhizobium sp. Pop5 Isolate Nodule
34 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
35 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
36 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
37 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
38 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
39 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
40 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
41 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
42 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
43 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
44 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
45 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
46 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
47 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
48 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
49 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
50 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
51 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
52 2643221568 Rhizobium sp. Root564 Isolate Unclassified
53 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
54 2643221688 Rhizobium sp. Root482 Isolate Unclassified
55 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
56 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
57 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
58 2718217882 Rhizobium sp. N741 Isolate Nodule
59 2718217927 Rhizobium sp. N324 Isolate Nodule
60 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
61 2718218009 Rhizobium sp. N561 Isolate Nodule
62 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
63 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
64 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
65 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
66 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
67 2718218363 Rhizobium sp. N113 Isolate Nodule
68 2718218365 Rhizobium sp. N731 Isolate Nodule
69 2718218366 Rhizobium sp. N621 Isolate Nodule
70 2721755514 Rhizobium sp. N6212 Isolate Nodule
71 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
72 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
73 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
74 2721755810 Rhizobium sp. N871 Isolate Nodule
75 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
76 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
77 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
78 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
79 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
80 2728369365 Rhizobium sp. N1341 Isolate Nodule
81 2728369397 Rhizobium sp. N1314 Isolate Nodule
82 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
83 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
84 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
85 2791355256 Rhizobium sp. M10 Isolate Nodule
86 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
87 2791355260 Rhizobium sp. L9 Isolate Nodule
88 2791355261 Rhizobium sp. J15 Isolate Nodule
89 2791355262 Rhizobium sp. M1 Isolate Nodule
90 2791355263 Rhizobium chutanense C5 Isolate Nodule
91 2791355264 Rhizobium sp. S9 Isolate Nodule
92 2791355265 Rhizobium sp. H4 Isolate Nodule
93 2791355266 Rhizobium sp. L43 Isolate Nodule
94 2791355267 Rhizobium sp. L18 Isolate Nodule
95 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
96 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
97 2802429633 Rhizobium anhuiense J3 Isolate Nodule
98 2802429634 Rhizobium anhuiense S10 Isolate Nodule
99 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
100 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
101 2802429637 Rhizobium anhuiense C15 Isolate Nodule
102 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
103 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
104 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
105 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
106 2838061910 Rhizobium phaseoli L15 Isolate Nodule
107 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
108 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
109 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
110 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
111 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
112 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
113 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
114 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
115 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
116 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
117 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
118 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
119 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
120 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
121 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
122 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
123 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
124 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
125 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
126 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
127 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
128 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
129 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
130 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
131 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
132 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
133 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
134 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
135 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
136 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
137 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
138 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
139 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
140 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
141 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
142 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
143 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
144 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
145 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
146 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
147 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
148 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
149 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
150 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
151 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
152 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
153 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
154 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
155 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
156 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
157 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
158 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
159 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
160 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
161 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
162 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
163 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
164 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
165 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
166 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
167 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
168 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
