F465299

General Info

Members Datasets Scaffolds Average Seq Length
574 256 1148 254

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100141842|Ga0075431_1001418422
Length 278
Sequence VTVTDNGVATPAPAAGADAHPTMDINLHVWRQAPGQEGRMVTYVEEAKDISPEMSFLEMLDIVNERLIAKGEDPIAFEHDCREGICGSCGMMINGQAHGPQKGTATCQLHMRKFSDGDEIYVEPWRARAFPVLRDLIVDREAFDRIIEAGGYMTAPTGAAPDANLILVPKEVSDAAMDAAACIGCGACVAACPNSAAQLFTSAKLQHLNLLPQGQAERYRRTVAMVDTMESYFGSCTNHGECEEACPKEISIDFIAYMNRDYVKAQLKNRKLAGQTST

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
142 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0
Rhizoplane 4.36
Rhizosphere 87.11
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100141842 3300006847 Bacteria 2477
2 Ga0070683_100282411 3300005329 Bacteria 1579
3 Ga0070683_100536722 3300005329 Bacteria 1118
4 Ga0068869_100284000 3300005334 Bacteria 1332
5 Ga0068869_100771201 3300005334 Bacteria 825
6 Ga0068868_100386665 3300005338 Bacteria 1205
7 Ga0070668_100397582 3300005347 Bacteria 1176
8 Ga0070671_100004383 3300005355 Bacteria 11158
9 Ga0070714_100472262 3300005435 Bacteria 1193
10 Ga0070713_100000168 3300005436 Bacteria 43646
11 Ga0070713_100182810 3300005436 Bacteria 1885
12 Ga0070711_100076507 3300005439 Bacteria 2373
13 Ga0070711_100515269 3300005439 Bacteria 988
14 Ga0070663_100138291 3300005455 Bacteria 1857
15 Ga0070681_10008750 3300005458 Bacteria 9932
16 Ga0070693_100014229 3300005547 Bacteria 4071
17 Ga0070693_100078131 3300005547 Bacteria 1966
18 Ga0070665_100005553 3300005548 Bacteria 12968
19 Ga0070665_100277545 3300005548 Bacteria 1678
20 Ga0070704_100280567 3300005549 Bacteria 1380
21 Ga0068855_100087730 3300005563 Bacteria 3595
22 Ga0070664_100183588 3300005564 Bacteria 1860
23 Ga0070664_100251144 3300005564 Bacteria 1590
24 Ga0068857_100555869 3300005577 Bacteria 1082
25 Ga0068864_100421521 3300005618 Bacteria 1272
26 Ga0068864_100782109 3300005618 Bacteria 937
27 Ga0068861_100739667 3300005719 Bacteria 918
28 Ga0068863_100690499 3300005841 Bacteria 1014
29 Ga0068858_100012927 3300005842 Bacteria 7872
30 Ga0068860_100192521 3300005843 Bacteria 1974
31 Ga0081455_10001121 3300005937 Bacteria 33469
32 Ga0081455_10012359 3300005937 Bacteria 8519
33 Ga0081455_10070894 3300005937 Bacteria 2892
34 Ga0081455_10181677 3300005937 Bacteria 1592
35 Ga0081538_10000111 3300005981 Bacteria 81814
36 Ga0081538_10041253 3300005981 Bacteria 2932
37 Ga0081539_10017903 3300005985 Bacteria 4944
38 Ga0070717_10054504 3300006028 Bacteria 3298
39 Ga0075365_10011517 3300006038 Bacteria 5202
40 Ga0075365_10018775 3300006038 Bacteria 4257
41 Ga0075365_10050904 3300006038 Bacteria 2734
42 Ga0075365_10147208 3300006038 Bacteria 1637
43 Ga0075365_10213933 3300006038 Bacteria 1352
44 Ga0075363_100038987 3300006048 Bacteria 2499
45 Ga0075363_100075491 3300006048 Bacteria 1837
46 Ga0075363_100250983 3300006048 Bacteria 1019
47 Ga0075364_10028542 3300006051 Bacteria 3572
48 Ga0075364_10098719 3300006051 Bacteria 1943
49 Ga0075364_10214454 3300006051 Bacteria 1306
50 Ga0070712_100021785 3300006175 Bacteria 4215
51 Ga0070712_100098800 3300006175 Bacteria 2153
52 Ga0075362_10193240 3300006177 Bacteria 989
53 Ga0075367_10016454 3300006178 Bacteria 4037
54 Ga0075367_10096656 3300006178 Bacteria 1801
55 Ga0075367_10292966 3300006178 Bacteria 1024
56 Ga0075367_10322464 3300006178 Bacteria 973
57 Ga0075428_100001768 3300006844 Bacteria 23072
58 Ga0075428_100004130 3300006844 Bacteria 15986
59 Ga0075428_100051471 3300006844 Bacteria 4516
60 Ga0075428_100256025 3300006844 Bacteria 1886
61 Ga0075428_100568553 3300006844 Bacteria 1211
62 Ga0075430_100001329 3300006846 Bacteria 19966
63 Ga0075430_100176842 3300006846 Bacteria 1775
64 Ga0075430_100217720 3300006846 Bacteria 1584
65 Ga0075431_100004231 3300006847 Bacteria 14063
66 Ga0075431_100004863 3300006847 Bacteria 13229
67 Ga0075431_100006249 3300006847 Bacteria 11833
68 Ga0075431_100068315 3300006847 Bacteria 3667
69 Ga0075431_100088699 3300006847 Bacteria 3192
70 Ga0075434_100479008 3300006871 Bacteria 1266
71 Ga0075429_100000058 3300006880 Bacteria 53378
72 Ga0075429_100039381 3300006880 Bacteria 4113
73 Ga0075429_100072324 3300006880 Bacteria 3003
74 Ga0075429_100189157 3300006880 Bacteria 1804
75 Ga0075429_100468983 3300006880 Bacteria 1103
76 Ga0075435_100208379 3300007076 Bacteria 1657
77 Ga0105240_10593773 3300009093 Bacteria 1220
78 Ga0111539_10097152 3300009094 Bacteria 3460
79 Ga0111539_10128565 3300009094 Bacteria 2967
80 Ga0111539_10150920 3300009094 Bacteria 2720
81 Ga0111539_10252284 3300009094 Bacteria 2054
82 Ga0105245_10002034 3300009098 Bacteria 18344
83 Ga0105245_10741715 3300009098 Bacteria 1017
84 Ga0105247_10294589 3300009101 Bacteria 1123
85 Ga0114129_10000091 3300009147 Bacteria 86444
86 Ga0114129_10027319 3300009147 Bacteria 8081
87 Ga0114129_10201908 3300009147 Bacteria 2692
88 Ga0114129_10231820 3300009147 Bacteria 2487
89 Ga0114129_10731671 3300009147 Bacteria 1268
90 Ga0114129_11134134 3300009147 Bacteria 977
91 Ga0105243_10045249 3300009148 Bacteria 3457
92 Ga0105242_10039532 3300009176 Bacteria 3798
93 Ga0105242_10095370 3300009176 Bacteria 2511
94 Ga0105242_10808971 3300009176 Bacteria 928
95 Ga0105248_10374641 3300009177 Bacteria 1603
96 Ga0105238_11013087 3300009551 Bacteria 851
97 Ga0105249_10923505 3300009553 Bacteria 940
98 Ga0157369_10099358 3300013105 Bacteria 3103
99 Ga0157369_10617112 3300013105 Bacteria 1119
100 Ga0157374_10175180 3300013296 Bacteria 2094
101 Ga0157374_10307067 3300013296 Bacteria 1570
102 Ga0157374_10607119 3300013296 Bacteria 1104
103 Ga0157378_10275776 3300013297 Bacteria 1619
104 Ga0163162_10782474 3300013306 Bacteria 1072
105 Ga0163163_10881641 3300014325 Bacteria 958
106 Ga0163163_10897171 3300014325 Bacteria 950
107 Ga0157380_10145384 3300014326 Bacteria 2043
108 Ga0157377_10187959 3300014745 Bacteria 1303
109 Ga0157376_10336396 3300014969 Bacteria 1440
110 Ga0207692_10017252 3300025898 Bacteria 3216
