F465293

General Info

Members Datasets Scaffolds Average Seq Length
574 294 574 137

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10012290|Ga0081538_100122902
Length 137
Sequence MDITIHASFLPHDDPDASLAFYRDILGFEVRGDVGNGKMRWITVGPPDQPDTSIVLEPXXXXGTGITDEERRTIAEMMAKGTYGFINLATKNLDGTFEQLQASDAEVVQEPTDQPYGIRDCAFRDPAGNLIRIQELR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.85
Nodule 0
Rhizoplane 6.45
Rhizosphere 79.62
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1005511 3300001977 Bacteria 1973
2 JGI24739J22299_10031098 3300001989 Bacteria 1847
3 JGI24737J22298_10055191 3300001990 Bacteria 1201
4 JGI24737J22298_10094541 3300001990 Bacteria 886
5 JGI24737J22298_10172141 3300001990 Bacteria 639
6 JGI24743J22301_10006415 3300001991 Bacteria 2005
7 JGI24745J21846_1003847 3300002073 Bacteria 1586
8 JGI24738J21930_10011625 3300002075 Bacteria 1932
9 JGI24744J21845_10007872 3300002077 Bacteria 2201
10 JGI24742J22300_10005704 3300002244 Bacteria 2048
11 JGI25156J39149_1027211 3300002705 Bacteria 896
12 JGI25154J39366_1028162 3300002738 Bacteria 502
13 JGI25157J39369_1007493 3300002741 Bacteria 1573
14 JGI25406J46586_10009256 3300003203 Bacteria 4415
15 JGI25407J50210_10038829 3300003373 Bacteria 1222
16 Ga0055527_1000071 3300003760 Bacteria 84489
17 Ga0055535_1000213 3300003761 Bacteria 61546
18 Ga0055542_1000161 3300003762 Bacteria 84490
19 Ga0055529_1000272 3300003763 Bacteria 61544
20 Ga0070658_10619519 3300005327 Bacteria 938
21 Ga0070676_10028008 3300005328 Bacteria 3199
22 Ga0070683_100032193 3300005329 Bacteria 4774
23 Ga0070683_101583279 3300005329 Bacteria 630
24 Ga0068869_100036967 3300005334 Bacteria 3470
25 Ga0070666_10002633 3300005335 Bacteria 10846
26 Ga0070680_100201705 3300005336 Bacteria 1678
27 Ga0070682_100016612 3300005337 Bacteria 4283
28 Ga0070682_100025176 3300005337 Bacteria 3549
29 Ga0070682_100418537 3300005337 Bacteria 1018
30 Ga0068868_100002656 3300005338 Bacteria 12403
31 Ga0068868_100634853 3300005338 Bacteria 949
32 Ga0070660_100060619 3300005339 Bacteria 2937
33 Ga0070660_100328157 3300005339 Bacteria 1258
34 Ga0070689_100016638 3300005340 Bacteria 5383
35 Ga0070691_10134204 3300005341 Bacteria 1256
36 Ga0070691_10274115 3300005341 Bacteria 913
37 Ga0070661_100085923 3300005344 Bacteria 2325
38 Ga0070668_100000347 3300005347 Bacteria 30543
39 Ga0070668_100001780 3300005347 Bacteria 15656
40 Ga0070668_100127838 3300005347 Bacteria 2037
41 Ga0070669_100039437 3300005353 Bacteria 3432
42 Ga0070675_100317031 3300005354 Bacteria 1377
43 Ga0070671_100029440 3300005355 Bacteria 4528
44 Ga0070674_100003233 3300005356 Bacteria 9094
45 Ga0070674_100514865 3300005356 Bacteria 999
46 Ga0070673_100090673 3300005364 Bacteria 2497
47 Ga0070688_100004005 3300005365 Bacteria 7639
48 Ga0070688_100031996 3300005365 Bacteria 3168
49 Ga0070659_100352474 3300005366 Bacteria 1235
50 Ga0070659_100373836 3300005366 Bacteria 1199
51 Ga0070659_100517068 3300005366 Bacteria 1019
52 Ga0070667_100005709 3300005367 Bacteria 10397
53 Ga0070667_100407087 3300005367 Bacteria 1239
54 Ga0070709_10004024 3300005434 Bacteria 7930
55 Ga0070714_100976032 3300005435 Bacteria 824
56 Ga0070710_10025644 3300005437 Bacteria 3123
57 Ga0070701_10002486 3300005438 Bacteria 7121
58 Ga0070701_10238996 3300005438 Bacteria 1092
59 Ga0070711_100000402 3300005439 Bacteria 22353
60 Ga0070711_100000860 3300005439 Bacteria 15973
61 Ga0070705_100031929 3300005440 Bacteria 2921
62 Ga0070705_100115944 3300005440 Bacteria 1721
63 Ga0070700_100005259 3300005441 Bacteria 6845
64 Ga0070694_100004412 3300005444 Bacteria 8459
65 Ga0070694_100305386 3300005444 Bacteria 1220
66 Ga0070708_101360309 3300005445 Bacteria 663
67 Ga0070663_100069326 3300005455 Bacteria 2561
68 Ga0070663_100182113 3300005455 Bacteria 1630
69 Ga0070678_100000273 3300005456 Bacteria 23976
70 Ga0070678_100026963 3300005456 Bacteria 3893
71 Ga0070662_100098007 3300005457 Bacteria 2213
72 Ga0070662_100182676 3300005457 Bacteria 1654
73 Ga0070662_100386958 3300005457 Bacteria 1152
74 Ga0068867_100002987 3300005459 Bacteria 11917
75 Ga0068867_100410188 3300005459 Bacteria 1145
76 Ga0070685_10026763 3300005466 Bacteria 3181
77 Ga0070707_100602719 3300005468 Bacteria 1061
78 Ga0070679_100653536 3300005530 Bacteria 994
79 Ga0070684_100026869 3300005535 Bacteria 4852
80 Ga0070697_100688219 3300005536 Bacteria 902
81 Ga0068853_100002811 3300005539 Bacteria 13177
82 Ga0068853_100510569 3300005539 Bacteria 1136
83 Ga0068853_100546987 3300005539 Bacteria 1096
84 Ga0070686_100331292 3300005544 Bacteria 1138
85 Ga0070695_100008824 3300005545 Bacteria 5990
86 Ga0070695_100114250 3300005545 Bacteria 1838
87 Ga0070696_100000796 3300005546 Bacteria 20313
88 Ga0070696_100174628 3300005546 Bacteria 1591
89 Ga0070693_100007039 3300005547 Bacteria 5478
90 Ga0070693_100818455 3300005547 Bacteria 692
91 Ga0070665_100000821 3300005548 Bacteria 40648
92 Ga0070665_100005361 3300005548 Bacteria 13239
93 Ga0070665_100049345 3300005548 Bacteria 4224
94 Ga0070704_100032789 3300005549 Bacteria 3507
95 Ga0070704_100069505 3300005549 Bacteria 2551
96 Ga0068855_100369885 3300005563 Bacteria 1576
97 Ga0068857_100008819 3300005577 Bacteria 8735
98 Ga0068854_100101132 3300005578 Bacteria 2161
99 Ga0068854_100297695 3300005578 Bacteria 1304
100 Ga0068856_100150028 3300005614 Bacteria 2340
101 Ga0070702_100007930 3300005615 Bacteria 5114
102 Ga0070702_100658501 3300005615 Bacteria 793
103 Ga0068852_100692397 3300005616 Bacteria 1029
104 Ga0068859_100005745 3300005617 Bacteria 12616
105 Ga0068864_100236513 3300005618 Bacteria 1691
106 Ga0068866_10000419 3300005718 Bacteria 19721
107 Ga0068866_10148991 3300005718 Bacteria 1352
108 Ga0068866_10259538 3300005718 Bacteria 1067