169 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
170 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
171 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
172 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
173 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
174 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
175 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
176 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
177 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
178 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
179 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
180 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
181 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
182 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
183 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
184 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
185 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
186 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
187 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
188 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
189 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
190 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
191 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
192 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
193 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
194 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
195 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
196 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
197 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
198 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
199 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
200 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
201 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
202 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
203 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
204 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
205 2936381700 Rhizobium chutanense C16 Isolate Unclassified
206 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
207 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
208 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
209 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
210 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
211 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
212 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
213 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
214 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
215 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
216 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
217 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
218 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
219 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
220 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
221 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
222 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
223 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
224 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
225 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
226 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
227 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
228 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
229 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
230 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
231 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
232 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
233 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
234 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
235 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
236 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
237 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
238 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
239 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
240 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
241 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
242 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
243 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
244 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
245 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
246 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
247 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
248 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
249 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
250 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
251 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
252 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
253 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
254 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
255 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
256 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
257 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
258 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
259 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
260 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
261 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
262 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
263 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
264 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
265 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
266 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
267 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
268 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
269 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
270 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
271 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
272 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
273 2996893221 Rhizobium sp. R635 Isolate Nodule
274 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
275 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
276 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
277 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
278 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
279 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
280 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
281 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
282 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
283 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
284 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
285 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
286 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
287 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
288 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
289 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
290 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
291 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
292 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
293 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
294 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
295 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
296 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
297 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
298 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
299 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
300 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