111 Ga0207688_10197611 3300025901 Bacteria 1205
112 Ga0207707_10007153 3300025912 Bacteria 9717
113 Ga0207707_10019333 3300025912 Bacteria 5945
114 Ga0207707_10184668 3300025912 Bacteria 1820
115 Ga0207693_10169215 3300025915 Bacteria 1721
116 Ga0207693_10268275 3300025915 Bacteria 1338
117 Ga0207663_10099775 3300025916 Bacteria 1947
118 Ga0207652_10666104 3300025921 Bacteria 930
119 Ga0207646_10237959 3300025922 Bacteria 1645
120 Ga0207681_10347188 3300025923 Bacteria 1187
121 Ga0207659_10209158 3300025926 Bacteria 1563
122 Ga0207687_10008189 3300025927 Bacteria 6842
123 Ga0207687_10209147 3300025927 Bacteria 1529
124 Ga0207700_10039414 3300025928 Bacteria 3439
125 Ga0207700_10299631 3300025928 Bacteria 1388
126 Ga0207700_10531050 3300025928 Bacteria 1043
127 Ga0207644_10091970 3300025931 Bacteria 2262
128 Ga0207644_10641312 3300025931 Bacteria 884
129 Ga0207690_10031872 3300025932 Bacteria 3378
130 Ga0207706_10129376 3300025933 Bacteria 2220
131 Ga0207686_10269257 3300025934 Bacteria 1252
132 Ga0207665_10191009 3300025939 Bacteria 1488
133 Ga0207691_10219797 3300025940 Bacteria 1648
134 Ga0207679_10227080 3300025945 Bacteria 1574
135 Ga0207668_10102479 3300025972 Bacteria 2130
136 Ga0207640_10421945 3300025981 Bacteria 1092
137 Ga0207658_10822333 3300025986 Bacteria 844
138 Ga0207703_10010911 3300026035 Bacteria 7081
139 Ga0207641_10421635 3300026088 Bacteria 1285
140 Ga0207676_10084023 3300026095 Bacteria 2594
141 Ga0207676_10289104 3300026095 Bacteria 1492
142 Ga0207676_10297251 3300026095 Bacteria 1473
143 Ga0207676_10449989 3300026095 Bacteria 1214
144 Ga0207675_100616949 3300026118 Bacteria 1089
145 Ga0207675_100925362 3300026118 Bacteria 889
146 Ga0207683_10689094 3300026121 Bacteria 947
147 Ga0209813_10056765 3300027866 Bacteria 1240
148 Ga0207428_10022161 3300027907 Bacteria 5363
149 Ga0207428_10114075 3300027907 Bacteria 2077
150 Ga0268266_10086458 3300028379 Bacteria 2742
151 Ga0268266_10214793 3300028379 Bacteria 1765
152 Ga0268266_10680697 3300028379 Bacteria 991
153 Ga0268264_10159432 3300028381 Bacteria 2031
154 Ga0265334_10026680 3300028573 Bacteria 2331
155 Ga0265322_10002981 3300028654 Bacteria 5151
156 Ga0265338_10000149 3300028800 Bacteria 127027
157 Ga0265338_10091399 3300028800 Bacteria 2515
158 Ga0265332_10105192 3300031238 Bacteria 1190
159 Ga0265325_10005785 3300031241 Bacteria 7580
160 Ga0265329_10000870 3300031242 Bacteria 15259
161 Ga0265339_10006718 3300031249 Bacteria 7512
162 Ga0265339_10020888 3300031249 Bacteria 3819
163 Ga0265331_10024015 3300031250 Bacteria 3090
164 Ga0265327_10010207 3300031251 Bacteria 6634
165 Ga0265327_10015927 3300031251 Bacteria 4813
166 Ga0265327_10029492 3300031251 Bacteria 3121
167 Ga0265327_10050934 3300031251 Bacteria 2164
168 Ga0265327_10155171 3300031251 Bacteria 1061
169 Ga0265327_10163945 3300031251 Bacteria 1025
170 Ga0265316_10002062 3300031344 Bacteria 21157
171 Ga0265316_10185606 3300031344 Bacteria 1547
172 Ga0307408_100357837 3300031548 Bacteria 1241
173 Ga0265313_10005933 3300031595 Bacteria 8835
174 Ga0265314_10050760 3300031711 Bacteria 2893
175 Ga0265314_10055040 3300031711 Bacteria 2749
176 Ga0265342_10001527 3300031712 Bacteria 21406
177 Ga0316576_10001198 3300031727 Bacteria 13675
178 Ga0316576_10066056 3300031727 Bacteria 2659
179 Ga0316578_10003461 3300031728 Bacteria 7225
180 Ga0316578_10197997 3300031728 Bacteria 1210
181 Ga0316577_10055815 3300031733 Bacteria 2204
182 Ga0307410_10048078 3300031852 Bacteria 2855
183 Ga0307407_10167547 3300031903 Bacteria 1444
184 Ga0307409_100183391 3300031995 Bacteria 1855
185 Ga0307416_100437660 3300032002 Bacteria 1357
186 Ga0307416_100550251 3300032002 Bacteria 1227
187 Ga0307411_10085632 3300032005 Bacteria 2184
188 Ga0307415_100286029 3300032126 Bacteria 1358
189 Ga0307415_100308258 3300032126 Bacteria 1315
190 Ga0316580_10096563 3300032139 Bacteria 904
191 Ga0373930_0004702 3300034816 Bacteria 2235
192 Ga0373948_0002487 3300034817 Bacteria 2732
193 Ga0373926_0030082 3300035083 Bacteria 1910
194 Ga0373928_0005348 3300035084 Bacteria 2453
195 Ga0373932_0000349 3300035112 Bacteria 14175
196 Ga0373945_0047393 3300035116 Bacteria 1571
197 Ga0373953_0006244 3300035117 Bacteria 3915
198 Ga0373954_0008789 3300035118 Bacteria 4443
199 Ga0373956_0000415 3300035119 Bacteria 17327
200 Ga0373946_0060572 3300035171 Bacteria 1609
201 Ga0373946_0237511 3300035171 Bacteria 885
202 Ga0373955_0000555 3300035172 Bacteria 15870
203 Ga0373955_0302172 3300035172 Bacteria 965
204 Ga0316574_0004863 3300035398 Bacteria 7114
205 Ga0316574_0011457 3300035398 Bacteria 5039
206 Ga0316574_0016503 3300035398 Bacteria 4305
207 Ga0316574_0165967 3300035398 Bacteria 1422
208 Ga0316574_0190076 3300035398 Bacteria 1320
209 Ga0373924_0005409 3300035410 Bacteria 4520
210 Ga0373931_0000003 3300035691 Bacteria 560286
211 Ga0373931_0000049 3300035691 Bacteria 63064
212 Ga0373931_0034375 3300035691 Bacteria 2631
213 Ga0373927_0142275 3300035695 Bacteria 1569
214 Ga0373933_0000055 3300035724 Bacteria 67484
215 Ga0373933_0067939 3300035724 Bacteria 2164
216 Ga0373947_0069805 3300035725 Bacteria 2151
217 Ga0373937_0000420 3300036401 Bacteria 39552
218 Ga0373937_0116409 3300036401 Bacteria 2489
219 Ga0316582_0026301 3300036647 Bacteria 3502
220 Ga0316582_0142223 3300036647 Bacteria 1618
221 Ga0316582_0180573 3300036647 Bacteria 1436
222 Ga0316584_0020673 3300036712 Bacteria 4776
223 Ga0316584_0029120 3300036712 Bacteria 4076
224 Ga0316584_0227434 3300036712 Bacteria 1368
225 Ga0373925_0013717 3300037068 Bacteria 5867
226 Ga0395901_0281833 3300038443 Bacteria 1727
227 Ga0400485_04335 3300038735 Bacteria 2507
228 Ga0400485_10559 3300038735 Bacteria 4472
229 Ga0400483_015531 3300039062 Bacteria 3688
230 Ga0400483_016254 3300039062 Bacteria 54904
231 Ga0400483_024784 3300039062 Bacteria 3799
232 Ga0400483_043157 3300039062 Bacteria 5375
233 Ga0400483_082826 3300039062 Bacteria 6784
234 Ga0400483_148612 3300039062 Bacteria 4462