109 Ga0068861_100301020 3300005719 Bacteria 1389
110 Ga0068870_10663283 3300005840 Bacteria 716
111 Ga0068863_100048870 3300005841 Bacteria 4011
112 Ga0068863_100567042 3300005841 Bacteria 1122
113 Ga0068858_100022886 3300005842 Bacteria 5829
114 Ga0068858_100050241 3300005842 Bacteria 3859
115 Ga0068860_100000035 3300005843 Bacteria 238993
116 Ga0068860_100000775 3300005843 Bacteria 35961
117 Ga0068860_100498305 3300005843 Bacteria 1216
118 Ga0068862_100005734 3300005844 Bacteria 10366
119 Ga0068862_100199094 3300005844 Bacteria 1805
120 Ga0081455_10011687 3300005937 Bacteria 8804
121 Ga0081455_10077189 3300005937 Bacteria 2741
122 Ga0081455_10185414 3300005937 Bacteria 1572
123 Ga0081538_10004521 3300005981 Bacteria 12805
124 Ga0081538_10012290 3300005981 Bacteria 6873
125 Ga0081538_10031865 3300005981 Bacteria 3546
126 Ga0081539_10003298 3300005985 Bacteria 20193
127 Ga0070717_10234650 3300006028 Bacteria 1616
128 Ga0075365_10049058 3300006038 Bacteria 2780
129 Ga0075365_10077920 3300006038 Bacteria 2240
130 Ga0075365_10265683 3300006038 Bacteria 1207
131 Ga0075365_10314292 3300006038 Bacteria 1103
132 Ga0075368_10090096 3300006042 Bacteria 1254
133 Ga0075363_100002031 3300006048 Bacteria 8070
134 Ga0075363_100013855 3300006048 Bacteria 3924
135 Ga0075363_100022561 3300006048 Bacteria 3183
136 Ga0075363_100023916 3300006048 Bacteria 3102
137 Ga0075363_100089770 3300006048 Bacteria 1690
138 Ga0075363_100093897 3300006048 Bacteria 1654
139 Ga0075364_10000303 3300006051 Bacteria 24056
140 Ga0075364_10011745 3300006051 Bacteria 5331
141 Ga0075364_10040679 3300006051 Bacteria 3015
142 Ga0075364_10084199 3300006051 Bacteria 2105
143 Ga0070716_100000471 3300006173 Bacteria 16672
144 Ga0070716_100017054 3300006173 Bacteria 3758
145 Ga0070712_100115385 3300006175 Bacteria 2012
146 Ga0070712_100212556 3300006175 Bacteria 1526
147 Ga0075362_10011769 3300006177 Bacteria 3454
148 Ga0075362_10060613 3300006177 Bacteria 1711
149 Ga0075369_10000129 3300006186 Bacteria 20893
150 Ga0075369_10242427 3300006186 Bacteria 836
151 Ga0075369_10256598 3300006186 Bacteria 812
152 Ga0075369_10286283 3300006186 Bacteria 768
153 Ga0097621_100033270 3300006237 Bacteria 4104
154 Ga0097621_100704384 3300006237 Bacteria 930
155 Ga0075370_10180480 3300006353 Bacteria 1242
156 Ga0075370_10372709 3300006353 Bacteria 855
157 Ga0068865_100004325 3300006881 Bacteria 8577
158 Ga0068865_100065650 3300006881 Bacteria 2558
159 Ga0068865_100505892 3300006881 Bacteria 1008
160 Ga0097620_100005745 3300006931 Bacteria 12616
161 Ga0105250_10452626 3300009092 Bacteria 576
162 Ga0105240_10593424 3300009093 Bacteria 1220
163 Ga0105245_10032532 3300009098 Bacteria 4617
164 Ga0105245_10037427 3300009098 Bacteria 4314
165 Ga0105247_10003162 3300009101 Bacteria 10855
166 Ga0105247_10120331 3300009101 Bacteria 1700
167 Ga0105247_10804061 3300009101 Bacteria 718
168 Ga0114129_10306156 3300009147 Bacteria 2116
169 Ga0105243_10001826 3300009148 Bacteria 18210
170 Ga0105243_10547090 3300009148 Bacteria 1105
171 Ga0105241_10059209 3300009174 Bacteria 2944
172 Ga0105241_10076888 3300009174 Bacteria 2604
173 Ga0105241_11566785 3300009174 Bacteria 636
174 Ga0105242_10000459 3300009176 Bacteria 32413
175 Ga0105242_10023936 3300009176 Bacteria 4819
176 Ga0105242_10841038 3300009176 Bacteria 912
177 Ga0105248_10003999 3300009177 Bacteria 16302
178 Ga0105248_10275424 3300009177 Bacteria 1895
179 Ga0105237_10108924 3300009545 Bacteria 2761
180 Ga0105237_10447552 3300009545 Bacteria 1297
181 Ga0105238_10091684 3300009551 Bacteria 3026
182 Ga0105238_10262247 3300009551 Bacteria 1707
183 Ga0105249_10006558 3300009553 Bacteria 10127
184 Ga0105249_10083288 3300009553 Bacteria 2977
185 Ga0105249_10367509 3300009553 Bacteria 1461
186 Ga0105249_10642350 3300009553 Bacteria 1118
187 Ga0105249_10866566 3300009553 Bacteria 969
188 Ga0105239_10012460 3300010375 Bacteria 9470
189 Ga0105239_10416493 3300010375 Bacteria 1521
190 Ga0105239_10571827 3300010375 Bacteria 1288
191 Ga0105239_10810185 3300010375 Bacteria 1073
192 Ga0105239_11461457 3300010375 Bacteria 790
193 Ga0105246_10002382 3300011119 Bacteria 11342
194 Ga0105246_10321670 3300011119 Bacteria 1257
195 Ga0157371_10647766 3300013102 Bacteria 788
196 Ga0157369_10019113 3300013105 Bacteria 7669
197 Ga0157369_10140861 3300013105 Bacteria 2552
198 Ga0157369_10531931 3300013105 Bacteria 1215
199 Ga0157369_11669617 3300013105 Bacteria 647
200 Ga0157374_10013307 3300013296 Bacteria 7179
201 Ga0157374_10252377 3300013296 Bacteria 1736
202 Ga0157378_10003979 3300013297 Bacteria 13058
203 Ga0157378_10170604 3300013297 Bacteria 2040
204 Ga0157378_12953374 3300013297 Bacteria 527
205 Ga0163162_10006338 3300013306 Bacteria 11457
206 Ga0163162_10240440 3300013306 Bacteria 1941
207 Ga0157372_10109161 3300013307 Bacteria 3168
208 Ga0157372_10239765 3300013307 Bacteria 2104
209 Ga0157372_10829356 3300013307 Bacteria 1074
210 Ga0157372_12365335 3300013307 Bacteria 610
211 Ga0157375_10009568 3300013308 Bacteria 8510
212 Ga0157375_10209038 3300013308 Bacteria 2108
213 Ga0163163_10088004 3300014325 Bacteria 3117
214 Ga0157380_10001560 3300014326 Bacteria 15073
215 Ga0157380_10407507 3300014326 Bacteria 1292
216 Ga0157377_10068682 3300014745 Bacteria 2043
217 Ga0157377_10086101 3300014745 Bacteria 1846
218 Ga0157377_10130474 3300014745 Bacteria 1534
219 Ga0157379_10013893 3300014968 Bacteria 7057
220 Ga0157379_10017352 3300014968 Bacteria 6342
221 Ga0157379_10033521 3300014968 Bacteria 4579
222 Ga0157376_10446008 3300014969 Bacteria 1261
223 Ga0163161_10003090 3300017792 Bacteria 11750
224 Ga0163161_10595014 3300017792 Bacteria 911
225 Ga0163161_10849656 3300017792 Bacteria 770