301 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
302 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
303 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
304 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
305 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
306 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
307 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
308 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
309 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
310 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
311 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
312 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
313 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
314 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
315 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
316 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
317 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
318 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
319 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
320 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
321 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
322 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
323 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
324 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
325 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
326 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
327 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
328 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
329 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
330 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
331 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
332 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
333 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
335 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
336 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
337 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
339 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
340 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
342 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
343 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
344 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
347 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
350 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
352 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
353 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
354 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
355 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
356 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
357 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
358 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
359 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
360 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
361 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
362 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
363 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
364 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
365 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
366 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
367 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
368 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
369 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
372 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
373 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
374 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
375 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
376 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
394 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
395 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
400 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
407 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
408 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
409 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
410 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
411 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
412 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
413 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
414 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
415 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
416 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
417 8005275841 Rhizobium sp. N4311 Isolate Nodule
418 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
419 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
420 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
421 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
422 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
423 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
424 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
425 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
426 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
427 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
428 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
429 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
430 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
431 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
432 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
433 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
434 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
435 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
436 8018176218 Rhizobium sp. N122 Isolate Nodule
437 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
438 8024501048 Rhizobium sp. H4 Isolate Nodule
439 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
440 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
441 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
442 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
443 8056382006 Rhizobium croatiense 13T Isolate Nodule
444 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
445 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 35.02
Metatranscriptomes 0
Isolates 64.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 17.25
Nodule 56.1
Rhizoplane 0.87
Rhizosphere 11.5
Stem 0
Stem Tuber 0
Unclassified 14.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000026 3300002704 Bacteria 127779
2 JGI25156J39149_1000028 3300002705 Bacteria 127325
3 JGI25154J39366_1000046 3300002738 Bacteria 127252
4 JGI25158J39367_1000430 3300002739 Bacteria 8688
5 JGI25157J39369_1000067 3300002741 Bacteria 95529
6 JGI25152J39213_1001646 3300002773 Bacteria 9311
7 JGI25152J39213_1001741 3300002773 Bacteria 8900
8 JGI25159J45721_1000020 3300002987 Bacteria 124791
9 JGI25159J45721_1000846 3300002987 Bacteria 13349
10 JGI25165J46597_1000006 3300003214 Bacteria 529784
11 JGI25153J46596_10003144 3300003215 Bacteria 9311
12 JGI25160J50197_1000055 3300003354 Bacteria 124791
13 JGI25160J50197_1003872 3300003354 Bacteria 6568
14 JGI25161J50226_1000084 3300003374 Bacteria 76415
15 JGI25161J50226_1000374 3300003374 Bacteria 22499
16 Ga0055526_1000508 3300003771 Bacteria 30971
17 Ga0055526_1002807 3300003771 Bacteria 11532
18 Ga0055524_1006414 3300003775 Bacteria 5102
19 Ga0055528_1000133 3300003790 Bacteria 60151
20 Ga0055528_1004317 3300003790 Bacteria 6868
21 Ga0055540_1001170 3300003792 Bacteria 16272
22 Ga0055540_1002919 3300003792 Bacteria 8639
23 Ga0055531_10004284 3300003794 Bacteria 8760
24 Ga0058692_1000350 3300003856 Bacteria 22460