235 Ga0400483_189864 3300039062 Bacteria 51364
236 Ga0400483_201548 3300039062 Bacteria 2028
237 Ga0400483_213226 3300039062 Bacteria 1262
238 Ga0400483_227564 3300039062 Bacteria 5842
239 Ga0400483_257051 3300039062 Bacteria 6325
240 Ga0436365_0488997 3300039437 Bacteria 2692
241 Ga0439436_0058766 3300041404 Bacteria 1078
242 Ga0439466_0074389 3300041411 Bacteria 1078
243 Ga0451837_1710427 3300041494 Bacteria 1255
244 Ga0439448_0004663 3300042005 Bacteria 3878
245 Ga0439432_078867 3300042006 Bacteria 999
246 Ga0439450_001320 3300042008 Bacteria 3601
247 Ga0439452_035551 3300042010 Bacteria 1198
248 Ga0450902_015040 3300042137 Bacteria 1254
249 Ga0439434_0043289 3300042435 Bacteria 1385
250 Ga0439434_0045780 3300042435 Bacteria 1350
251 Ga0439464_0013166 3300042439 Bacteria 2211
252 Ga0439460_0056002 3300042461 Bacteria 1193
253 Ga0439440_0006850 3300042993 Bacteria 2304
254 Ga0466957_0272099 3300044842 Bacteria 1131
255 Ga0466959_0171350 3300045049 Bacteria 1522
256 Ga0466958_0360977 3300045836 Bacteria 936
257 Ga0466967_0148910 3300045976 Bacteria 2186
258 Ga0466967_0771168 3300045976 Bacteria 954
259 Ga0495592_0000395 3300046454 Bacteria 33972
260 Ga0495592_0026130 3300046454 Bacteria 4430
261 Ga0495592_0262956 3300046454 Bacteria 1136
262 Ga0495603_0017296 3300046455 Bacteria 4366
263 Ga0495603_0296977 3300046455 Bacteria 928
264 Ga0495629_0019641 3300046459 Bacteria 4825
265 Ga0495629_0108513 3300046459 Bacteria 1936
266 Ga0495641_0065447 3300046461 Bacteria 1636
267 Ga0495641_0201066 3300046461 Bacteria 893
268 Ga0495651_0000996 3300046462 Bacteria 21980
269 Ga0495651_0165192 3300046462 Bacteria 1582
270 Ga0495653_0000195 3300046463 Bacteria 49244
271 Ga0495653_0009938 3300046463 Bacteria 7784
272 Ga0495653_0081473 3300046463 Bacteria 2392
273 Ga0495653_0142647 3300046463 Bacteria 1683
274 Ga0495582_0019694 3300046473 Bacteria 3689
275 Ga0495582_0039782 3300046473 Bacteria 2589
276 Ga0495582_0129755 3300046473 Bacteria 1424
277 Ga0495639_0014891 3300046475 Bacteria 3370
278 Ga0495639_0076087 3300046475 Bacteria 1557
279 Ga0495594_0325892 3300046499 Bacteria 875
280 Ga0495607_0163703 3300046501 Bacteria 1128
281 Ga0495608_0000085 3300046511 Bacteria 68124
282 Ga0495608_0039547 3300046511 Bacteria 3161
283 Ga0495628_0000154 3300046516 Bacteria 59770
284 Ga0495628_0005349 3300046516 Bacteria 11264
285 Ga0495628_0016727 3300046516 Bacteria 6114
286 Ga0495630_0001923 3300046517 Bacteria 14486
287 Ga0495630_0031194 3300046517 Bacteria 3967
288 Ga0495630_0055049 3300046517 Bacteria 2980
289 Ga0495652_0004085 3300046529 Bacteria 14085
290 Ga0495652_0382435 3300046529 Bacteria 1001
291 Ga0495665_0018501 3300046531 Bacteria 3743
292 Ga0495640_0224106 3300046533 Bacteria 1185
293 Ga0495587_0006926 3300046536 Bacteria 7366
294 Ga0495587_0092465 3300046536 Bacteria 1747
295 Ga0495587_0423614 3300046536 Bacteria 739
296 Ga0495645_0000144 3300046543 Bacteria 48490
297 Ga0495667_0003612 3300046559 Bacteria 10400
298 Ga0495667_0038919 3300046559 Bacteria 3166
299 Ga0495634_0014118 3300046642 Bacteria 5767
300 Ga0495634_0170856 3300046642 Bacteria 1366
301 Ga0495635_0000253 3300046663 Bacteria 34161
302 Ga0495635_0207906 3300046663 Bacteria 1326
303 Ga0495635_0281148 3300046663 Bacteria 1118
304 Ga0495588_0052784 3300046674 Bacteria 2096
305 Ga0495657_0000210 3300046675 Bacteria 52663
306 Ga0495599_0000320 3300046678 Bacteria 28749
307 Ga0495623_0000750 3300046679 Bacteria 21746
308 Ga0495646_0002718 3300046680 Bacteria 10930
309 Ga0495658_0021085 3300046683 Bacteria 3430
310 Ga0495658_0022126 3300046683 Bacteria 3359
311 Ga0495613_0074748 3300046689 Bacteria 2468
312 Ga0495613_0090879 3300046689 Bacteria 2211
313 Ga0495613_0161319 3300046689 Bacteria 1595
314 Ga0495600_0000023 3300046809 Bacteria 94401
315 Ga0495581_0009896 3300047315 Bacteria 5515
316 Ga0495604_0000251 3300047317 Bacteria 47665
317 Ga0495674_0006496 3300047319 Bacteria 11215
318 Ga0495674_0148940 3300047319 Bacteria 1963
319 Ga0495676_0072396 3300047321 Bacteria 2647
320 Ga0495680_0008686 3300047322 Bacteria 9213
321 Ga0495680_0110668 3300047322 Bacteria 2035
322 Ga0495680_0217819 3300047322 Bacteria 1364
323 Ga0495680_0507471 3300047322 Bacteria 818
324 Ga0495675_0003854 3300047444 Bacteria 9085
325 Ga0495675_0150633 3300047444 Bacteria 1437
326 Ga0495684_0000037 3300047471 Bacteria 106933
327 Ga0495684_0031760 3300047471 Bacteria 4056
328 Ga0495684_0153582 3300047471 Bacteria 1720
329 Ga0495593_0009152 3300047673 Bacteria 5744
330 Ga0495602_0002980 3300048088 Bacteria 17361
331 Ga0495614_0104490 3300048089 Unclassified 1240
332 Ga0495614_0107882 3300048089 Bacteria 1221
333 Ga0496101_0075798 3300048904 Bacteria 2476
334 Ga0496102_0182175 3300048905 Bacteria 1979
335 Ga0496102_0285761 3300048905 Bacteria 1555
336 Ga0496102_0524798 3300048905 Bacteria 1107
337 Ga0496104_0007380 3300048907 Bacteria 9714
338 Ga0496105_0002999 3300048908 Bacteria 12411
339 Ga0496105_0005139 3300048908 Bacteria 9928
340 Ga0496105_0270609 3300048908 Bacteria 1372
341 Ga0496106_0413126 3300048909 Bacteria 1085
342 Ga0496108_0086858 3300048911 Bacteria 2656
343 Ga0496108_0345721 3300048911 Bacteria 1298
344 Ga0496108_0368006 3300048911 Bacteria 1255
345 Ga0496109_0066405 3300048912 Bacteria 3303
346 Ga0496109_0066697 3300048912 Bacteria 3296
347 Ga0496109_0080736 3300048912 Bacteria 2997
348 Ga0496109_0096057 3300048912 Bacteria 2745
349 Ga0496109_0225432 3300048912 Bacteria 1763
350 Ga0496109_0532323 3300048912 Bacteria 1109
351 Ga0496110_0578517 3300048913 Bacteria 1020
352 Ga0496110_0629692 3300048913 Bacteria 972
353 Ga0496112_0088634 3300048915 Bacteria 3062
354 Ga0496112_0251555 3300048915 Bacteria 1718
355 Ga0496113_0424614 3300048916 Bacteria 1068
356 Ga0496114_0023013 3300048917 Bacteria 5079
357 Ga0496114_0154302 3300048917 Bacteria 1993
358 Ga0496121_0217369 3300048924 Bacteria 1349
359 Ga0496126_0175858 3300048929 Bacteria 1821