226 Ga0197907_10828368 3300020069 Bacteria 1799
227 Ga0213873_10037562 3300021358 Bacteria 1234
228 Ga0213875_10065288 3300021388 Bacteria 1701
229 Ga0224712_10075666 3300022467 Bacteria 1378
230 Ga0209672_100004 3300025228 Bacteria 1467504
231 Ga0209563_100028 3300025230 Bacteria 509539
232 Ga0209258_100003 3300025242 Bacteria 1467504
233 Ga0209646_1003803 3300025246 Bacteria 2885
234 Ga0209026_1000281 3300025250 Bacteria 58797
235 Ga0209148_1000016 3300025254 Bacteria 804369
236 Ga0209759_1008527 3300025256 Bacteria 3184
237 Ga0209455_1000004 3300025272 Bacteria 1467504
238 Ga0207642_10004024 3300025899 Bacteria 4702
239 Ga0207642_10085089 3300025899 Bacteria 1547
240 Ga0207642_10278779 3300025899 Bacteria 961
241 Ga0207710_10004040 3300025900 Bacteria 6454
242 Ga0207688_10010768 3300025901 Bacteria 4977
243 Ga0207680_10003070 3300025903 Bacteria 7838
244 Ga0207680_10010590 3300025903 Bacteria 4619
245 Ga0207647_10066300 3300025904 Bacteria 2189
246 Ga0207647_10080074 3300025904 Bacteria 1960
247 Ga0207647_10248643 3300025904 Bacteria 1020
248 Ga0207685_10001517 3300025905 Bacteria 4910
249 Ga0207699_10014305 3300025906 Bacteria 4087
250 Ga0207645_10038444 3300025907 Bacteria 3069
251 Ga0207645_10166126 3300025907 Bacteria 1445
252 Ga0207705_10765082 3300025909 Bacteria 750
253 Ga0207654_10139797 3300025911 Bacteria 1543
254 Ga0207654_10209233 3300025911 Bacteria 1288
255 Ga0207654_10709275 3300025911 Bacteria 723
256 Ga0207671_10410821 3300025914 Bacteria 1077
257 Ga0207671_10478155 3300025914 Bacteria 993
258 Ga0207671_10979625 3300025914 Bacteria 667
259 Ga0207693_10000381 3300025915 Bacteria 40785
260 Ga0207693_10001414 3300025915 Bacteria 21264
261 Ga0207663_10004663 3300025916 Bacteria 6840
262 Ga0207663_10324343 3300025916 Bacteria 1158
263 Ga0207663_10505795 3300025916 Bacteria 939
264 Ga0207660_10125433 3300025917 Bacteria 1949
265 Ga0207662_10089950 3300025918 Bacteria 1887
266 Ga0207657_10225338 3300025919 Bacteria 1501
267 Ga0207657_10605984 3300025919 Bacteria 854
268 Ga0207652_10361109 3300025921 Bacteria 1311
269 Ga0207652_10551588 3300025921 Bacteria 1036
270 Ga0207681_10112725 3300025923 Bacteria 1981
271 Ga0207681_10156179 3300025923 Bacteria 1715
272 Ga0207694_10099044 3300025924 Bacteria 2309
273 Ga0207694_10305147 3300025924 Bacteria 1311
274 Ga0207687_10000587 3300025927 Bacteria 24594
275 Ga0207687_10530327 3300025927 Bacteria 986
276 Ga0207664_10190289 3300025929 Bacteria 1766
277 Ga0207664_11069970 3300025929 Bacteria 722
278 Ga0207644_10308513 3300025931 Bacteria 1277
279 Ga0207690_10532665 3300025932 Bacteria 953
280 Ga0207690_10707389 3300025932 Bacteria 829
281 Ga0207706_10046021 3300025933 Bacteria 3864
282 Ga0207686_10015983 3300025934 Bacteria 4206
283 Ga0207709_10028683 3300025935 Bacteria 3220
284 Ga0207709_10210212 3300025935 Bacteria 1396
285 Ga0207670_10006540 3300025936 Bacteria 6470
286 Ga0207669_10001288 3300025937 Bacteria 10653
287 Ga0207704_10001708 3300025938 Bacteria 9820
288 Ga0207704_10055306 3300025938 Bacteria 2425
289 Ga0207704_10341437 3300025938 Bacteria 1162
290 Ga0207665_10021570 3300025939 Bacteria 4236
291 Ga0207665_10134296 3300025939 Bacteria 1759
292 Ga0207711_10029205 3300025941 Bacteria 4647
293 Ga0207711_10115504 3300025941 Bacteria 2392
294 Ga0207689_10016281 3300025942 Bacteria 6298
295 Ga0207689_10017429 3300025942 Bacteria 6077
296 Ga0207689_10474131 3300025942 Bacteria 1047
297 Ga0207661_10231513 3300025944 Bacteria 1636
298 Ga0207661_11814922 3300025944 Bacteria 555
299 Ga0207679_10804914 3300025945 Bacteria 857
300 Ga0207679_10986905 3300025945 Bacteria 772
301 Ga0207667_10363536 3300025949 Bacteria 1476
302 Ga0207651_10485760 3300025960 Bacteria 1065
303 Ga0207712_10033254 3300025961 Bacteria 3484
304 Ga0207712_10264942 3300025961 Bacteria 1395
305 Ga0207712_10361870 3300025961 Bacteria 1209
306 Ga0207712_10911101 3300025961 Bacteria 777
307 Ga0207712_11002999 3300025961 Bacteria 741
308 Ga0207668_10004077 3300025972 Bacteria 8587
309 Ga0207668_10007345 3300025972 Bacteria 6549
310 Ga0207668_11367761 3300025972 Bacteria 638
311 Ga0207640_10013690 3300025981 Bacteria 4654
312 Ga0207640_10274045 3300025981 Bacteria 1322
313 Ga0207640_10508933 3300025981 Bacteria 1004
314 Ga0207640_10848419 3300025981 Bacteria 795
315 Ga0207658_10017204 3300025986 Bacteria 4981
316 Ga0207677_10310657 3300026023 Bacteria 1306
317 Ga0207677_10690804 3300026023 Bacteria 904
318 Ga0207703_10039188 3300026035 Bacteria 3786
319 Ga0207703_10056148 3300026035 Bacteria 3206
320 Ga0207703_10385246 3300026035 Bacteria 1298
321 Ga0207639_10018307 3300026041 Bacteria 4977
322 Ga0207639_10133457 3300026041 Bacteria 2059
323 Ga0207678_10004848 3300026067 Bacteria 12086
324 Ga0207678_10093791 3300026067 Bacteria 2564
325 Ga0207708_10018949 3300026075 Bacteria 5183
326 Ga0207708_10176416 3300026075 Bacteria 1695
327 Ga0207702_10052727 3300026078 Bacteria 3443
328 Ga0207702_10377407 3300026078 Bacteria 1363
329 Ga0207641_10012729 3300026088 Bacteria 6897
330 Ga0207641_10464498 3300026088 Bacteria 1225
331 Ga0207648_10000462 3300026089 Bacteria 45206
332 Ga0207648_10073136 3300026089 Bacteria 2988
333 Ga0207676_10127111 3300026095 Bacteria 2161
334 Ga0207676_10526579 3300026095 Bacteria 1126
335 Ga0207674_10014897 3300026116 Bacteria 8573
336 Ga0207675_100000768 3300026118 Bacteria 31981
337 Ga0207675_100266320 3300026118 Bacteria 1662
338 Ga0207675_100447979 3300026118 Bacteria 1279
339 Ga0207683_10000575 3300026121 Bacteria 33996
340 Ga0207683_10150507 3300026121 Bacteria 2100
341 Ga0207698_10067881 3300026142 Bacteria 2814
342 Ga0207698_10967468 3300026142 Bacteria 861
343 Ga0268266_10003777 3300028379 Bacteria 14835