25 Ga0058692_1002210 3300003856 Bacteria 6633
26 Ga0055543_1000017 3300004625 Bacteria 170255
27 Ga0055543_1000240 3300004625 Bacteria 42475
28 Ga0055543_1002012 3300004625 Bacteria 7196
29 Ga0065165_1001002 3300005262 Bacteria 34597
30 Ga0065165_1004951 3300005262 Bacteria 7838
31 Ga0065165_1005299 3300005262 Bacteria 7343
32 Ga0065165_1007968 3300005262 Bacteria 5071
33 Ga0070665_100013731 3300005548 Bacteria 8152
34 Ga0075365_10001173 3300006038 Bacteria 11506
35 Ga0075365_10009000 3300006038 Bacteria 5709
36 Ga0075364_10001547 3300006051 Bacteria 12560
37 Ga0075367_10015106 3300006178 Bacteria 4190
38 Ga0075370_10013055 3300006353 Bacteria 4407
39 Ga0079104_1004877 3300006946 Bacteria 5555
40 Ga0099826_10000091 3300006948 Bacteria 44824
41 Ga0105251_10010622 3300009011 Bacteria 5323
42 Ga0105240_10057207 3300009093 Bacteria 4874
43 Ga0105237_10017817 3300009545 Bacteria 7363
44 Ga0105238_10027401 3300009551 Bacteria 5805
45 Ga0105238_10039291 3300009551 Bacteria 4798
46 Ga0123341_1000231 3300009765 Bacteria 29572
47 Ga0105239_10021138 3300010375 Bacteria 7178
48 Ga0157373_10019436 3300013100 Bacteria 4943
49 Ga0157371_10000015 3300013102 Bacteria 339838
50 Ga0157371_10005633 3300013102 Bacteria 10518
51 Ga0157370_10000402 3300013104 Bacteria 54601
52 Ga0157369_10013384 3300013105 Bacteria 9278
53 Ga0171463_1003 3300013249 Bacteria 695693
54 Ga0182008_10004137 3300014497 Bacteria 8545
55 Ga0183363_1047 3300015690 Bacteria 39413
56 Ga0214544_1000017 3300021320 Bacteria 193638
57 Ga0214542_1000006 3300021321 Bacteria 345164
58 Ga0214543_1000005 3300021327 Bacteria 454523
59 Ga0214543_1000014 3300021327 Bacteria 324986
60 Ga0228710_1000707 3300022740 Bacteria 45192
61 Ga0209435_100017 3300025206 Bacteria 303699
62 Ga0209436_100012 3300025208 Bacteria 136927
63 Ga0207425_1001408 3300025245 Bacteria 10110
64 Ga0209646_1000048 3300025246 Bacteria 303808
65 Ga0209026_1000035 3300025250 Bacteria 303808
66 Ga0209148_1001087 3300025254 Bacteria 16457
67 Ga0209759_1000027 3300025256 Bacteria 303808
68 Ga0209129_1000272 3300025258 Bacteria 50370
69 Ga0209129_1000815 3300025258 Bacteria 19637
70 Ga0209129_1000849 3300025258 Bacteria 19150
71 Ga0209233_1000010 3300025261 Bacteria 1194329
72 Ga0209455_1003054 3300025272 Bacteria 6119
73 Ga0209673_1000005 3300025273 Bacteria 692788
74 Ga0209673_1000550 3300025273 Bacteria 60329
75 Ga0209673_1000741 3300025273 Bacteria 44895
76 Ga0209673_1002314 3300025273 Bacteria 13508
77 Ga0209673_1006617 3300025273 Bacteria 5544
78 Ga0209130_1000022 3300025284 Bacteria 361244
79 Ga0209130_1000026 3300025284 Bacteria 334058
80 Ga0209676_1004782 3300025292 Bacteria 7374
81 Ga0209025_1000094 3300025294 Bacteria 241080
82 Ga0209025_1000119 3300025294 Bacteria 210606
83 Ga0209025_1000735 3300025294 Bacteria 55469
84 Ga0209025_1000767 3300025294 Bacteria 53337
85 Ga0209025_1002950 3300025294 Bacteria 16914
86 Ga0209025_1003939 3300025294 Bacteria 13336
87 Ga0209564_1000208 3300025295 Bacteria 134794
88 Ga0209564_1000215 3300025295 Bacteria 132838
89 Ga0209564_1000238 3300025295 Bacteria 120531
90 Ga0209758_1000291 3300025297 Bacteria 98850
91 Ga0209758_1000687 3300025297 Bacteria 50244
92 Ga0209758_1004002 3300025297 Bacteria 12749
93 Ga0209758_1004967 3300025297 Bacteria 10636
94 Ga0209758_1005887 3300025297 Bacteria 9144
95 Ga0209050_1002228 3300025298 Bacteria 17343
96 Ga0209256_1000042 3300025299 Bacteria 341821
97 Ga0209256_1000783 3300025299 Bacteria 41002
98 Ga0209256_1001519 3300025299 Bacteria 23406
99 Ga0209256_1002161 3300025299 Bacteria 16949
100 Ga0209256_1003045 3300025299 Bacteria 12354
101 Ga0209256_1005794 3300025299 Bacteria 6892
102 Ga0209256_1012524 3300025299 Bacteria 3232
103 Ga0207426_1000005 3300025302 Bacteria 1037188
104 Ga0207426_1000006 3300025302 Bacteria 1025969
105 Ga0207426_1000569 3300025302 Bacteria 49930
106 Ga0207426_1001114 3300025302 Bacteria 24662
107 Ga0207426_1009823 3300025302 Bacteria 3752
108 Ga0209051_1000176 3300025303 Bacteria 115875
109 Ga0209051_1000402 3300025303 Bacteria 60065
110 Ga0209051_1000615 3300025303 Bacteria 41084
111 Ga0209051_1000958 3300025303 Bacteria 28336
112 Ga0209051_1010112 3300025303 Bacteria 4800
113 Ga0209051_1019354 3300025303 Bacteria 2973
114 Ga0209257_1002285 3300025304 Bacteria 19498
115 Ga0209257_1012749 3300025304 Bacteria 3837
116 Ga0209281_1000272 3300027111 Bacteria 99700
117 Ga0209281_1002751 3300027111 Bacteria 6573
118 Ga0209371_1000021 3300027312 Bacteria 555864
119 Ga0209371_1000229 3300027312 Bacteria 71827
120 Ga0209282_1000055 3300027666 Bacteria 101018
121 Ga0209282_1001073 3300027666 Bacteria 14481
122 Ga0307515_10000448 3300028794 Bacteria 98768
123 Ga0268256_1000020 3300030500 Bacteria 557873
124 Ga0268256_1006211 3300030500 Bacteria 4490
125 Ga0265327_10009422 3300031251 Bacteria 7050
126 Ga0315914_1000695 3300031967 Bacteria 45194
127 Ga0315913_1000019 3300033430 Bacteria 100387
128 Ga0315915_1000023 3300033464 Bacteria 119157
129 Ga0373927_0000178 3300035695 Bacteria 50343
130 Ga0395905_0000569 3300037471 Bacteria 50013
131 Ga0395901_0004556 3300038443 Bacteria 13986
132 Ga0395901_0053643 3300038443 Bacteria 4189
133 Ga0395901_0073568 3300038443 Bacteria 3564
134 Ga0439436_0009191 3300041404 Bacteria 3032
135 Ga0439465_0004964 3300041413 Bacteria 4273
136 Ga0439465_0008138 3300041413 Bacteria 3311
137 Ga0451849_0834657 3300041505 Bacteria 2608
138 Ga0450906_006734 3300042145 Bacteria 2302
139 Ga0495638_0012420 3300046460 Bacteria 5839
140 Ga0495605_0000920 3300046474 Bacteria 20193
141 Ga0495585_0002348 3300046492 Bacteria 13595
142 Ga0495585_0013677 3300046492 Bacteria 4745
143 Ga0495585_0027758 3300046492 Bacteria 3230
144 Ga0495583_0005484 3300046506 Bacteria 8599
145 Ga0495668_0003214 3300046616 Bacteria 12475
146 Ga0495625_0000919 3300046660 Bacteria 39575
147 Ga0495670_0037017 3300046691 Bacteria 2432
148 Ga0495660_0058283 3300046810 Bacteria 2081
149 Ga0496104_0036529 3300048907 Bacteria 4593
150 Ga0496105_0002577 3300048908 Bacteria 13176
151 Ga0496106_0000474 3300048909 Bacteria 28635
152 Ga0496111_0018779 3300048914 Bacteria 4792
153 Ga0496116_0000043 3300048919 Bacteria 328085
154 Ga0496117_0000002 3300048920 Bacteria 2483758
155 Ga0496117_0003988 3300048920 Bacteria 16669
156 Ga0496118_0000355 3300048921 Bacteria 77500
157 Ga0496119_0003856 3300048922 Bacteria 15315
158 Ga0496119_0020442 3300048922 Bacteria 4832
159 Ga0496120_0000496 3300048923 Bacteria 61562
160 Ga0496120_0000941 3300048923 Bacteria 40051
161 Ga0496121_0002929 3300048924 Bacteria 24985
162 Ga0496121_0060769 3300048924 Bacteria 3106
163 Ga0496122_0000001 3300048925 Bacteria 1827766
164 Ga0496122_0000106 3300048925 Bacteria 193672
165 Ga0496122_0000525 3300048925 Bacteria 79294
166 Ga0496122_0010990 3300048925 Bacteria 9250
167 Ga0496123_0000001 3300048926 Bacteria 1831497
168 Ga0496123_0000022 3300048926 Bacteria 361832
169 Ga0496123_0000448 3300048926 Bacteria 73842
170 Ga0496123_0021831 3300048926 Bacteria 4960
171 Ga0496124_0001936 3300048927 Bacteria 28381
172 Ga0496124_0003536 3300048927 Bacteria 19010
173 Ga0496124_0013499 3300048927 Bacteria 7971
174 Ga0496125_0001127 3300048928 Bacteria 40785
175 Ga0496125_0051899 3300048928 Bacteria 3378
176 Ga0496125_0059046 3300048928 Bacteria 3094
177 Ga0496125_0099270 3300048928 Bacteria 2151
178 Ga0496126_0000362 3300048929 Bacteria 94734
179 Ga0496126_0001019 3300048929 Bacteria 47578
180 Ga0501036_0025832 3300049572 Bacteria 4957
181 Ga0501046_0013003 3300049580 Bacteria 7064
182 Ga0501083_0029686 3300049744 Bacteria 3758
183 Ga0501035_0048403 3300049822 Bacteria 3813
184 nmdc:mga03683_2553_c1 3300050489 Bacteria 5680