360 Ga0501031_0001704 3300049568 Bacteria 13796
361 Ga0501031_0044182 3300049568 Bacteria 2908
362 Ga0501031_0063503 3300049568 Bacteria 2406
363 Ga0501032_0003134 3300049569 Bacteria 12729
364 Ga0501032_0070814 3300049569 Bacteria 2325
365 Ga0501032_0087851 3300049569 Bacteria 2064
366 Ga0501032_0110084 3300049569 Bacteria 1823
367 Ga0501033_0000740 3300049570 Bacteria 29988
368 Ga0501033_0032828 3300049570 Bacteria 3898
369 Ga0501033_0388488 3300049570 Bacteria 974
370 Ga0501034_0008392 3300049571 Bacteria 10918
371 Ga0501036_0010115 3300049572 Bacteria 7775
372 Ga0501036_0102392 3300049572 Bacteria 2422
373 Ga0501036_0259314 3300049572 Bacteria 1456
374 Ga0501036_0366900 3300049572 Bacteria 1202
375 Ga0501037_0001668 3300049573 Bacteria 16149
376 Ga0501037_0046339 3300049573 Bacteria 3189
377 Ga0501037_0156008 3300049573 Bacteria 1629
378 Ga0501037_0167424 3300049573 Bacteria 1564
379 Ga0501037_0240733 3300049573 Bacteria 1268
380 Ga0501038_0001722 3300049574 Bacteria 20335
381 Ga0501038_0057296 3300049574 Bacteria 3346
382 Ga0501038_0059189 3300049574 Bacteria 3282
383 Ga0501039_0001419 3300049575 Bacteria 17627
384 Ga0501039_0001952 3300049575 Bacteria 15293
385 Ga0501039_0070044 3300049575 Bacteria 2724
386 Ga0501039_0074892 3300049575 Bacteria 2631
387 Ga0501039_0075769 3300049575 Bacteria 2615
388 Ga0501039_0124334 3300049575 Bacteria 2023
389 Ga0501039_0335146 3300049575 Bacteria 1189
390 Ga0501040_0002352 3300049576 Bacteria 12143
391 Ga0501040_0016987 3300049576 Bacteria 4824
392 Ga0501040_0021283 3300049576 Bacteria 4329
393 Ga0501040_0329112 3300049576 Bacteria 1093
394 Ga0501040_0461822 3300049576 Bacteria 914
395 Ga0501040_0530317 3300049576 Bacteria 849
396 Ga0501041_0002109 3300049577 Bacteria 11209
397 Ga0501041_0005129 3300049577 Bacteria 7640
398 Ga0501042_0013729 3300049578 Bacteria 5516
399 Ga0501042_0034744 3300049578 Bacteria 3576
400 Ga0501042_0208865 3300049578 Bacteria 1408
401 Ga0501042_0390577 3300049578 Bacteria 1008
402 Ga0501043_0014314 3300049579 Bacteria 6208
403 Ga0501043_0083815 3300049579 Bacteria 2506
404 Ga0501043_0158672 3300049579 Bacteria 1768
405 Ga0501043_0383863 3300049579 Bacteria 1063
406 Ga0501046_0009840 3300049580 Bacteria 8242
407 Ga0501046_0026907 3300049580 Bacteria 4697
408 Ga0501046_0047147 3300049580 Bacteria 3417
409 Ga0501046_0048554 3300049580 Bacteria 3361
410 Ga0501046_0051664 3300049580 Bacteria 3243
411 Ga0501047_0009574 3300049581 Bacteria 9157
412 Ga0501047_0219908 3300049581 Bacteria 1756
413 Ga0501047_0307260 3300049581 Bacteria 1427
414 Ga0501048_0000600 3300049582 Bacteria 25555
415 Ga0501048_0006028 3300049582 Bacteria 9230
416 Ga0501048_0043666 3300049582 Bacteria 3208
417 Ga0501048_0170326 3300049582 Bacteria 1542
418 Ga0501067_0063967 3300049583 Bacteria 2037
419 Ga0501068_0000164 3300049584 Bacteria 30782
420 Ga0501068_0018846 3300049584 Bacteria 3999
421 Ga0501068_0046798 3300049584 Bacteria 2608
422 Ga0501069_0001031 3300049585 Bacteria 13308
423 Ga0501069_0065994 3300049585 Bacteria 2024
424 Ga0501070_0000016 3300049586 Bacteria 178549
425 Ga0501070_0007132 3300049586 Bacteria 9491
426 Ga0501070_0012694 3300049586 Bacteria 7104
427 Ga0501070_0014130 3300049586 Bacteria 6720
428 Ga0501070_0063708 3300049586 Bacteria 3054
429 Ga0501070_0082568 3300049586 Bacteria 2660
430 Ga0501070_0093777 3300049586 Bacteria 2484
431 Ga0501070_0119551 3300049586 Bacteria 2178
432 Ga0501070_0303527 3300049586 Bacteria 1300
433 Ga0501071_0001441 3300049587 Bacteria 13743
434 Ga0501071_0009693 3300049587 Bacteria 6426
435 Ga0501071_0014578 3300049587 Bacteria 5377
436 Ga0501071_0041812 3300049587 Bacteria 3282
437 Ga0501071_0100488 3300049587 Bacteria 2132
438 Ga0501071_0105268 3300049587 Bacteria 2083
439 Ga0501071_0196353 3300049587 Bacteria 1515
440 Ga0501071_0503439 3300049587 Bacteria 929
441 Ga0501072_0001416 3300049588 Bacteria 17980
442 Ga0501072_0021865 3300049588 Bacteria 4961
443 Ga0501072_0067928 3300049588 Bacteria 2813
444 Ga0501072_0098333 3300049588 Bacteria 2326
445 Ga0501072_0102357 3300049588 Bacteria 2276
446 Ga0501072_0162635 3300049588 Bacteria 1781
447 Ga0501072_0315251 3300049588 Bacteria 1243
448 Ga0501073_0002863 3300049589 Bacteria 12918
449 Ga0501073_0008935 3300049589 Bacteria 7401
450 Ga0501073_0015432 3300049589 Bacteria 5542
451 Ga0501073_0159202 3300049589 Bacteria 1564
452 Ga0501073_0285703 3300049589 Bacteria 1138
453 Ga0501074_0001548 3300049590 Bacteria 15547
454 Ga0501074_0073945 3300049590 Bacteria 2447
455 Ga0501074_0355721 3300049590 Bacteria 1039
456 Ga0501075_0001758 3300049591 Bacteria 14238
457 Ga0501075_0002131 3300049591 Bacteria 13096
458 Ga0501075_0002498 3300049591 Bacteria 12250
459 Ga0501075_0024112 3300049591 Bacteria 4456
460 Ga0501075_0032468 3300049591 Bacteria 3879
461 Ga0501075_0083213 3300049591 Bacteria 2424
462 Ga0501076_0005558 3300049592 Bacteria 9083
463 Ga0501076_0013246 3300049592 Bacteria 6183
464 Ga0501076_0046251 3300049592 Bacteria 3438
465 Ga0501076_0183507 3300049592 Bacteria 1706
466 Ga0501076_0246838 3300049592 Bacteria 1460
467 Ga0501076_0462728 3300049592 Bacteria 1044
468 Ga0501076_0586752 3300049592 Bacteria 919
469 Ga0501077_0004094 3300049593 Bacteria 8800
470 Ga0501077_0012700 3300049593 Bacteria 5274
471 Ga0501077_0024084 3300049593 Bacteria 3863
472 Ga0501077_0225246 3300049593 Bacteria 1192
473 Ga0501077_0273919 3300049593 Bacteria 1074
474 Ga0501079_0020900 3300049741 Bacteria 5005
475 Ga0501079_0054085 3300049741 Bacteria 3096
476 Ga0501079_0077729 3300049741 Bacteria 2567
477 Ga0501079_0098712 3300049741 Bacteria 2263
478 Ga0501080_0001813 3300049742 Bacteria 18312
479 Ga0501080_0022918 3300049742 Bacteria 5788
480 Ga0501080_0038612 3300049742 Bacteria 4457
481 Ga0501080_0072889 3300049742 Bacteria 3195
482 Ga0501080_0083732 3300049742 Bacteria 2963
483 Ga0501080_0175600 3300049742 Bacteria 1973
484 Ga0501080_0187503 3300049742 Bacteria 1901