344 Ga0268266_10084714 3300028379 Bacteria 2768
345 Ga0268265_10014518 3300028380 Bacteria 5369
346 Ga0268265_10692889 3300028380 Bacteria 983
347 Ga0268264_10000031 3300028381 Bacteria 409525
348 Ga0268264_10004232 3300028381 Bacteria 12249
349 Ga0268264_10420373 3300028381 Bacteria 1289
350 Ga0268264_12157866 3300028381 Bacteria 565
351 Ga0265338_10027056 3300028800 Bacteria 5765
352 Ga0265327_10010227 3300031251 Bacteria 6627
353 Ga0307409_100604709 3300031995 Bacteria 1084
354 Ga0373949_0076523 3300035090 Bacteria 885
355 Ga0373949_0173788 3300035090 Bacteria 634
356 Ga0373923_0022109 3300035111 Bacteria 2490
357 Ga0373960_0356500 3300035121 Bacteria 556
358 Ga0373935_1288236 3300035692 Bacteria 545
359 Ga0436364_0332337 3300037853 Bacteria 1098
360 Ga0436364_0406475 3300037853 Bacteria 2798
361 Ga0436364_1019987 3300037853 Bacteria 1980
362 Ga0436362_0337613 3300039453 Bacteria 1541
363 Ga0451797_0578190 3300041453 Bacteria 1421
364 Ga0451807_2424073 3300041486 Bacteria 642
365 Ga0451843_0327092 3300041509 Bacteria 981
366 Ga0451853_2158879 3300041512 Bacteria 1305
367 Ga0466969_0065346 3300044656 Bacteria 1759
368 Ga0466969_0085665 3300044656 Bacteria 1498
369 Ga0466969_0099441 3300044656 Bacteria 1371
370 Ga0466972_0012804 3300044658 Bacteria 4212
371 Ga0466972_0016581 3300044658 Bacteria 3683
372 Ga0466972_0056586 3300044658 Bacteria 1886
373 Ga0466965_0000685 3300044683 Bacteria 12514
374 Ga0466965_0051130 3300044683 Bacteria 2050
375 Ga0466965_0407571 3300044683 Bacteria 752
376 Ga0466965_0519921 3300044683 Bacteria 669
377 Ga0466966_0013868 3300044684 Bacteria 5334
378 Ga0466966_0058391 3300044684 Bacteria 2438
379 Ga0466966_0067623 3300044684 Bacteria 2244
380 Ga0466966_0159544 3300044684 Bacteria 1373
381 Ga0466966_0196883 3300044684 Bacteria 1220
382 Ga0466961_0005936 3300044693 Bacteria 7741
383 Ga0466961_0054471 3300044693 Bacteria 2551
384 Ga0466961_0101936 3300044693 Bacteria 1808
385 Ga0466961_0142303 3300044693 Bacteria 1501
386 Ga0466961_0470870 3300044693 Bacteria 760
387 Ga0466963_0059216 3300044694 Bacteria 2556
388 Ga0466963_0107554 3300044694 Bacteria 1913
389 Ga0466963_0497531 3300044694 Bacteria 861
390 Ga0466963_0592075 3300044694 Bacteria 783
391 Ga0466964_0052557 3300044706 Bacteria 1675
392 Ga0466964_0086649 3300044706 Bacteria 1355
393 Ga0466964_0141666 3300044706 Bacteria 1106
394 Ga0466964_0202030 3300044706 Bacteria 955
395 Ga0466971_0024229 3300044719 Bacteria 2708
396 Ga0466971_0620940 3300044719 Bacteria 540
397 Ga0466968_0000928 3300044735 Bacteria 10322
398 Ga0466968_0260617 3300044735 Bacteria 825
399 Ga0466970_0077642 3300044765 Bacteria 1790
400 Ga0466970_0089151 3300044765 Bacteria 1673
401 Ga0466970_0157229 3300044765 Bacteria 1256
402 Ga0466970_0372336 3300044765 Bacteria 812
403 Ga0466970_0524568 3300044765 Bacteria 683
404 Ga0466957_0006881 3300044842 Bacteria 6425
405 Ga0466957_0065269 3300044842 Bacteria 2241
406 Ga0466957_0297004 3300044842 Bacteria 1084
407 Ga0466960_0108912 3300044901 Bacteria 1436
408 Ga0466960_0300440 3300044901 Bacteria 904
409 Ga0466960_0338013 3300044901 Bacteria 856
410 Ga0466959_0020726 3300045049 Bacteria 4844
411 Ga0466959_0032197 3300045049 Bacteria 3881
412 Ga0466959_0199351 3300045049 Bacteria 1394
413 Ga0466959_0302738 3300045049 Bacteria 1094
414 Ga0466959_0322550 3300045049 Bacteria 1056
415 Ga0466959_0459689 3300045049 Bacteria 862
416 Ga0466959_0527514 3300045049 Bacteria 797
417 Ga0451576_0250245 3300045051 Bacteria 1852
418 Ga0466958_0003414 3300045836 Bacteria 8245
419 Ga0466958_0006577 3300045836 Bacteria 6336
420 Ga0466958_0037102 3300045836 Bacteria 2919
421 Ga0466958_0095622 3300045836 Bacteria 1842
422 Ga0466958_0309393 3300045836 Bacteria 1015
423 Ga0466958_0326190 3300045836 Bacteria 987
424 Ga0466958_0459081 3300045836 Bacteria 825
425 Ga0466967_0007720 3300045976 Bacteria 7798
426 Ga0466967_0028377 3300045976 Bacteria 4672
427 Ga0466967_0089596 3300045976 Bacteria 2793
428 Ga0466967_0126986 3300045976 Bacteria 2363
429 Ga0466967_0262998 3300045976 Bacteria 1651
430 Ga0466967_0263007 3300045976 Bacteria 1651
431 Ga0466967_0464415 3300045976 Bacteria 1238
432 Ga0495638_0000563 3300046460 Bacteria 42248
433 Ga0495641_0121577 3300046461 Bacteria 1165
434 Ga0495582_0614298 3300046473 Bacteria 629
435 Ga0495639_0111775 3300046475 Bacteria 1297
436 Ga0495585_0120502 3300046492 Bacteria 1388
437 Ga0495608_0285103 3300046511 Bacteria 1024
438 Ga0495666_0095129 3300046526 Bacteria 1405
439 Ga0495652_0711185 3300046529 Bacteria 675
440 Ga0495665_0486225 3300046531 Bacteria 622
441 Ga0495640_0044374 3300046533 Bacteria 3091
442 Ga0495640_0461776 3300046533 Bacteria 775
443 Ga0495634_0091948 3300046642 Bacteria 1969
444 Ga0495611_0424511 3300046648 Bacteria 607
445 Ga0495625_0148674 3300046660 Bacteria 1576
446 Ga0495625_0534438 3300046660 Bacteria 712
447 Ga0495635_0457265 3300046663 Bacteria 843
448 Ga0495657_0350130 3300046675 Bacteria 874
449 Ga0495658_0188015 3300046683 Bacteria 1283
450 Ga0495613_0527106 3300046689 Bacteria 793
451 Ga0495649_0201929 3300046694 Bacteria 1032
452 Ga0495649_0415441 3300046694 Bacteria 674
453 Ga0495674_0514288 3300047319 Bacteria 956
454 Ga0495676_0648472 3300047321 Bacteria 685
455 Ga0495680_0072616 3300047322 Bacteria 2617
456 Ga0495593_0030322 3300047673 Bacteria 2960
457 Ga0495626_0267001 3300048091 Bacteria 683
458 Ga0496100_0007272 3300048903 Bacteria 6091
459 Ga0496100_0480218 3300048903 Bacteria 956
460 Ga0496101_0027794 3300048904 Bacteria 3944
461 Ga0496102_0001190 3300048905 Bacteria 23615
462 Ga0496102_0101907 3300048905 Bacteria 2668
463 Ga0496102_0833475 3300048905 Bacteria 844
464 Ga0496103_0001391 3300048906 Bacteria 16284