185 nmdc:mga00v17_3076_c1 3300050491 Bacteria 8574
186 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
187 nmdc:mga0yw44_11723_c2 3300050492 Bacteria 4162
188 nmdc:mga0yw44_1454_c2 3300050492 Bacteria 3137
189 nmdc:mga0yw44_2879_c1 3300050492 Bacteria 7477
190 nmdc:mga0k408_2434_c1 3300050493 Bacteria 9897
191 nmdc:mga06z11_9632_c1 3300050494 Bacteria 4078
192 nmdc:mga07m45_20018_c1 3300050496 Bacteria 3632
193 nmdc:mga0sz30_8734_c1 3300050516 Bacteria 3835
194 Ga0500572_004581 3300053111 Bacteria 3137
195 Ga0500658_0000110 3300053134 Bacteria 38421
196 Ga0500658_0004345 3300053134 Bacteria 5313
197 Ga0500568_0001453 3300053139 Bacteria 15183
198 Ga0500616_0000232 3300053153 Bacteria 87382
199 Ga0500622_0000471 3300053156 Bacteria 37968
200 Ga0500636_0000448 3300053177 Bacteria 22560
201 Ga0501082_0098580 3300060353 Bacteria 2527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0099270 Ga0496125_0099270_138_2126 587
2 3300048928 Ga0496125_0059046 Ga0496125_0059046_57_1991 617
3 3300046810 Ga0495660_0058283 Ga0495660_0058283_31_1974 627
4 iso_pu_bacteria 2876420981 2876423524 648
5 iso_pu_bacteria 2513237138 2513872051 657
6 3300031251 Ga0265327_10009422 Ga0265327_100094224 664
7 iso_pu_bacteria 2856334872 2856337870 670
8 iso_pu_bacteria 2857367948 2857372910 670
9 iso_pu_bacteria 2874162495 2874167779 670
10 iso_pu_bacteria 2878781027 2878787549 670
11 iso_pu_bacteria 2906408224 2906408614 670
12 iso_pu_bacteria 2922172374 2922174960 670
13 iso_pu_bacteria 2924762789 2924767283 670
14 iso_pu_bacteria 2965032056 2965034848 674
15 iso_pu_bacteria 2558860100 2558865711 676
16 3300025303 Ga0209051_1000176 Ga0209051_10001765 679
17 3300041404 Ga0439436_0009191 Ga0439436_0009191_841_2958 679
18 3300009011 Ga0105251_10010622 Ga0105251_100106224 682
19 3300048907 Ga0496104_0036529 Ga0496104_0036529_1933_4206 682
20 3300048908 Ga0496105_0002577 Ga0496105_0002577_3455_5728 682
21 3300048914 Ga0496111_0018779 Ga0496111_0018779_1453_3726 682
22 3300048922 Ga0496119_0003856 Ga0496119_0003856_12424_14697 682
23 3300048927 Ga0496124_0013499 Ga0496124_0013499_345_2618 682
24 iso_pu_bacteria 2906378014 2906386291 682
25 3300025302 Ga0207426_1009823 Ga0207426_10098233 683
26 3300003792 Ga0055540_1002919 Ga0055540_10029195 692
27 3300025273 Ga0209673_1000550 Ga0209673_100055058 694
28 3300038443 Ga0395901_0004556 Ga0395901_0004556_9445_11703 695
29 iso_pu_bacteria 2937980651 2937984788 695
30 3300002987 JGI25159J45721_1000020 JGI25159J45721_10000202 698
31 3300003354 JGI25160J50197_1000055 JGI25160J50197_10000552 698
32 3300003374 JGI25161J50226_1000374 JGI25161J50226_10003742 698
33 3300004625 Ga0055543_1000240 Ga0055543_100024042 698
34 3300005262 Ga0065165_1001002 Ga0065165_100100236 698
35 3300025284 Ga0209130_1000026 Ga0209130_1000026356 698
36 3300025302 Ga0207426_1000006 Ga0207426_10000061019 698
37 3300048923 Ga0496120_0000496 Ga0496120_0000496_34726_36984 699
38 3300038443 Ga0395901_0073568 Ga0395901_0073568_1139_3397 700
39 iso_pu_bacteria 2878788777 2878792056 700
40 3300010375 Ga0105239_10021138 Ga0105239_100211385 701
41 3300014497 Ga0182008_10004137 Ga0182008_100041378 701
42 3300042145 Ga0450906_006734 Ga0450906_006734_83_2278 701
43 3300050494 nmdc:mga06z11_9632_c1 nmdc:mga06z11_9632_c1_1531_3789 701
44 iso_pu_bacteria 2924762789 2924763958 702
45 3300025254 Ga0209148_1001087 Ga0209148_100108716 703
46 3300025272 Ga0209455_1003054 Ga0209455_10030544 703
47 3300025297 Ga0209758_1004967 Ga0209758_10049677 704
48 3300009545 Ga0105237_10017817 Ga0105237_100178172 706
49 3300009551 Ga0105238_10027401 Ga0105238_100274013 706
50 3300038443 Ga0395901_0053643 Ga0395901_0053643_762_3020 706
51 3300048925 Ga0496122_0000525 Ga0496122_0000525_10579_12840 706
52 3300048926 Ga0496123_0000448 Ga0496123_0000448_10550_12811 706
53 3300048927 Ga0496124_0001936 Ga0496124_0001936_6520_8775 706
54 3300048928 Ga0496125_0051899 Ga0496125_0051899_531_2798 707
55 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006501 708
56 3300009551 Ga0105238_10039291 Ga0105238_100392913 708
57 3300025261 Ga0209233_1000010 Ga0209233_10000101080 708
58 3300005548 Ga0070665_100013731 Ga0070665_1000137313 710
59 3300013100 Ga0157373_10019436 Ga0157373_100194363 710
60 3300050489 nmdc:mga03683_2553_c1 nmdc:mga03683_2553_c1_1080_3293 710
61 3300050491 nmdc:mga00v17_6_c1 nmdc:mga00v17_6_c1_82445_84658 710
62 3300050492 nmdc:mga0yw44_2879_c1 nmdc:mga0yw44_2879_c1_485_2698 710
63 3300050516 nmdc:mga0sz30_8734_c1 nmdc:mga0sz30_8734_c1_284_2497 710
64 3300006178 Ga0075367_10015106 Ga0075367_100151063 711
65 3300009093 Ga0105240_10057207 Ga0105240_100572074 711
66 3300035695 Ga0373927_0000178 Ga0373927_0000178_24954_27245 712
67 3300048926 Ga0496123_0021831 Ga0496123_0021831_2635_4857 713
68 iso_pu_bacteria 2903528002 2903530556 714
69 3300013249 Ga0171463_1003 Ga0171463_1003621 715
70 3300049822 Ga0501035_0048403 Ga0501035_0048403_635_2890 715
71 iso_pu_bacteria 2987652177 2987654847 715
72 iso_pu_bacteria 643692032 643825991 715
73 iso_pu_bacteria 2510065059 2510319973 716
74 iso_pu_bacteria 2515154107 2515612704 716
75 iso_pu_bacteria 2534681796 2535520846 716
76 iso_pu_bacteria 2582581306 2585269766 716
77 iso_pu_bacteria 2582581865 2585391108 716
78 iso_pu_bacteria 2855872281 2855876775 716
79 iso_pu_bacteria 2937822353 2937822983 716
80 iso_pu_bacteria 2509276019 2509380549 717
81 iso_pu_bacteria 2558860100 2558862689 717
82 iso_pu_bacteria 2857349434 2857354068 717
83 iso_pu_bacteria 2885305155 2885312438 717
84 iso_pu_bacteria 2885326080 2885333802 717
85 iso_pu_bacteria 2885334103 2885341322 717
86 3300025299 Ga0209256_1012524 Ga0209256_10125243 718
87 3300028794 Ga0307515_10000448 Ga0307515_1000044840 718
88 iso_pu_bacteria 2516143018 2516209706 718
89 iso_pu_bacteria 2847686936 2847688738 718
90 iso_pu_bacteria 2874102143 2874107639 718
91 iso_pu_bacteria 2876406927 2876407008 718
92 iso_pu_bacteria 2881853255 2881856508 718
93 iso_pu_bacteria 2906328253 2906333618 718
94 iso_pu_bacteria 2924726620 2924732075 718
95 iso_pu_bacteria 2977864932 2977871375 718
96 iso_pu_bacteria 2987666974 2987670427 718
97 3300013105 Ga0157369_10013384 Ga0157369_100133843 719
98 3300021320 Ga0214544_1000017 Ga0214544_100001746 719
99 3300021321 Ga0214542_1000006 Ga0214542_1000006184 719
100 3300021327 Ga0214543_1000014 Ga0214543_1000014139 719
101 iso_pu_bacteria 2508501122 2509111575 719
102 iso_pu_bacteria 2512047086 2512530834 719
103 iso_pu_bacteria 2913295892 2913301389 719
104 iso_pu_bacteria 8005542996 8005549786 719
105 iso_pu_bacteria 8054558443 8054560264 719
106 3300003790 Ga0055528_1000133 Ga0055528_100013337 720
107 3300025273 Ga0209673_1000005 Ga0209673_1000005244 720
108 3300025299 Ga0209256_1000783 Ga0209256_100078315 720
109 3300048929 Ga0496126_0000362 Ga0496126_0000362_38696_40996 720
110 iso_pu_bacteria 2516143018 2516206907 720
111 iso_pu_bacteria 2802429605 2805930799 720
112 3300021327 Ga0214543_1000005 Ga0214543_100000553 721
113 3300048920 Ga0496117_0003988 Ga0496117_0003988_6191_8452 721
114 3300048928 Ga0496125_0001127 Ga0496125_0001127_35737_37998 721
115 iso_pu_bacteria 2657244999 2657681216 721
116 iso_pu_bacteria 2802429268 2804752416 721
117 3300006946 Ga0079104_1004877 Ga0079104_10048773 722
118 3300022740 Ga0228710_1000707 Ga0228710_10007074 722
119 3300025303 Ga0209051_1000402 Ga0209051_100040224 722
120 3300027111 Ga0209281_1000272 Ga0209281_1000272106 722
121 3300027111 Ga0209281_1002751 Ga0209281_10027513 722
122 3300027666 Ga0209282_1000055 Ga0209282_1000055107 722
123 3300031967 Ga0315914_1000695 Ga0315914_100069545 722
124 3300033430 Ga0315913_1000019 Ga0315913_1000019105 722