485 Ga0501080_0247828 3300049742 Bacteria 1624
486 Ga0501081_0001943 3300049743 Bacteria 12839
487 Ga0501081_0012301 3300049743 Bacteria 5619
488 Ga0501081_0042036 3300049743 Bacteria 3132
489 Ga0501081_0112031 3300049743 Bacteria 1937
490 Ga0501081_0169996 3300049743 Bacteria 1573
491 Ga0501081_0302585 3300049743 Bacteria 1173
492 Ga0501081_0310528 3300049743 Bacteria 1158
493 Ga0501083_0010339 3300049744 Bacteria 6570
494 Ga0501083_0014676 3300049744 Bacteria 5477
495 Ga0501083_0050616 3300049744 Bacteria 2796
496 Ga0501035_0042412 3300049822 Bacteria 4104
497 Ga0501044_0010877 3300049823 Bacteria 9874
498 Ga0501044_0055758 3300049823 Bacteria 4058
499 Ga0501045_0007031 3300049824 Bacteria 7801
500 Ga0501045_0020281 3300049824 Bacteria 4747
501 Ga0501045_0043098 3300049824 Bacteria 3285
502 Ga0501045_0200523 3300049824 Bacteria 1487
503 Ga0501045_0205070 3300049824 Bacteria 1469
504 nmdc:mga03683_17374_c1 3300050489 Bacteria 2722
505 nmdc:mga03n38_36517_c1 3300050490 Bacteria 2113
506 nmdc:mga00v17_61031_c1 3300050491 Bacteria 2317
507 nmdc:mga0yw44_143780_c1 3300050492 Bacteria 1551
508 nmdc:mga0yw44_168767_c1 3300050492 Bacteria 1436
509 nmdc:mga0yw44_17475_c1 3300050492 Bacteria 3904
510 nmdc:mga0yw44_620_c1 3300050492 Bacteria 12856
511 nmdc:mga0yw44_81580_c1 3300050492 Bacteria 2028
512 nmdc:mga0yw44_83344_c1 3300050492 Bacteria 2008
513 nmdc:mga06z11_18040_c1 3300050494 Bacteria 3216
514 nmdc:mga06z11_6929_c2 3300050494 Bacteria 1394
515 nmdc:mga04h51_66290_c1 3300050495 Bacteria 1250
516 nmdc:mga05p37_103430_c1 3300050507 Bacteria 3506
517 nmdc:mga05p37_160382_c1 3300050507 Bacteria 2747
518 nmdc:mga05p37_262225_c1 3300050507 Bacteria 2067
519 nmdc:mga05p37_272_c1 3300050507 Bacteria 49943
520 nmdc:mga05p37_458086_c1 3300050507 Bacteria 1474
521 nmdc:mga05p37_85299_c1 3300050507 Bacteria 3891
522 nmdc:mga09592_13294_c1 3300050508 Bacteria 6722
523 nmdc:mga09592_198119_c1 3300050508 Bacteria 1739
524 nmdc:mga09592_2100_c1 3300050508 Bacteria 16087
525 nmdc:mga09592_36127_c1 3300050508 Bacteria 4138
526 nmdc:mga0qj67_21411_c1 3300050509 Bacteria 4960
527 nmdc:mga0qj67_360751_c1 3300050509 Bacteria 1174
528 nmdc:mga0qj67_365041_c1 3300050509 Bacteria 1167
529 nmdc:mga0qj67_4702_c1 3300050509 Bacteria 9915
530 nmdc:mga06r32_120291_c1 3300050510 Bacteria 2590
531 nmdc:mga06r32_1865_c1 3300050510 Bacteria 18767
532 nmdc:mga06r32_54414_c1 3300050510 Bacteria 3838
533 nmdc:mga06r32_797001_c1 3300050510 Bacteria 906
534 nmdc:mga06r32_8234_c1 3300050510 Bacteria 9387
535 nmdc:mga08y16_10919_c1 3300050511 Bacteria 9539
536 nmdc:mga08y16_134673_c1 3300050511 Bacteria 2568
537 nmdc:mga08y16_37828_c1 3300050511 Bacteria 5066
538 nmdc:mga0n895_1016500_c1 3300050512 Bacteria 809
539 nmdc:mga0n895_210606_c1 3300050512 Bacteria 1974
540 nmdc:mga0n895_462744_c1 3300050512 Bacteria 1280
541 nmdc:mga0a205_584491_c1 3300050515 Bacteria 970
542 Ga0495601_0004505 3300053077 Bacteria 8055
543 Ga0495601_0429702 3300053077 Bacteria 855
544 Ga0495595_0006629 3300053084 Bacteria 4727
545 Ga0495595_0057841 3300053084 Bacteria 1809
546 Ga0495619_0017385 3300053085 Bacteria 4554
547 Ga0495619_0025817 3300053085 Bacteria 3776
548 Ga0495619_0055580 3300053085 Bacteria 2622
549 Ga0495619_0093061 3300053085 Bacteria 2043
550 Ga0495619_0104740 3300053085 Bacteria 1928
551 Ga0495619_0374805 3300053085 Bacteria 984
552 Ga0500566_0000115 3300053094 Bacteria 41424
553 Ga0500566_0285923 3300053094 Bacteria 783
554 Ga0500616_0007770 3300053153 Bacteria 6763
555 Ga0501084_0000435 3300054114 Bacteria 32177
556 Ga0501084_0003388 3300054114 Bacteria 12919
557 Ga0501084_0127344 3300054114 Bacteria 2143
558 Ga0501084_0261972 3300054114 Bacteria 1459
559 Ga0501084_0439701 3300054114 Bacteria 1102
560 Ga0501082_0004567 3300060353 Bacteria 12089
561 Ga0501082_0020500 3300060353 Bacteria 5700
562 Ga0501082_0021269 3300060353 Bacteria 5597
563 Ga0501082_0068657 3300060353 Bacteria 3052
564 Ga0501082_0203663 3300060353 Bacteria 1722
565 Ga0501082_0302805 3300060353 Bacteria 1392
566 Ga0501082_0330634 3300060353 Bacteria 1328
567 Ga0501082_0389947 3300060353 Bacteria 1215
568 Ga0501082_0489256 3300060353 Bacteria 1075
569 Ga0530510_0002849 3300061734 Bacteria 11890
570 Ga0530510_0010013 3300061734 Bacteria 6652
571 Ga0530510_0027997 3300061734 Bacteria 4040
572 Ga0530510_0039364 3300061734 Bacteria 3412
573 Ga0530510_0047625 3300061734 Bacteria 3097
574 Ga0530510_0308731 3300061734 Bacteria 1184
575 Ga0075431_100141842
576 Ga0070683_100282411
577 Ga0070683_100536722
578 Ga0068869_100284000
579 Ga0068869_100771201
580 Ga0068868_100386665
581 Ga0070668_100397582
582 Ga0070671_100004383
583 Ga0070714_100472262
584 Ga0070713_100000168
585 Ga0070713_100182810
586 Ga0070711_100076507
587 Ga0070711_100515269
588 Ga0070663_100138291
589 Ga0070681_10008750
590 Ga0070693_100014229
591 Ga0070693_100078131
592 Ga0070665_100005553
593 Ga0070665_100277545
594 Ga0070704_100280567
595 Ga0068855_100087730
596 Ga0070664_100183588
597 Ga0070664_100251144
598 Ga0068857_100555869
599 Ga0068864_100421521
600 Ga0068864_100782109
601 Ga0068861_100739667
602 Ga0068863_100690499
603 Ga0068858_100012927
604 Ga0068860_100192521
605 Ga0081455_10001121
606 Ga0081455_10012359
607 Ga0081455_10070894
608 Ga0081455_10181677
609 Ga0081538_10000111
610 Ga0081538_10041253
611 Ga0081539_10017903
612 Ga0070717_10054504
613 Ga0075365_10011517
614 Ga0075365_10018775
615 Ga0075365_10050904
616 Ga0075365_10147208
617 Ga0075365_10213933
618 Ga0075363_100038987
619 Ga0075363_100075491
620 Ga0075363_100250983
621 Ga0075364_10028542
622 Ga0075364_10098719
623 Ga0075364_10214454
624 Ga0070712_100021785
625 Ga0070712_100098800
626 Ga0075362_10193240
627 Ga0075367_10016454
628 Ga0075367_10096656
629 Ga0075367_10292966
630 Ga0075367_10322464
631 Ga0075428_100001768
632 Ga0075428_100004130
633 Ga0075428_100051471
634 Ga0075428_100256025
635 Ga0075428_100568553
636 Ga0075430_100001329