465 Ga0496103_0092510 3300048906 Bacteria 1909
466 Ga0496104_0073058 3300048907 Bacteria 3263
467 Ga0496106_0010229 3300048909 Bacteria 6934
468 Ga0496106_0186141 3300048909 Bacteria 1650
469 Ga0496106_0549226 3300048909 Bacteria 927
470 Ga0496107_0000760 3300048910 Bacteria 18575
471 Ga0496107_0160349 3300048910 Bacteria 1667
472 Ga0496107_0358006 3300048910 Bacteria 1086
473 Ga0496107_0522359 3300048910 Bacteria 880
474 Ga0496107_0558328 3300048910 Bacteria 848
475 Ga0496107_1270335 3300048910 Bacteria 527
476 Ga0496108_0010094 3300048911 Bacteria 7663
477 Ga0496108_0011269 3300048911 Bacteria 7264
478 Ga0496108_0034514 3300048911 Bacteria 4204
479 Ga0496108_0466524 3300048911 Bacteria 1103
480 Ga0496108_0738885 3300048911 Bacteria 852
481 Ga0496108_0848471 3300048911 Bacteria 786
482 Ga0496108_1753196 3300048911 Bacteria 510
483 Ga0496109_0002148 3300048912 Bacteria 16388
484 Ga0496109_0042367 3300048912 Bacteria 4123
485 Ga0496110_0380003 3300048913 Bacteria 1287
486 Ga0496111_0040429 3300048914 Bacteria 3345
487 Ga0496111_0085836 3300048914 Bacteria 2302
488 Ga0496111_0234739 3300048914 Bacteria 1362
489 Ga0496113_0165653 3300048916 Bacteria 1749
490 Ga0496113_0242246 3300048916 Bacteria 1439
491 Ga0496114_0001875 3300048917 Bacteria 15936
492 Ga0496115_0004439 3300048918 Bacteria 10169
493 Ga0501034_0003091 3300049571 Bacteria 19192
494 Ga0501034_0204785 3300049571 Bacteria 1930
495 Ga0501037_0439646 3300049573 Bacteria 891
496 Ga0501043_1131343 3300049579 Bacteria 552
497 Ga0501047_0642600 3300049581 Bacteria 881
498 Ga0501047_0857831 3300049581 Bacteria 722
499 Ga0501047_0903648 3300049581 Bacteria 696
500 Ga0501047_1063196 3300049581 Bacteria 623
501 Ga0501067_0026209 3300049583 Bacteria 3230
502 Ga0501067_0634284 3300049583 Bacteria 600
503 Ga0501068_0003128 3300049584 Bacteria 8856
504 Ga0501068_0083003 3300049584 Bacteria 1969
505 Ga0501069_0000052 3300049585 Bacteria 69909
506 Ga0501070_0000030 3300049586 Bacteria 139270
507 Ga0501070_0069240 3300049586 Bacteria 2921
508 Ga0501070_0420279 3300049586 Bacteria 1080
509 Ga0501070_0505064 3300049586 Bacteria 971
510 Ga0501070_0595798 3300049586 Bacteria 881
511 Ga0501071_0022503 3300049587 Bacteria 4394
512 Ga0501071_0241466 3300049587 Bacteria 1362
513 Ga0501071_1092998 3300049587 Bacteria 616
514 Ga0501072_0171672 3300049588 Bacteria 1730
515 Ga0501073_0017820 3300049589 Bacteria 5140
516 Ga0501073_0262430 3300049589 Bacteria 1192
517 Ga0501074_0035839 3300049590 Bacteria 3594
518 Ga0501080_0004387 3300049742 Bacteria 12532
519 Ga0501080_0019341 3300049742 Bacteria 6309
520 Ga0501080_0128721 3300049742 Bacteria 2344
521 Ga0501080_0529539 3300049742 Bacteria 1051
522 Ga0501083_0005470 3300049744 Bacteria 8996
523 Ga0501083_0622060 3300049744 Bacteria 702
524 Ga0501044_0265740 3300049823 Bacteria 1653
525 nmdc:mga03683_21876_c1 3300050489 Bacteria 2472
526 nmdc:mga03683_69745_c1 3300050489 Bacteria 1500
527 nmdc:mga03n38_10885_c1 3300050490 Bacteria 3368
528 nmdc:mga03n38_23297_c1 3300050490 Bacteria 2517
529 nmdc:mga03n38_3586_c1 3300050490 Bacteria 5012
530 nmdc:mga03n38_4344_c1 3300050490 Bacteria 4682
531 nmdc:mga03n38_789072_c1 3300050490 Bacteria 552
532 nmdc:mga03n38_8261_c1 3300050490 Bacteria 3727
533 nmdc:mga03n38_829130_c1 3300050490 Bacteria 540
534 nmdc:mga00v17_143508_c1 3300050491 Bacteria 1532
535 nmdc:mga00v17_206426_c1 3300050491 Bacteria 1271
536 nmdc:mga00v17_37521_c1 3300050491 Bacteria 2895
537 nmdc:mga00v17_39824_c1 3300050491 Bacteria 2816
538 nmdc:mga00v17_5446_c1 3300050491 Bacteria 6702
539 nmdc:mga0yw44_142464_c1 3300050492 Bacteria 1558
540 nmdc:mga0yw44_15301_c1 3300050492 Bacteria 4105
541 nmdc:mga0yw44_215454_c1 3300050492 Bacteria 1271
542 nmdc:mga0yw44_464056_c1 3300050492 Bacteria 858
543 nmdc:mga0yw44_758273_c1 3300050492 Bacteria 659
544 nmdc:mga0yw44_98777_c1 3300050492 Bacteria 1857
545 nmdc:mga06z11_140360_c1 3300050494 Bacteria 1365
546 nmdc:mga06z11_4117_c1 3300050494 Bacteria 5681
547 nmdc:mga06z11_86081_c1 3300050494 Bacteria 1697
548 nmdc:mga04h51_174928_c1 3300050495 Bacteria 833
549 nmdc:mga07m45_50544_c1 3300050496 Bacteria 2343
550 nmdc:mga07m45_80553_c1 3300050496 Bacteria 1859
551 nmdc:mga0qj67_419368_c1 3300050509 Bacteria 1079
552 nmdc:mga0sz30_2742_c1 3300050516 Bacteria 6286
553 nmdc:mga0sz30_73493_c1 3300050516 Bacteria 1474
554 nmdc:mga0sz30_93514_c1 3300050516 Bacteria 1309
555 Ga0500610_0245956 3300053079 Bacteria 828
556 Ga0495655_0003715 3300053083 Bacteria 2545
557 Ga0495619_0221785 3300053085 Bacteria 1310
558 Ga0495619_0268887 3300053085 Bacteria 1181
559 Ga0500644_0040039 3300053088 Bacteria 1549
560 Ga0500556_0253053 3300053104 Bacteria 693
561 Ga0500562_040357 3300053108 Bacteria 1241
562 Ga0500628_161399 3300053129 Bacteria 632
563 Ga0500577_0311419 3300053142 Bacteria 687
564 Ga0500604_0111155 3300053151 Bacteria 910
565 Ga0590071_008796 3300059421 Bacteria 2373
566 Ga0590074_015218 3300059423 Bacteria 1305
567 Ga0590075_002363 3300059424 Bacteria 4530
568 Ga0590075_022717 3300059424 Bacteria 1570
569 Ga0590077_003731 3300059426 Bacteria 3143
570 Ga0590077_051866 3300059426 Bacteria 921
571 Ga0501082_0392410 3300060353 Bacteria 1211
572 Ga0466962_0049026 3300061719 Bacteria 2018
573 Ga0466962_0537305 3300061719 Bacteria 593
574 Ga0466962_0546680 3300061719 Bacteria 588

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0056586 Ga0466972_0056586_517_924 133
2 3300035121 Ga0373960_0356500 Ga0373960_0356500_84_506 134
3 3300010375 Ga0105239_11461457 Ga0105239_114614572 135
4 3300013297 Ga0157378_12953374 Ga0157378_129533741 135
5 3300025945 Ga0207679_10986905 Ga0207679_109869051 135
6 3300028800 Ga0265338_10027056 Ga0265338_100270569 135