125 3300033464 Ga0315915_1000023 Ga0315915_1000023129 722
126 3300046460 Ga0495638_0012420 Ga0495638_0012420_1680_3962 722
127 3300048919 Ga0496116_0000043 Ga0496116_0000043_206564_208864 722
128 3300053156 Ga0500622_0000471 Ga0500622_0000471_32548_34830 722
129 iso_pu_bacteria 2513237159 2513999117 722
130 iso_pu_bacteria 2842521101 2842524861 722
131 iso_pu_bacteria 2852387548 2852395312 722
132 iso_pu_bacteria 2874123672 2874128566 723
133 iso_pu_bacteria 2937877337 2937879697 723
134 iso_pu_bacteria 2958084443 2958086874 723
135 iso_pu_bacteria 3000135777 3000138740 723
136 iso_pu_bacteria 2693429783 2694631794 724
137 iso_pu_bacteria 2693429784 2694639271 724
138 iso_pu_bacteria 2854896431 2854899765 724
139 iso_pu_bacteria 2876363079 2876367334 724
140 iso_pu_bacteria 2888350351 2888351512 724
141 iso_pu_bacteria 2958115193 2958121893 724
142 iso_pu_bacteria 2968091066 2968094647 724
143 iso_pu_bacteria 2968128360 2968133792 724
144 iso_pu_bacteria 2979742915 2979744298 724
145 iso_pu_bacteria 8004703790 8004712735 724
146 iso_pu_bacteria 2558860983 2561468283 725
147 iso_pu_bacteria 2841734538 2841738485 725
148 iso_pu_bacteria 2854916844 2854921009 725
149 iso_pu_bacteria 2874123672 2874129301 725
150 iso_pu_bacteria 2885312484 2885316197 725
151 iso_pu_bacteria 2888343758 2888349513 725
152 iso_pu_bacteria 2989771324 2989774950 725
153 iso_pu_bacteria 8055617313 8055623955 725
154 3300003771 Ga0055526_1000508 Ga0055526_10005084 726
155 3300006051 Ga0075364_10001547 Ga0075364_100015473 726
156 3300015690 Ga0183363_1047 Ga0183363_10473 726
157 3300025294 Ga0209025_1000767 Ga0209025_100076743 726
158 3300025295 Ga0209564_1000208 Ga0209564_10002083 726
159 3300025299 Ga0209256_1000042 Ga0209256_100004239 726
160 3300025299 Ga0209256_1002161 Ga0209256_10021613 726
161 3300048924 Ga0496121_0002929 Ga0496121_0002929_14322_16610 726
162 3300048925 Ga0496122_0010990 Ga0496122_0010990_987_3275 726
163 3300050491 nmdc:mga00v17_3076_c1 nmdc:mga00v17_3076_c1_845_3133 726
164 iso_pu_bacteria 2643221688 2644495942 726
165 iso_pu_bacteria 2842509118 2842514334 726
166 iso_pu_bacteria 2871495908 2871496727 726
167 iso_pu_bacteria 2876392853 2876394257 726
168 iso_pu_bacteria 2878760144 2878760954 726
169 iso_pu_bacteria 2878767105 2878767917 726
170 iso_pu_bacteria 2881147464 2881150989 726
171 iso_pu_bacteria 2881161766 2881164203 726
172 iso_pu_bacteria 2903540706 2903541525 726
173 iso_pu_bacteria 2904659560 2904660973 726
174 iso_pu_bacteria 2937994558 2937995381 726
175 iso_pu_bacteria 2958165035 2958165857 726
176 iso_pu_bacteria 2961114664 2961120637 726
177 iso_pu_bacteria 2961163497 2961164316 726
178 iso_pu_bacteria 2965018300 2965019305 726
179 iso_pu_bacteria 2965110997 2965117134 726
180 iso_pu_bacteria 2968110612 2968111945 726
181 iso_pu_bacteria 2968171901 2968172716 726
182 iso_pu_bacteria 2970554993 2970555809 726
183 iso_pu_bacteria 2987636660 2987642520 726
184 iso_pu_bacteria 2987659509 2987660322 726
185 iso_pu_bacteria 3004188549 3004189371 726
186 iso_pu_bacteria 8054460903 8054462306 726
187 3300053111 Ga0500572_004581 Ga0500572_004581_139_2412 727
188 3300053177 Ga0500636_0000448 Ga0500636_0000448_711_2984 727
189 iso_pu_bacteria 2509276018 2509369773 727
190 iso_pu_bacteria 2529292951 2530649854 727
191 iso_pu_bacteria 2597489875 2597815434 727
192 iso_pu_bacteria 2844002411 2844002543 727
193 iso_pu_bacteria 2844009547 2844011748 727
194 iso_pu_bacteria 2856342000 2856347532 727
195 iso_pu_bacteria 2869249662 2869255304 727
196 iso_pu_bacteria 2869264136 2869270638 727
197 iso_pu_bacteria 2869271264 2869272692 727
198 iso_pu_bacteria 2869278585 2869285256 727
199 iso_pu_bacteria 2871444079 2871447366 727
200 iso_pu_bacteria 2871451962 2871457926 727
201 iso_pu_bacteria 2871459585 2871466843 727
202 iso_pu_bacteria 2874123672 2874124673 727
203 iso_pu_bacteria 2874139085 2874140346 727
204 iso_pu_bacteria 2876399893 2876406150 727
205 iso_pu_bacteria 2878035449 2878041206 727
206 iso_pu_bacteria 2878774303 2878776919 727
207 iso_pu_bacteria 2885305155 2885305199 727
208 iso_pu_bacteria 2885312484 2885315385 727
209 iso_pu_bacteria 2906386501 2906389691 727
210 iso_pu_bacteria 2922151315 2922151705 727
211 iso_pu_bacteria 2922158528 2922163029 727
212 iso_pu_bacteria 2924710171 2924713338 727
213 iso_pu_bacteria 2924733363 2924740131 727
214 iso_pu_bacteria 2924748358 2924754186 727
215 iso_pu_bacteria 2937848649 2937849509 727
216 iso_pu_bacteria 2937861824 2937867253 727
217 iso_pu_bacteria 2937891427 2937894133 727
218 iso_pu_bacteria 2958034702 2958040961 727
219 iso_pu_bacteria 2958041894 2958057455 727
220 iso_pu_bacteria 2958108152 2958111031 727
221 iso_pu_bacteria 2958122699 2958123097 727
222 iso_pu_bacteria 2958137437 2958141061 727
223 iso_pu_bacteria 2958158011 2958160403 727
224 iso_pu_bacteria 2961127735 2961132342 727
225 iso_pu_bacteria 2961136820 2961140181 727
226 iso_pu_bacteria 2961183825 2961189923 727
227 iso_pu_bacteria 2965047637 2965050156 727
228 iso_pu_bacteria 2965089291 2965096046 727
229 iso_pu_bacteria 2967996073 2967997312 727
230 iso_pu_bacteria 2968003550 2968010632 727
231 iso_pu_bacteria 2968097103 2968103231 727
232 iso_pu_bacteria 2970489779 2970491311 727
233 iso_pu_bacteria 2970524798 2970530950 727
234 iso_pu_bacteria 2970532167 2970535044 727
235 iso_pu_bacteria 2970540015 2970545941 727
236 iso_pu_bacteria 2970547951 2970554073 727
237 iso_pu_bacteria 2970593180 2970599872 727
238 iso_pu_bacteria 2970627176 2970630739 727
239 iso_pu_bacteria 2977821940 2977828001 727
240 iso_pu_bacteria 2977851361 2977856171 727
241 iso_pu_bacteria 2977858184 2977859985 727
242 iso_pu_bacteria 2977872689 2977877230 727
243 iso_pu_bacteria 2977907340 2977914247 727
244 iso_pu_bacteria 2977915119 2977917183 727
245 iso_pu_bacteria 2977922695 2977923787 727
246 iso_pu_bacteria 2977935797 2977937896 727
247 iso_pu_bacteria 2977950692 2977956222 727
248 iso_pu_bacteria 2977957713 2977960187 727
249 iso_pu_bacteria 2979764755 2979766406 727
250 iso_pu_bacteria 2979772303 2979772638 727
251 iso_pu_bacteria 2979779861 2979781039 727
252 iso_pu_bacteria 2979793036 2979798826 727
253 iso_pu_bacteria 2987645492 2987649878 727
254 iso_pu_bacteria 2987666974 2987671194 727
255 iso_pu_bacteria 2996341866 2996345407 727
256 iso_pu_bacteria 3004195979 3004199316 727
257 iso_pu_bacteria 3004211236 3004212873 727
258 iso_pu_bacteria 3004218560 3004220552 727
259 iso_pu_bacteria 3004239961 3004240367 727
260 iso_pu_bacteria 3004268573 3004271194 727
261 iso_pu_bacteria 3004289098 3004289235 727
262 iso_pu_bacteria 8004300914 8004301418 727
263 iso_pu_bacteria 8004312739 8004320185 727
264 iso_pu_bacteria 8004361976 8004363454 727
265 iso_pu_bacteria 8004374579 8004380977 727
266 iso_pu_bacteria 8004395343 8004400228 727
267 iso_pu_bacteria 8004445564 8004449866 727
268 iso_pu_bacteria 8004695233 8004700746 727
269 iso_pu_bacteria 8004727605 8004732877 727
270 3300041413 Ga0439465_0004964 Ga0439465_0004964_304_2586 728
271 iso_pu_bacteria 2906328253 2906331961 728
272 iso_pu_bacteria 2965062239 2965063395 728
273 iso_pu_bacteria 2977858184 2977861136 728
274 iso_pu_bacteria 8004445564 8004447784 728
275 3300046474 Ga0495605_0000920 Ga0495605_0000920_14110_16383 729
276 3300046492 Ga0495585_0002348 Ga0495585_0002348_1629_3902 729
277 3300046616 Ga0495668_0003214 Ga0495668_0003214_4402_6675 729
278 3300046660 Ga0495625_0000919 Ga0495625_0000919_18239_20512 729
279 3300048927 Ga0496124_0003536 Ga0496124_0003536_6360_8654 729
280 iso_pu_bacteria 2837651117 2837653477 729
281 iso_pu_bacteria 2891373044 2891373166 729
282 iso_pu_bacteria 2989349275 2989349426 729