637 Ga0075430_100176842
638 Ga0075430_100217720
639 Ga0075431_100004231
640 Ga0075431_100004863
641 Ga0075431_100006249
642 Ga0075431_100068315
643 Ga0075431_100088699
644 Ga0075434_100479008
645 Ga0075429_100000058
646 Ga0075429_100039381
647 Ga0075429_100072324
648 Ga0075429_100189157
649 Ga0075429_100468983
650 Ga0075435_100208379
651 Ga0105240_10593773
652 Ga0111539_10097152
653 Ga0111539_10128565
654 Ga0111539_10150920
655 Ga0111539_10252284
656 Ga0105245_10002034
657 Ga0105245_10741715
658 Ga0105247_10294589
659 Ga0114129_10000091
660 Ga0114129_10027319
661 Ga0114129_10201908
662 Ga0114129_10231820
663 Ga0114129_10731671
664 Ga0114129_11134134
665 Ga0105243_10045249
666 Ga0105242_10039532
667 Ga0105242_10095370
668 Ga0105242_10808971
669 Ga0105248_10374641
670 Ga0105238_11013087
671 Ga0105249_10923505
672 Ga0157369_10099358
673 Ga0157369_10617112
674 Ga0157374_10175180
675 Ga0157374_10307067
676 Ga0157374_10607119
677 Ga0157378_10275776
678 Ga0163162_10782474
679 Ga0163163_10881641
680 Ga0163163_10897171
681 Ga0157380_10145384
682 Ga0157377_10187959
683 Ga0157376_10336396
684 Ga0207692_10017252
685 Ga0207688_10197611
686 Ga0207707_10007153
687 Ga0207707_10019333
688 Ga0207707_10184668
689 Ga0207693_10169215
690 Ga0207693_10268275
691 Ga0207663_10099775
692 Ga0207652_10666104
693 Ga0207646_10237959
694 Ga0207681_10347188
695 Ga0207659_10209158
696 Ga0207687_10008189
697 Ga0207687_10209147
698 Ga0207700_10039414
699 Ga0207700_10299631
700 Ga0207700_10531050
701 Ga0207644_10091970
702 Ga0207644_10641312
703 Ga0207690_10031872
704 Ga0207706_10129376
705 Ga0207686_10269257
706 Ga0207665_10191009
707 Ga0207691_10219797
708 Ga0207679_10227080
709 Ga0207668_10102479
710 Ga0207640_10421945
711 Ga0207658_10822333
712 Ga0207703_10010911
713 Ga0207641_10421635
714 Ga0207676_10084023
715 Ga0207676_10289104
716 Ga0207676_10297251
717 Ga0207676_10449989
718 Ga0207675_100616949
719 Ga0207675_100925362
720 Ga0207683_10689094
721 Ga0209813_10056765
722 Ga0207428_10022161
723 Ga0207428_10114075
724 Ga0268266_10086458
725 Ga0268266_10214793
726 Ga0268266_10680697
727 Ga0268264_10159432
728 Ga0265334_10026680
729 Ga0265322_10002981
730 Ga0265338_10000149
731 Ga0265338_10091399
732 Ga0265332_10105192
733 Ga0265325_10005785
734 Ga0265329_10000870
735 Ga0265339_10006718
736 Ga0265339_10020888
737 Ga0265331_10024015
738 Ga0265327_10010207
739 Ga0265327_10015927
740 Ga0265327_10029492
741 Ga0265327_10050934
742 Ga0265327_10155171
743 Ga0265327_10163945
744 Ga0265316_10002062
745 Ga0265316_10185606
746 Ga0307408_100357837
747 Ga0265313_10005933
748 Ga0265314_10050760
749 Ga0265314_10055040
750 Ga0265342_10001527
751 Ga0316576_10001198
752 Ga0316576_10066056
753 Ga0316578_10003461
754 Ga0316578_10197997
755 Ga0316577_10055815
756 Ga0307410_10048078
757 Ga0307407_10167547
758 Ga0307409_100183391
759 Ga0307416_100437660
760 Ga0307416_100550251
761 Ga0307411_10085632
762 Ga0307415_100286029
763 Ga0307415_100308258
764 Ga0316580_10096563
765 Ga0373930_0004702
766 Ga0373948_0002487
767 Ga0373926_0030082
768 Ga0373928_0005348
769 Ga0373932_0000349
770 Ga0373945_0047393
771 Ga0373953_0006244
772 Ga0373954_0008789
773 Ga0373956_0000415
774 Ga0373946_0060572
775 Ga0373946_0237511
776 Ga0373955_0000555
777 Ga0373955_0302172
778 Ga0316574_0004863
779 Ga0316574_0011457
780 Ga0316574_0016503
781 Ga0316574_0165967
782 Ga0316574_0190076
783 Ga0373924_0005409
784 Ga0373931_0000003
785 Ga0373931_0000049
786 Ga0373931_0034375
787 Ga0373927_0142275
788 Ga0373933_0000055
789 Ga0373933_0067939
790 Ga0373947_0069805
791 Ga0373937_0000420
792 Ga0373937_0116409
793 Ga0316582_0026301
794 Ga0316582_0142223
795 Ga0316582_0180573
796 Ga0316584_0020673
797 Ga0316584_0029120
798 Ga0316584_0227434
799 Ga0373925_0013717
800 Ga0395901_0281833
801 Ga0400485_04335
802 Ga0400485_10559
803 Ga0400483_015531
804 Ga0400483_016254
805 Ga0400483_024784
806 Ga0400483_043157
807 Ga0400483_082826
808 Ga0400483_148612
809 Ga0400483_189864
810 Ga0400483_201548
811 Ga0400483_213226
812 Ga0400483_227564
813 Ga0400483_257051
814 Ga0436365_0488997
815 Ga0439436_0058766
816 Ga0439466_0074389
817 Ga0451837_1710427
818 Ga0439448_0004663
819 Ga0439432_078867
820 Ga0439450_001320
821 Ga0439452_035551
822 Ga0450902_015040
823 Ga0439434_0043289
824 Ga0439434_0045780
825 Ga0439464_0013166
826 Ga0439460_0056002
827 Ga0439440_0006850
828 Ga0466957_0272099
829 Ga0466959_0171350
830 Ga0466958_0360977
831 Ga0466967_0148910
832 Ga0466967_0771168
833 Ga0495592_0000395
834 Ga0495592_0026130
835 Ga0495592_0262956
836 Ga0495603_0017296
837 Ga0495603_0296977
838 Ga0495629_0019641
839 Ga0495629_0108513
840 Ga0495641_0065447
841 Ga0495641_0201066
842 Ga0495651_0000996
843 Ga0495651_0165192
844 Ga0495653_0000195
845 Ga0495653_0009938
846 Ga0495653_0081473
847 Ga0495653_0142647
848 Ga0495582_0019694
849 Ga0495582_0039782
850 Ga0495582_0129755
851 Ga0495639_0014891
852 Ga0495639_0076087
853 Ga0495594_0325892
854 Ga0495607_0163703
855 Ga0495608_0000085
856 Ga0495608_0039547
857 Ga0495628_0000154
858 Ga0495628_0005349
859 Ga0495628_0016727
860 Ga0495630_0001923
861 Ga0495630_0031194
862 Ga0495630_0055049
863 Ga0495652_0004085
864 Ga0495652_0382435
865 Ga0495665_0018501
866 Ga0495640_0224106
867 Ga0495587_0006926
868 Ga0495587_0092465
869 Ga0495587_0423614
870 Ga0495645_0000144
871 Ga0495667_0003612
872 Ga0495667_0038919
873 Ga0495634_0014118
874 Ga0495634_0170856
875 Ga0495635_0000253
876 Ga0495635_0207906
877 Ga0495635_0281148
878 Ga0495588_0052784
879 Ga0495657_0000210
880 Ga0495599_0000320
881 Ga0495623_0000750
882 Ga0495646_0002718
883 Ga0495658_0021085
884 Ga0495658_0022126
885 Ga0495613_0074748
886 Ga0495613_0090879
887 Ga0495613_0161319
888 Ga0495600_0000023
889 Ga0495581_0009896
890 Ga0495604_0000251
891 Ga0495674_0006496
892 Ga0495674_0148940
893 Ga0495676_0072396
894 Ga0495680_0008686
895 Ga0495680_0110668
896 Ga0495680_0217819
897 Ga0495680_0507471
898 Ga0495675_0003854