7 3300031251 Ga0265327_10010227 Ga0265327_100102273 135
8 3300044658 Ga0466972_0016581 Ga0466972_0016581_1742_2149 135
9 3300044684 Ga0466966_0159544 Ga0466966_0159544_634_1041 135
10 3300044693 Ga0466961_0142303 Ga0466961_0142303_331_747 135
11 3300044706 Ga0466964_0052557 Ga0466964_0052557_287_703 135
12 3300044719 Ga0466971_0024229 Ga0466971_0024229_200_616 135
13 3300044719 Ga0466971_0620940 Ga0466971_0620940_109_525 135
14 3300044735 Ga0466968_0260617 Ga0466968_0260617_128_544 135
15 3300044765 Ga0466970_0157229 Ga0466970_0157229_503_910 135
16 3300044842 Ga0466957_0065269 Ga0466957_0065269_677_1084 135
17 3300045049 Ga0466959_0302738 Ga0466959_0302738_313_720 135
18 3300045836 Ga0466958_0037102 Ga0466958_0037102_839_1255 135
19 3300061719 Ga0466962_0049026 Ga0466962_0049026_1091_1507 135
20 3300001977 JGI24746J21847_1005511 JGI24746J21847_10055112 136
21 3300001989 JGI24739J22299_10031098 JGI24739J22299_100310982 136
22 3300001990 JGI24737J22298_10055191 JGI24737J22298_100551912 136
23 3300001990 JGI24737J22298_10094541 JGI24737J22298_100945412 136
24 3300001990 JGI24737J22298_10172141 JGI24737J22298_101721411 136
25 3300001991 JGI24743J22301_10006415 JGI24743J22301_100064152 136
26 3300002073 JGI24745J21846_1003847 JGI24745J21846_10038472 136
27 3300002075 JGI24738J21930_10011625 JGI24738J21930_100116253 136
28 3300002077 JGI24744J21845_10007872 JGI24744J21845_100078723 136
29 3300002244 JGI24742J22300_10005704 JGI24742J22300_100057043 136
30 3300002705 JGI25156J39149_1027211 JGI25156J39149_10272112 136
31 3300002738 JGI25154J39366_1028162 JGI25154J39366_10281621 136
32 3300002741 JGI25157J39369_1007493 JGI25157J39369_10074932 136
33 3300003203 JGI25406J46586_10009256 JGI25406J46586_100092563 136
34 3300003373 JGI25407J50210_10038829 JGI25407J50210_100388292 136
35 3300003760 Ga0055527_1000071 Ga0055527_100007131 136
36 3300003761 Ga0055535_1000213 Ga0055535_100021323 136
37 3300003762 Ga0055542_1000161 Ga0055542_100016131 136
38 3300003763 Ga0055529_1000272 Ga0055529_100027223 136
39 3300005327 Ga0070658_10619519 Ga0070658_106195192 136
40 3300005328 Ga0070676_10028008 Ga0070676_100280082 136
41 3300005329 Ga0070683_100032193 Ga0070683_1000321936 136
42 3300005329 Ga0070683_101583279 Ga0070683_1015832791 136
43 3300005334 Ga0068869_100036967 Ga0068869_1000369672 136
44 3300005335 Ga0070666_10002633 Ga0070666_100026332 136
45 3300005336 Ga0070680_100201705 Ga0070680_1002017052 136
46 3300005337 Ga0070682_100016612 Ga0070682_1000166122 136
47 3300005337 Ga0070682_100025176 Ga0070682_1000251765 136
48 3300005337 Ga0070682_100418537 Ga0070682_1004185373 136
49 3300005338 Ga0068868_100002656 Ga0068868_1000026564 136
50 3300005338 Ga0068868_100634853 Ga0068868_1006348532 136
51 3300005339 Ga0070660_100060619 Ga0070660_1000606192 136
52 3300005339 Ga0070660_100328157 Ga0070660_1003281572 136
53 3300005340 Ga0070689_100016638 Ga0070689_1000166383 136
54 3300005341 Ga0070691_10134204 Ga0070691_101342042 136
55 3300005341 Ga0070691_10274115 Ga0070691_102741151 136
56 3300005344 Ga0070661_100085923 Ga0070661_1000859233 136
57 3300005347 Ga0070668_100000347 Ga0070668_1000003473 136
58 3300005347 Ga0070668_100001780 Ga0070668_10000178014 136
59 3300005347 Ga0070668_100127838 Ga0070668_1001278382 136
60 3300005353 Ga0070669_100039437 Ga0070669_1000394372 136
61 3300005354 Ga0070675_100317031 Ga0070675_1003170311 136
62 3300005355 Ga0070671_100029440 Ga0070671_1000294406 136
63 3300005356 Ga0070674_100003233 Ga0070674_1000032338 136
64 3300005356 Ga0070674_100514865 Ga0070674_1005148652 136
65 3300005364 Ga0070673_100090673 Ga0070673_1000906734 136
66 3300005365 Ga0070688_100004005 Ga0070688_1000040054 136
67 3300005365 Ga0070688_100031996 Ga0070688_1000319963 136
68 3300005366 Ga0070659_100352474 Ga0070659_1003524742 136
69 3300005366 Ga0070659_100373836 Ga0070659_1003738362 136
70 3300005366 Ga0070659_100517068 Ga0070659_1005170682 136
71 3300005367 Ga0070667_100005709 Ga0070667_1000057093 136
72 3300005367 Ga0070667_100407087 Ga0070667_1004070872 136
73 3300005434 Ga0070709_10004024 Ga0070709_100040247 136
74 3300005435 Ga0070714_100976032 Ga0070714_1009760322 136
75 3300005437 Ga0070710_10025644 Ga0070710_100256443 136
76 3300005438 Ga0070701_10002486 Ga0070701_100024862 136
77 3300005438 Ga0070701_10238996 Ga0070701_102389963 136
78 3300005439 Ga0070711_100000402 Ga0070711_1000004021 136
79 3300005439 Ga0070711_100000860 Ga0070711_10000086015 136
80 3300005440 Ga0070705_100031929 Ga0070705_1000319293 136
81 3300005440 Ga0070705_100115944 Ga0070705_1001159442 136
82 3300005441 Ga0070700_100005259 Ga0070700_1000052595 136
83 3300005444 Ga0070694_100004412 Ga0070694_1000044128 136
84 3300005444 Ga0070694_100305386 Ga0070694_1003053862 136
85 3300005445 Ga0070708_101360309 Ga0070708_1013603091 136
86 3300005455 Ga0070663_100069326 Ga0070663_1000693263 136
87 3300005455 Ga0070663_100182113 Ga0070663_1001821132 136
88 3300005456 Ga0070678_100000273 Ga0070678_1000002736 136
89 3300005456 Ga0070678_100026963 Ga0070678_1000269633 136
90 3300005457 Ga0070662_100098007 Ga0070662_1000980074 136
91 3300005457 Ga0070662_100182676 Ga0070662_1001826762 136
92 3300005457 Ga0070662_100386958 Ga0070662_1003869582 136
93 3300005459 Ga0068867_100002987 Ga0068867_10000298710 136
94 3300005459 Ga0068867_100410188 Ga0068867_1004101882 136
95 3300005466 Ga0070685_10026763 Ga0070685_100267633 136
96 3300005468 Ga0070707_100602719 Ga0070707_1006027192 136
97 3300005530 Ga0070679_100653536 Ga0070679_1006535362 136
98 3300005535 Ga0070684_100026869 Ga0070684_1000268697 136
99 3300005536 Ga0070697_100688219 Ga0070697_1006882192 136
100 3300005539 Ga0068853_100002811 Ga0068853_1000028114 136