283 3300006038 Ga0075365_10009000 Ga0075365_100090005 730
284 3300006353 Ga0075370_10013055 Ga0075370_100130552 730
285 3300025299 Ga0209256_1003045 Ga0209256_10030459 730
286 3300027312 Ga0209371_1000021 Ga0209371_1000021159 730
287 3300030500 Ga0268256_1000020 Ga0268256_1000020165 730
288 3300041413 Ga0439465_0008138 Ga0439465_0008138_961_3231 730
289 3300050492 nmdc:mga0yw44_11723_c2 nmdc:mga0yw44_11723_c2_1741_4026 730
290 3300050493 nmdc:mga0k408_2434_c1 nmdc:mga0k408_2434_c1_4040_6325 730
291 3300050496 nmdc:mga07m45_20018_c1 nmdc:mga07m45_20018_c1_333_2618 730
292 iso_pu_bacteria 2585427633 2585998186 730
293 iso_pu_bacteria 2585427634 2586002763 730
294 iso_pu_bacteria 2919171160 2919172726 730
295 iso_pu_bacteria 2513237103 2513714466 731
296 iso_pu_bacteria 2838661181 2838668290 731
297 3300025294 Ga0209025_1000119 Ga0209025_100011982 732
298 3300041505 Ga0451849_0834657 Ga0451849_0834657_305_2575 732
299 3300048929 Ga0496126_0001019 Ga0496126_0001019_10504_12798 732
300 iso_pu_bacteria 2643221568 2643855560 732
301 iso_pu_bacteria 2791355262 2793338144 732
302 iso_pu_bacteria 2899803654 2899809021 732
303 iso_pu_bacteria 2984587000 2984589453 732
304 3300003856 Ga0058692_1000350 Ga0058692_100035016 733
305 3300003856 Ga0058692_1002210 Ga0058692_10022105 733
306 3300006948 Ga0099826_10000091 Ga0099826_1000009128 733
307 3300013102 Ga0157371_10000015 Ga0157371_1000001555 733
308 3300013104 Ga0157370_10000402 Ga0157370_1000040227 733
309 3300025294 Ga0209025_1000094 Ga0209025_100009460 733
310 3300027312 Ga0209371_1000229 Ga0209371_10002293 733
311 3300027666 Ga0209282_1001073 Ga0209282_100107314 733
312 3300030500 Ga0268256_1006211 Ga0268256_10062113 733
313 3300037471 Ga0395905_0000569 Ga0395905_0000569_19939_22416 733
314 3300048920 Ga0496117_0000002 Ga0496117_0000002_1064557_1066848 733
315 3300048921 Ga0496118_0000355 Ga0496118_0000355_15393_17684 733
316 3300048922 Ga0496119_0020442 Ga0496119_0020442_352_2643 733
317 3300048923 Ga0496120_0000941 Ga0496120_0000941_14444_16735 733
318 3300048924 Ga0496121_0060769 Ga0496121_0060769_541_2832 733
319 3300048925 Ga0496122_0000001 Ga0496122_0000001_371010_373301 733
320 3300048926 Ga0496123_0000001 Ga0496123_0000001_374741_377032 733
321 iso_pu_bacteria 2513237093 2513636339 733
322 iso_pu_bacteria 2519899620 2520381406 733
323 iso_pu_bacteria 2615840624 2616298401 733
324 iso_pu_bacteria 2718217927 2719383673 733
325 iso_pu_bacteria 2718217997 2719663475 733
326 iso_pu_bacteria 2718218199 2720488879 733
327 iso_pu_bacteria 2718218235 2720634140 733
328 iso_pu_bacteria 2718218269 2720777979 733
329 iso_pu_bacteria 2718218365 2721155478 733
330 iso_pu_bacteria 2721755684 2723563898 733
331 iso_pu_bacteria 2721755685 2723570763 733
332 iso_pu_bacteria 2721755819 2724087721 733
333 iso_pu_bacteria 2721755822 2724102311 733
334 iso_pu_bacteria 2721755823 2724107495 733
335 iso_pu_bacteria 2728369397 2730296358 733
336 iso_pu_bacteria 2791355256 2793299704 733
337 iso_pu_bacteria 2791355259 2793318607 733
338 iso_pu_bacteria 2791355264 2793351118 733
339 iso_pu_bacteria 2791355265 2793357625 733
340 iso_pu_bacteria 2791355267 2793371381 733
341 iso_pu_bacteria 2802429635 2806063916 733
342 iso_pu_bacteria 2802429636 2806071204 733
343 iso_pu_bacteria 2838016132 2838022515 733
344 iso_pu_bacteria 2838061910 2838068212 733
345 iso_pu_bacteria 2842291075 2842297967 733
346 iso_pu_bacteria 2842370503 2842377396 733
347 iso_pu_bacteria 2842377471 2842384449 733
348 iso_pu_bacteria 2842447887 2842454326 733
349 iso_pu_bacteria 8005275841 8005276894 733
350 iso_pu_bacteria 8005619151 8005625229 733
351 iso_pu_bacteria 8018176218 8018181132 733
352 iso_pu_bacteria 8024501048 8024504840 733
353 iso_pu_bacteria 8057575449 8057576556 733
354 3300003794 Ga0055531_10004284 Ga0055531_100042846 734
355 3300009765 Ga0123341_1000231 Ga0123341_100023126 734
356 3300025273 Ga0209673_1006617 Ga0209673_10066173 734
357 3300025292 Ga0209676_1004782 Ga0209676_10047826 734
358 3300025297 Ga0209758_1000291 Ga0209758_100029153 734
359 3300025303 Ga0209051_1000958 Ga0209051_100095825 734
360 3300025304 Ga0209257_1002285 Ga0209257_10022853 734
361 3300050492 nmdc:mga0yw44_1454_c2 nmdc:mga0yw44_1454_c2_191_2473 734
362 3300053153 Ga0500616_0000232 Ga0500616_0000232_21508_23799 734
363 iso_pu_bacteria 2515075009 2515109867 734
364 iso_pu_bacteria 2517287029 2517411688 734
365 iso_pu_bacteria 2643221634 2644194201 734
366 iso_pu_bacteria 2718218233 2720616667 734
367 iso_pu_bacteria 2738541317 2738946074 734
368 iso_pu_bacteria 2838042994 2838047636 734
369 iso_pu_bacteria 2842395702 2842396898 734
370 iso_pu_bacteria 2913308742 2913311343 734
371 iso_pu_bacteria 8005460587 8005465902 734
372 3300003792 Ga0055540_1001170 Ga0055540_10011706 735
373 3300025298 Ga0209050_1002228 Ga0209050_100222815 735
374 3300025303 Ga0209051_1000615 Ga0209051_100061535 735
375 iso_pu_bacteria 2510461069 2510842787 735
376 iso_pu_bacteria 2513237088 2513600211 735
377 iso_pu_bacteria 2582581867 2585401115 735
378 iso_pu_bacteria 2585427590 2585824606 735
379 iso_pu_bacteria 3005452660 3005457017 735
380 iso_pu_bacteria 8018150411 8018152055 735
381 3300013102 Ga0157371_10005633 Ga0157371_100056337 736
382 3300046492 Ga0495585_0027758 Ga0495585_0027758_324_2594 736
383 3300046691 Ga0495670_0037017 Ga0495670_0037017_92_2362 736
384 3300048909 Ga0496106_0000474 Ga0496106_0000474_2923_5190 736
385 3300049572 Ga0501036_0025832 Ga0501036_0025832_1482_3761 736
386 3300049744 Ga0501083_0029686 Ga0501083_0029686_747_3026 736
387 3300053134 Ga0500658_0000110 Ga0500658_0000110_2509_4794 736
388 3300053134 Ga0500658_0004345 Ga0500658_0004345_1321_3588 736
389 3300053139 Ga0500568_0001453 Ga0500568_0001453_513_2780 736
390 iso_pu_bacteria 2510917028 2511184290 736
391 iso_pu_bacteria 2513237144 2513910155 736
392 iso_pu_bacteria 2933016740 2933019693 736
393 iso_pu_bacteria 2510917030 2511198917 737
394 iso_pu_bacteria 2516653085 2517082117 737
395 iso_pu_bacteria 2582581298 2585227476 737
396 iso_pu_bacteria 2582581299 2585232647 737
397 iso_pu_bacteria 2585427529 2585550843 737
398 iso_pu_bacteria 2718217882 2719179117 737
399 iso_pu_bacteria 2718217882 2719184098 737
400 iso_pu_bacteria 2718218009 2719729482 737
401 iso_pu_bacteria 2718218009 2719729671 737
402 iso_pu_bacteria 2718218232 2720616044 737
403 iso_pu_bacteria 2718218363 2721143732 737
404 iso_pu_bacteria 2718218363 2721143921 737
405 iso_pu_bacteria 2718218365 2721156609 737
406 iso_pu_bacteria 2718218366 2721161296 737
407 iso_pu_bacteria 2718218366 2721166828 737
408 iso_pu_bacteria 2721755514 2722837249 737
409 iso_pu_bacteria 2721755514 2722837806 737
410 iso_pu_bacteria 2721755556 2723031420 737
411 iso_pu_bacteria 2721755810 2724040825 737
412 iso_pu_bacteria 2721755810 2724041375 737
413 iso_pu_bacteria 2728369352 2730105112 737
414 iso_pu_bacteria 2728369365 2730161578 737
415 iso_pu_bacteria 2728369365 2730162238 737
416 iso_pu_bacteria 2728369397 2730295370 737
417 iso_pu_bacteria 2791355260 2793321965 737
418 iso_pu_bacteria 2802429605 2805932027 737
419 iso_pu_bacteria 2838668709 2838675036 737
420 iso_pu_bacteria 2842264693 2842270812 737
421 iso_pu_bacteria 2842311132 2842317422 737
422 iso_pu_bacteria 2842341865 2842348701 737
423 iso_pu_bacteria 2842363717 2842370400 737
424 iso_pu_bacteria 2842428310 2842434698 737
425 iso_pu_bacteria 2842434925 2842441067 737
426 iso_pu_bacteria 2842441272 2842447685 737
427 iso_pu_bacteria 2842462802 2842469059 737
428 iso_pu_bacteria 2842469257 2842475614 737
429 iso_pu_bacteria 2842489311 2842495741 737
430 iso_pu_bacteria 2842495871 2842502452 737
431 iso_pu_bacteria 2919100787 2919108319 737