899 Ga0495675_0150633
900 Ga0495684_0000037
901 Ga0495684_0031760
902 Ga0495684_0153582
903 Ga0495593_0009152
904 Ga0495602_0002980
905 Ga0495614_0104490
906 Ga0495614_0107882
907 Ga0496101_0075798
908 Ga0496102_0182175
909 Ga0496102_0285761
910 Ga0496102_0524798
911 Ga0496104_0007380
912 Ga0496105_0002999
913 Ga0496105_0005139
914 Ga0496105_0270609
915 Ga0496106_0413126
916 Ga0496108_0086858
917 Ga0496108_0345721
918 Ga0496108_0368006
919 Ga0496109_0066405
920 Ga0496109_0066697
921 Ga0496109_0080736
922 Ga0496109_0096057
923 Ga0496109_0225432
924 Ga0496109_0532323
925 Ga0496110_0578517
926 Ga0496110_0629692
927 Ga0496112_0088634
928 Ga0496112_0251555
929 Ga0496113_0424614
930 Ga0496114_0023013
931 Ga0496114_0154302
932 Ga0496121_0217369
933 Ga0496126_0175858
934 Ga0501031_0001704
935 Ga0501031_0044182
936 Ga0501031_0063503
937 Ga0501032_0003134
938 Ga0501032_0070814
939 Ga0501032_0087851
940 Ga0501032_0110084
941 Ga0501033_0000740
942 Ga0501033_0032828
943 Ga0501033_0388488
944 Ga0501034_0008392
945 Ga0501036_0010115
946 Ga0501036_0102392
947 Ga0501036_0259314
948 Ga0501036_0366900
949 Ga0501037_0001668
950 Ga0501037_0046339
951 Ga0501037_0156008
952 Ga0501037_0167424
953 Ga0501037_0240733
954 Ga0501038_0001722
955 Ga0501038_0057296
956 Ga0501038_0059189
957 Ga0501039_0001419
958 Ga0501039_0001952
959 Ga0501039_0070044
960 Ga0501039_0074892
961 Ga0501039_0075769
962 Ga0501039_0124334
963 Ga0501039_0335146
964 Ga0501040_0002352
965 Ga0501040_0016987
966 Ga0501040_0021283
967 Ga0501040_0329112
968 Ga0501040_0461822
969 Ga0501040_0530317
970 Ga0501041_0002109
971 Ga0501041_0005129
972 Ga0501042_0013729
973 Ga0501042_0034744
974 Ga0501042_0208865
975 Ga0501042_0390577
976 Ga0501043_0014314
977 Ga0501043_0083815
978 Ga0501043_0158672
979 Ga0501043_0383863
980 Ga0501046_0009840
981 Ga0501046_0026907
982 Ga0501046_0047147
983 Ga0501046_0048554
984 Ga0501046_0051664
985 Ga0501047_0009574
986 Ga0501047_0219908
987 Ga0501047_0307260
988 Ga0501048_0000600
989 Ga0501048_0006028
990 Ga0501048_0043666
991 Ga0501048_0170326
992 Ga0501067_0063967
993 Ga0501068_0000164
994 Ga0501068_0018846
995 Ga0501068_0046798
996 Ga0501069_0001031
997 Ga0501069_0065994
998 Ga0501070_0000016
999 Ga0501070_0007132
1000 Ga0501070_0012694
1001 Ga0501070_0014130
1002 Ga0501070_0063708
1003 Ga0501070_0082568
1004 Ga0501070_0093777
1005 Ga0501070_0119551
1006 Ga0501070_0303527
1007 Ga0501071_0001441
1008 Ga0501071_0009693
1009 Ga0501071_0014578
1010 Ga0501071_0041812
1011 Ga0501071_0100488
1012 Ga0501071_0105268
1013 Ga0501071_0196353
1014 Ga0501071_0503439
1015 Ga0501072_0001416
1016 Ga0501072_0021865
1017 Ga0501072_0067928
1018 Ga0501072_0098333
1019 Ga0501072_0102357
1020 Ga0501072_0162635
1021 Ga0501072_0315251
1022 Ga0501073_0002863
1023 Ga0501073_0008935
1024 Ga0501073_0015432
1025 Ga0501073_0159202
1026 Ga0501073_0285703
1027 Ga0501074_0001548
1028 Ga0501074_0073945
1029 Ga0501074_0355721
1030 Ga0501075_0001758
1031 Ga0501075_0002131
1032 Ga0501075_0002498
1033 Ga0501075_0024112
1034 Ga0501075_0032468
1035 Ga0501075_0083213
1036 Ga0501076_0005558
1037 Ga0501076_0013246
1038 Ga0501076_0046251
1039 Ga0501076_0183507
1040 Ga0501076_0246838
1041 Ga0501076_0462728
1042 Ga0501076_0586752
1043 Ga0501077_0004094
1044 Ga0501077_0012700
1045 Ga0501077_0024084
1046 Ga0501077_0225246
1047 Ga0501077_0273919
1048 Ga0501079_0020900
1049 Ga0501079_0054085
1050 Ga0501079_0077729
1051 Ga0501079_0098712
1052 Ga0501080_0001813
1053 Ga0501080_0022918
1054 Ga0501080_0038612
1055 Ga0501080_0072889
1056 Ga0501080_0083732
1057 Ga0501080_0175600
1058 Ga0501080_0187503
1059 Ga0501080_0247828
1060 Ga0501081_0001943
1061 Ga0501081_0012301
1062 Ga0501081_0042036
1063 Ga0501081_0112031
1064 Ga0501081_0169996
1065 Ga0501081_0302585
1066 Ga0501081_0310528
1067 Ga0501083_0010339
1068 Ga0501083_0014676
1069 Ga0501083_0050616
1070 Ga0501035_0042412
1071 Ga0501044_0010877
1072 Ga0501044_0055758
1073 Ga0501045_0007031
1074 Ga0501045_0020281
1075 Ga0501045_0043098
1076 Ga0501045_0200523
1077 Ga0501045_0205070
1078 nmdc:mga03683_17374_c1
1079 nmdc:mga03n38_36517_c1
1080 nmdc:mga00v17_61031_c1
1081 nmdc:mga0yw44_143780_c1
1082 nmdc:mga0yw44_168767_c1
1083 nmdc:mga0yw44_17475_c1
1084 nmdc:mga0yw44_620_c1
1085 nmdc:mga0yw44_81580_c1
1086 nmdc:mga0yw44_83344_c1
1087 nmdc:mga06z11_18040_c1
1088 nmdc:mga06z11_6929_c2
1089 nmdc:mga04h51_66290_c1
1090 nmdc:mga05p37_103430_c1
1091 nmdc:mga05p37_160382_c1
1092 nmdc:mga05p37_262225_c1
1093 nmdc:mga05p37_272_c1
1094 nmdc:mga05p37_458086_c1
1095 nmdc:mga05p37_85299_c1
1096 nmdc:mga09592_13294_c1
1097 nmdc:mga09592_198119_c1
1098 nmdc:mga09592_2100_c1
1099 nmdc:mga09592_36127_c1
1100 nmdc:mga0qj67_21411_c1
1101 nmdc:mga0qj67_360751_c1
1102 nmdc:mga0qj67_365041_c1
1103 nmdc:mga0qj67_4702_c1
1104 nmdc:mga06r32_120291_c1
1105 nmdc:mga06r32_1865_c1
1106 nmdc:mga06r32_54414_c1
1107 nmdc:mga06r32_797001_c1
1108 nmdc:mga06r32_8234_c1
1109 nmdc:mga08y16_10919_c1
1110 nmdc:mga08y16_134673_c1
1111 nmdc:mga08y16_37828_c1
1112 nmdc:mga0n895_1016500_c1
1113 nmdc:mga0n895_210606_c1
1114 nmdc:mga0n895_462744_c1
1115 nmdc:mga0a205_584491_c1
1116 Ga0495601_0004505
1117 Ga0495601_0429702
1118 Ga0495595_0006629
1119 Ga0495595_0057841
1120 Ga0495619_0017385
1121 Ga0495619_0025817
1122 Ga0495619_0055580
1123 Ga0495619_0093061
1124 Ga0495619_0104740
1125 Ga0495619_0374805
1126 Ga0500566_0000115
1127 Ga0500566_0285923
1128 Ga0500616_0007770
1129 Ga0501084_0000435
1130 Ga0501084_0003388
1131 Ga0501084_0127344
1132 Ga0501084_0261972
1133 Ga0501084_0439701
1134 Ga0501082_0004567
1135 Ga0501082_0020500
1136 Ga0501082_0021269
1137 Ga0501082_0068657
1138 Ga0501082_0203663
1139 Ga0501082_0302805
1140 Ga0501082_0330634
1141 Ga0501082_0389947
1142 Ga0501082_0489256
1143 Ga0530510_0002849
1144 Ga0530510_0010013
1145 Ga0530510_0027997
1146 Ga0530510_0039364
1147 Ga0530510_0047625
1148 Ga0530510_0308731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