101 3300005539 Ga0068853_100510569 Ga0068853_1005105692 136
102 3300005539 Ga0068853_100546987 Ga0068853_1005469872 136
103 3300005544 Ga0070686_100331292 Ga0070686_1003312922 136
104 3300005545 Ga0070695_100008824 Ga0070695_1000088246 136
105 3300005545 Ga0070695_100114250 Ga0070695_1001142503 136
106 3300005546 Ga0070696_100000796 Ga0070696_10000079615 136
107 3300005546 Ga0070696_100174628 Ga0070696_1001746283 136
108 3300005547 Ga0070693_100007039 Ga0070693_1000070396 136
109 3300005547 Ga0070693_100818455 Ga0070693_1008184552 136
110 3300005548 Ga0070665_100000821 Ga0070665_1000008219 136
111 3300005548 Ga0070665_100005361 Ga0070665_1000053615 136
112 3300005548 Ga0070665_100049345 Ga0070665_1000493453 136
113 3300005549 Ga0070704_100032789 Ga0070704_1000327895 136
114 3300005549 Ga0070704_100069505 Ga0070704_1000695051 136
115 3300005563 Ga0068855_100369885 Ga0068855_1003698851 136
116 3300005577 Ga0068857_100008819 Ga0068857_10000881912 136
117 3300005578 Ga0068854_100101132 Ga0068854_1001011323 136
118 3300005578 Ga0068854_100297695 Ga0068854_1002976951 136
119 3300005614 Ga0068856_100150028 Ga0068856_1001500282 136
120 3300005615 Ga0070702_100007930 Ga0070702_1000079302 136
121 3300005615 Ga0070702_100658501 Ga0070702_1006585012 136
122 3300005616 Ga0068852_100692397 Ga0068852_1006923972 136
123 3300005617 Ga0068859_100005745 Ga0068859_1000057452 136
124 3300005618 Ga0068864_100236513 Ga0068864_1002365132 136
125 3300005718 Ga0068866_10000419 Ga0068866_1000041913 136
126 3300005718 Ga0068866_10148991 Ga0068866_101489914 136
127 3300005718 Ga0068866_10259538 Ga0068866_102595382 136
128 3300005719 Ga0068861_100301020 Ga0068861_1003010202 136
129 3300005840 Ga0068870_10663283 Ga0068870_106632831 136
130 3300005841 Ga0068863_100048870 Ga0068863_1000488704 136
131 3300005841 Ga0068863_100567042 Ga0068863_1005670422 136
132 3300005842 Ga0068858_100022886 Ga0068858_1000228863 136
133 3300005842 Ga0068858_100050241 Ga0068858_1000502413 136
134 3300005843 Ga0068860_100000035 Ga0068860_100000035155 136
135 3300005843 Ga0068860_100000775 Ga0068860_1000007754 136
136 3300005843 Ga0068860_100498305 Ga0068860_1004983052 136
137 3300005844 Ga0068862_100005734 Ga0068862_1000057345 136
138 3300005844 Ga0068862_100199094 Ga0068862_1001990943 136
139 3300005937 Ga0081455_10011687 Ga0081455_1001168710 136
140 3300005937 Ga0081455_10077189 Ga0081455_100771893 136
141 3300005937 Ga0081455_10185414 Ga0081455_101854142 136
142 3300005981 Ga0081538_10004521 Ga0081538_1000452110 136
143 3300005981 Ga0081538_10012290 Ga0081538_100122902 136
144 3300005981 Ga0081538_10031865 Ga0081538_100318651 136
145 3300005985 Ga0081539_10003298 Ga0081539_1000329815 136
146 3300006028 Ga0070717_10234650 Ga0070717_102346503 136
147 3300006038 Ga0075365_10049058 Ga0075365_100490583 136
148 3300006038 Ga0075365_10077920 Ga0075365_100779202 136
149 3300006038 Ga0075365_10265683 Ga0075365_102656832 136
150 3300006038 Ga0075365_10314292 Ga0075365_103142922 136
151 3300006042 Ga0075368_10090096 Ga0075368_100900961 136
152 3300006048 Ga0075363_100002031 Ga0075363_1000020313 136
153 3300006048 Ga0075363_100013855 Ga0075363_1000138553 136
154 3300006048 Ga0075363_100022561 Ga0075363_1000225613 136
155 3300006048 Ga0075363_100023916 Ga0075363_1000239163 136
156 3300006048 Ga0075363_100089770 Ga0075363_1000897704 136
157 3300006048 Ga0075363_100093897 Ga0075363_1000938973 136
158 3300006051 Ga0075364_10000303 Ga0075364_1000030310 136
159 3300006051 Ga0075364_10011745 Ga0075364_100117453 136
160 3300006051 Ga0075364_10040679 Ga0075364_100406793 136
161 3300006051 Ga0075364_10084199 Ga0075364_100841993 136
162 3300006173 Ga0070716_100000471 Ga0070716_1000004719 136
163 3300006173 Ga0070716_100017054 Ga0070716_1000170542 136
164 3300006175 Ga0070712_100115385 Ga0070712_1001153852 136
165 3300006175 Ga0070712_100212556 Ga0070712_1002125563 136
166 3300006177 Ga0075362_10011769 Ga0075362_100117693 136
167 3300006177 Ga0075362_10060613 Ga0075362_100606132 136
168 3300006186 Ga0075369_10000129 Ga0075369_1000012910 136
169 3300006186 Ga0075369_10242427 Ga0075369_102424272 136
170 3300006186 Ga0075369_10256598 Ga0075369_102565981 136
171 3300006186 Ga0075369_10286283 Ga0075369_102862832 136
172 3300006237 Ga0097621_100033270 Ga0097621_1000332704 136
173 3300006237 Ga0097621_100704384 Ga0097621_1007043842 136
174 3300006353 Ga0075370_10180480 Ga0075370_101804802 136
175 3300006353 Ga0075370_10372709 Ga0075370_103727092 136
176 3300006881 Ga0068865_100004325 Ga0068865_1000043251 136
177 3300006881 Ga0068865_100065650 Ga0068865_1000656503 136
178 3300006881 Ga0068865_100505892 Ga0068865_1005058922 136
179 3300006931 Ga0097620_100005745 Ga0097620_1000057452 136
180 3300009092 Ga0105250_10452626 Ga0105250_104526262 136
181 3300009093 Ga0105240_10593424 Ga0105240_105934242 136
182 3300009098 Ga0105245_10032532 Ga0105245_100325324 136
183 3300009098 Ga0105245_10037427 Ga0105245_100374276 136
184 3300009101 Ga0105247_10003162 Ga0105247_100031622 136
185 3300009101 Ga0105247_10120331 Ga0105247_101203311 136
186 3300009101 Ga0105247_10804061 Ga0105247_108040612 136
187 3300009147 Ga0114129_10306156 Ga0114129_103061562 136
188 3300009148 Ga0105243_10001826 Ga0105243_100018268 136
189 3300009148 Ga0105243_10547090 Ga0105243_105470903 136
190 3300009174 Ga0105241_10059209 Ga0105241_100592093 136
191 3300009174 Ga0105241_10076888 Ga0105241_100768883 136
192 3300009174 Ga0105241_11566785 Ga0105241_115667851 136
193 3300009176 Ga0105242_10000459 Ga0105242_1000045911 136
194 3300009176 Ga0105242_10023936 Ga0105242_100239363 136
195 3300009176 Ga0105242_10841038 Ga0105242_108410383 136
196 3300009177 Ga0105248_10003999 Ga0105248_100039996 136