432 iso_pu_bacteria 3005445848 3005451747 737
433 iso_pu_bacteria 8005289223 8005294068 737
434 iso_pu_bacteria 8005307578 8005312269 737
435 iso_pu_bacteria 8005430974 8005436472 737
436 iso_pu_bacteria 8005668836 8005674464 737
437 iso_pu_bacteria 8005688590 8005693202 737
438 iso_pu_bacteria 8005695170 8005699207 737
439 iso_pu_bacteria 8018127388 8018129480 737
440 iso_pu_bacteria 8056375014 8056379789 737
441 iso_pu_bacteria 8056382006 8056386382 737
442 iso_pu_bacteria 8057874678 8057878930 737
443 iso_pu_bacteria 2509276021 2509390328 738
444 iso_pu_bacteria 2718217997 2719669436 738
445 iso_pu_bacteria 2718218199 2720494452 738
446 iso_pu_bacteria 2718218232 2720610789 738
447 iso_pu_bacteria 2718218235 2720628023 738
448 iso_pu_bacteria 2718218269 2720771603 738
449 iso_pu_bacteria 2721755556 2723030867 738
450 iso_pu_bacteria 2721755684 2723563367 738
451 iso_pu_bacteria 2721755685 2723571357 738
452 iso_pu_bacteria 2721755819 2724087152 738
453 iso_pu_bacteria 2721755822 2724100863 738
454 iso_pu_bacteria 2721755823 2724108105 738
455 iso_pu_bacteria 2728369352 2730105333 738
456 iso_pu_bacteria 2738541333 2739037484 738
457 iso_pu_bacteria 2791355266 2793364154 738
458 iso_pu_bacteria 2838068647 2838072370 738
459 iso_pu_bacteria 2842285085 2842290852 738
460 iso_pu_bacteria 2842402390 2842408788 738
461 iso_pu_bacteria 2842409023 2842415451 738
462 iso_pu_bacteria 2842422224 2842426183 738
463 iso_pu_bacteria 2842447887 2842452603 738
464 iso_pu_bacteria 8005282627 8005287196 738
465 iso_pu_bacteria 8005289223 8005292124 738
466 iso_pu_bacteria 8005497431 8005503335 738
467 iso_pu_bacteria 8005570704 8005570743 738
468 iso_pu_bacteria 8005626139 8005631895 738
469 iso_pu_bacteria 8005668836 8005675213 738
470 iso_pu_bacteria 2509276033 2509445130 739
471 iso_pu_bacteria 2510065019 2510136994 739
472 iso_pu_bacteria 2510461076 2510897011 739
473 iso_pu_bacteria 2513237084 2513572685 739
474 iso_pu_bacteria 2513237085 2513581092 739
475 iso_pu_bacteria 2513237146 2513930227 739
476 iso_pu_bacteria 2513237162 2514023548 739
477 iso_pu_bacteria 2515154113 2515639568 739
478 iso_pu_bacteria 2515154114 2515644906 739
479 iso_pu_bacteria 2515154116 2515659445 739
480 iso_pu_bacteria 2516653077 2517040928 739
481 iso_pu_bacteria 2516653077 2517042144 739
482 iso_pu_bacteria 2517093000 2517099275 739
483 iso_pu_bacteria 2519899620 2520378782 739
484 iso_pu_bacteria 2585427528 2585542250 739
485 iso_pu_bacteria 2585427593 2585840554 739
486 iso_pu_bacteria 2599185170 2599414457 739
487 iso_pu_bacteria 2724679232 2725945955 739
488 iso_pu_bacteria 2738541333 2739038715 739
489 iso_pu_bacteria 2765235942 2766067054 739
490 iso_pu_bacteria 2791355256 2793295755 739
491 iso_pu_bacteria 2791355261 2793329435 739
492 iso_pu_bacteria 2791355263 2793340834 739
493 iso_pu_bacteria 2802429633 2806047212 739
494 iso_pu_bacteria 2802429634 2806054790 739
495 iso_pu_bacteria 2802429635 2806061982 739
496 iso_pu_bacteria 2802429636 2806069495 739
497 iso_pu_bacteria 2802429637 2806076134 739
498 iso_pu_bacteria 2838035591 2838042610 739
499 iso_pu_bacteria 2838686498 2838690876 739
500 iso_pu_bacteria 2842110456 2842115377 739
501 iso_pu_bacteria 2842217011 2842223536 739
502 iso_pu_bacteria 2842271015 2842275351 739
503 iso_pu_bacteria 2844454524 2844462133 739
504 iso_pu_bacteria 2933586486 2933589808 739
505 iso_pu_bacteria 2936367885 2936374068 739
506 iso_pu_bacteria 2936381700 2936388209 739
507 iso_pu_bacteria 2996893221 2996894603 739
508 iso_pu_bacteria 3005416602 3005420824 739
509 iso_pu_bacteria 639633055 639645563 739
510 iso_pu_bacteria 639633055 639650803 739
511 iso_pu_bacteria 8005301065 8005307307 739
512 iso_pu_bacteria 8005314921 8005318068 739
513 iso_pu_bacteria 8005570704 8005570770 739
514 iso_pu_bacteria 8005688590 8005688595 739
515 iso_pu_bacteria 8005695170 8005696996 739
516 iso_pu_bacteria 8018127388 8018130842 739
517 iso_pu_bacteria 8018127388 8018134300 739
518 iso_pu_bacteria 8018163183 8018164695 739
519 iso_pu_bacteria 8023680758 8023683779 739
520 iso_pu_bacteria 8057874678 8057879997 739
521 3300006038 Ga0075365_10001173 Ga0075365_100011739 740
522 3300025294 Ga0209025_1003939 Ga0209025_10039398 740
523 3300025303 Ga0209051_1010112 Ga0209051_10101124 740
524 3300002739 JGI25158J39367_1000430 JGI25158J39367_10004307 741
525 3300002773 JGI25152J39213_1001646 JGI25152J39213_10016466 741
526 3300002773 JGI25152J39213_1001741 JGI25152J39213_10017415 741
527 3300002987 JGI25159J45721_1000846 JGI25159J45721_10008465 741
528 3300003215 JGI25153J46596_10003144 JGI25153J46596_100031446 741
529 3300003354 JGI25160J50197_1003872 JGI25160J50197_10038725 741
530 3300003374 JGI25161J50226_1000084 JGI25161J50226_10000845 741
531 3300003771 Ga0055526_1002807 Ga0055526_10028074 741
532 3300003775 Ga0055524_1006414 Ga0055524_10064145 741
533 3300003790 Ga0055528_1004317 Ga0055528_10043175 741
534 3300004625 Ga0055543_1000017 Ga0055543_100001799 741
535 3300004625 Ga0055543_1002012 Ga0055543_10020126 741
536 3300005262 Ga0065165_1004951 Ga0065165_10049515 741
537 3300005262 Ga0065165_1005299 Ga0065165_10052996 741
538 3300025208 Ga0209436_100012 Ga0209436_100012143 741
539 3300025245 Ga0207425_1001408 Ga0207425_10014084 741
540 3300025258 Ga0209129_1000272 Ga0209129_100027213 741
541 3300025258 Ga0209129_1000815 Ga0209129_100081515 741
542 3300025258 Ga0209129_1000849 Ga0209129_10008497 741
543 3300025273 Ga0209673_1000741 Ga0209673_100074155 741
544 3300025273 Ga0209673_1002314 Ga0209673_10023147 741
545 3300025284 Ga0209130_1000022 Ga0209130_1000022241 741
546 3300025294 Ga0209025_1000735 Ga0209025_10007355 741
547 3300025294 Ga0209025_1002950 Ga0209025_10029508 741
548 3300025295 Ga0209564_1000215 Ga0209564_1000215125 741
549 3300025295 Ga0209564_1000238 Ga0209564_100023891 741
550 3300025297 Ga0209758_1000687 Ga0209758_100068751 741
551 3300025297 Ga0209758_1004002 Ga0209758_10040029 741
552 3300025297 Ga0209758_1005887 Ga0209758_10058875 741
553 3300025299 Ga0209256_1001519 Ga0209256_10015195 741
554 3300025299 Ga0209256_1005794 Ga0209256_10057945 741
555 3300025302 Ga0207426_1000005 Ga0207426_10000055 741
556 3300025302 Ga0207426_1000569 Ga0207426_100056950 741
557 3300025302 Ga0207426_1001114 Ga0207426_10011145 741
558 3300025303 Ga0209051_1019354 Ga0209051_10193543 741
559 3300025304 Ga0209257_1012749 Ga0209257_10127494 741
560 3300046492 Ga0495585_0013677 Ga0495585_0013677_820_3102 741
561 3300046506 Ga0495583_0005484 Ga0495583_0005484_2910_5192 741
562 3300049580 Ga0501046_0013003 Ga0501046_0013003_123_2405 741
563 3300060353 Ga0501082_0098580 Ga0501082_0098580_56_2338 741
564 3300005262 Ga0065165_1007968 Ga0065165_10079682 742
565 3300048925 Ga0496122_0000106 Ga0496122_0000106_1930_4215 742
566 3300048926 Ga0496123_0000022 Ga0496123_0000022_357942_360227 742
567 3300002704 JGI25155J39150_1000026 JGI25155J39150_1000026133 743
568 3300002705 JGI25156J39149_1000028 JGI25156J39149_1000028133 743
569 3300002738 JGI25154J39366_1000046 JGI25154J39366_1000046131 743
570 3300002741 JGI25157J39369_1000067 JGI25157J39369_1000067101 743
571 3300025206 Ga0209435_100017 Ga0209435_100017319 743
572 3300025246 Ga0209646_1000048 Ga0209646_10000483 743
573 3300025250 Ga0209026_1000035 Ga0209026_10000353 743
574 3300025256 Ga0209759_1000027 Ga0209759_1000027319 743

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00122

E1-E2_ATPase

E1-E2 ATPase

250

431

0.98

PF00403

HMA

Heavy-metal-associated domain

39

104

0.91

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

448

713

0.8

Feature Viewer

pLDDT pTM Quality
75 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map