175

198

0.89

PF12837

Fer4_6

4Fe-4S binding domain

175

199

0.89

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

26

145

0.89

PF13237

Fer4_10

4Fe-4S dicluster domain

175

247

0.79

PF13183

Fer4_8

4Fe-4S dicluster domain

178

250

0.73

PF12838

Fer4_7

4Fe-4S dicluster domain

181

250

0.69

PF13534

Fer4_17

4Fe-4S dicluster domain

181

251

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c3j-assembly1.cif.gz_B crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1 0.6817 2 241
6bva-assembly1.cif.gz_B ubiquitin variant (ubv.fl10.1) bound to a human skp1-fbl10 fragment complex. 0.6814 1 99
1yq3-assembly1.cif.gz_B avian respiratory complex ii with oxaloacetate and ubiquinone 0.6766 2 237
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.673 1 244
3abv-assembly1.cif.gz_B crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide 0.6643 2 237
ID Description Score Start End Superfamily
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8456 2 116 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8229 2 116 3.10.20.30
af_Q2FZC7_12_128_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7964 2 116 3.10.20.30
af_Q4DKU9_58_161_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7656 2 112 3.10.20.30
5xmjN01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7412 2 116 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A0F4IVH1-F1-model_v4 Succinate dehydrogenase 0.9502 1 50
AF-A0A7W1CRU6-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9431 1 114 GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A0C2Q2D4-F1-model_v4 deleted 0.9421 1 113
AF-A0A7V5RN34-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9378 1 57
AF-A0A257V1R0-F1-model_v4 Succinate dehydogenase/fumarate reductase N-terminal domain-containing protein 0.9358 1 116 GO:0009055
GO:0009060
GO:0022904
GO:0051537

Map