197 3300009177 Ga0105248_10275424 Ga0105248_102754244 136
198 3300009545 Ga0105237_10108924 Ga0105237_101089242 136
199 3300009545 Ga0105237_10447552 Ga0105237_104475523 136
200 3300009551 Ga0105238_10091684 Ga0105238_100916843 136
201 3300009551 Ga0105238_10262247 Ga0105238_102622472 136
202 3300009553 Ga0105249_10006558 Ga0105249_100065582 136
203 3300009553 Ga0105249_10083288 Ga0105249_100832883 136
204 3300009553 Ga0105249_10367509 Ga0105249_103675092 136
205 3300009553 Ga0105249_10642350 Ga0105249_106423502 136
206 3300009553 Ga0105249_10866566 Ga0105249_108665662 136
207 3300010375 Ga0105239_10012460 Ga0105239_100124608 136
208 3300010375 Ga0105239_10416493 Ga0105239_104164933 136
209 3300010375 Ga0105239_10571827 Ga0105239_105718272 136
210 3300010375 Ga0105239_10810185 Ga0105239_108101853 136
211 3300011119 Ga0105246_10002382 Ga0105246_1000238211 136
212 3300011119 Ga0105246_10321670 Ga0105246_103216703 136
213 3300013102 Ga0157371_10647766 Ga0157371_106477662 136
214 3300013105 Ga0157369_10019113 Ga0157369_100191137 136
215 3300013105 Ga0157369_10140861 Ga0157369_101408612 136
216 3300013105 Ga0157369_10531931 Ga0157369_105319312 136
217 3300013105 Ga0157369_11669617 Ga0157369_116696172 136
218 3300013296 Ga0157374_10013307 Ga0157374_100133076 136
219 3300013296 Ga0157374_10252377 Ga0157374_102523773 136
220 3300013297 Ga0157378_10003979 Ga0157378_100039793 136
221 3300013297 Ga0157378_10170604 Ga0157378_101706043 136
222 3300013306 Ga0163162_10006338 Ga0163162_100063384 136
223 3300013306 Ga0163162_10240440 Ga0163162_102404403 136
224 3300013307 Ga0157372_10109161 Ga0157372_101091613 136
225 3300013307 Ga0157372_10239765 Ga0157372_102397653 136
226 3300013307 Ga0157372_10829356 Ga0157372_108293563 136
227 3300013307 Ga0157372_12365335 Ga0157372_123653351 136
228 3300013308 Ga0157375_10009568 Ga0157375_100095686 136
229 3300013308 Ga0157375_10209038 Ga0157375_102090383 136
230 3300014325 Ga0163163_10088004 Ga0163163_100880043 136
231 3300014326 Ga0157380_10001560 Ga0157380_1000156015 136
232 3300014326 Ga0157380_10407507 Ga0157380_104075071 136
233 3300014745 Ga0157377_10068682 Ga0157377_100686823 136
234 3300014745 Ga0157377_10086101 Ga0157377_100861013 136
235 3300014745 Ga0157377_10130474 Ga0157377_101304742 136
236 3300014968 Ga0157379_10013893 Ga0157379_100138934 136
237 3300014968 Ga0157379_10017352 Ga0157379_100173522 136
238 3300014968 Ga0157379_10033521 Ga0157379_100335213 136
239 3300014969 Ga0157376_10446008 Ga0157376_104460082 136
240 3300017792 Ga0163161_10003090 Ga0163161_100030904 136
241 3300017792 Ga0163161_10595014 Ga0163161_105950142 136
242 3300017792 Ga0163161_10849656 Ga0163161_108496561 136
243 3300020069 Ga0197907_10828368 Ga0197907_108283683 136
244 3300021358 Ga0213873_10037562 Ga0213873_100375622 136
245 3300021388 Ga0213875_10065288 Ga0213875_100652882 136
246 3300022467 Ga0224712_10075666 Ga0224712_100756662 136
247 3300025228 Ga0209672_100004 Ga0209672_100004269 136
248 3300025230 Ga0209563_100028 Ga0209563_100028331 136
249 3300025242 Ga0209258_100003 Ga0209258_100003269 136
250 3300025246 Ga0209646_1003803 Ga0209646_10038034 136
251 3300025250 Ga0209026_1000281 Ga0209026_100028115 136
252 3300025254 Ga0209148_1000016 Ga0209148_1000016269 136
253 3300025256 Ga0209759_1008527 Ga0209759_10085273 136
254 3300025272 Ga0209455_1000004 Ga0209455_1000004269 136
255 3300025899 Ga0207642_10004024 Ga0207642_100040242 136
256 3300025899 Ga0207642_10085089 Ga0207642_100850892 136
257 3300025899 Ga0207642_10278779 Ga0207642_102787792 136
258 3300025900 Ga0207710_10004040 Ga0207710_100040403 136
259 3300025901 Ga0207688_10010768 Ga0207688_100107682 136
260 3300025903 Ga0207680_10003070 Ga0207680_100030703 136
261 3300025903 Ga0207680_10010590 Ga0207680_100105905 136
262 3300025904 Ga0207647_10066300 Ga0207647_100663003 136
263 3300025904 Ga0207647_10080074 Ga0207647_100800743 136
264 3300025904 Ga0207647_10248643 Ga0207647_102486432 136
265 3300025905 Ga0207685_10001517 Ga0207685_100015174 136
266 3300025906 Ga0207699_10014305 Ga0207699_100143053 136
267 3300025907 Ga0207645_10038444 Ga0207645_100384443 136
268 3300025907 Ga0207645_10166126 Ga0207645_101661263 136
269 3300025909 Ga0207705_10765082 Ga0207705_107650821 136
270 3300025911 Ga0207654_10139797 Ga0207654_101397973 136
271 3300025911 Ga0207654_10209233 Ga0207654_102092332 136
272 3300025911 Ga0207654_10709275 Ga0207654_107092751 136
273 3300025914 Ga0207671_10410821 Ga0207671_104108212 136
274 3300025914 Ga0207671_10478155 Ga0207671_104781552 136
275 3300025914 Ga0207671_10979625 Ga0207671_109796252 136
276 3300025915 Ga0207693_10000381 Ga0207693_100003819 136
277 3300025915 Ga0207693_10001414 Ga0207693_100014144 136
278 3300025916 Ga0207663_10004663 Ga0207663_100046632 136
279 3300025916 Ga0207663_10324343 Ga0207663_103243431 136
280 3300025916 Ga0207663_10505795 Ga0207663_105057952 136
281 3300025917 Ga0207660_10125433 Ga0207660_101254334 136
282 3300025918 Ga0207662_10089950 Ga0207662_100899503 136
283 3300025919 Ga0207657_10225338 Ga0207657_102253382 136
284 3300025919 Ga0207657_10605984 Ga0207657_106059842 136
285 3300025921 Ga0207652_10361109 Ga0207652_103611092 136
286 3300025921 Ga0207652_10551588 Ga0207652_105515881 136
287 3300025923 Ga0207681_10112725 Ga0207681_101127254 136
288 3300025923 Ga0207681_10156179 Ga0207681_101561793 136
289 3300025924 Ga0207694_10099044 Ga0207694_100990443 136
290 3300025924 Ga0207694_10305147 Ga0207694_103051472 136
291 3300025927 Ga0207687_10000587 Ga0207687_100005876 136
292 3300025927 Ga0207687_10530327 Ga0207687_105303272 136
293 3300025929 Ga0207664_10190289 Ga0207664_101902892 136
294 3300025929 Ga0207664_11069970 Ga0207664_110699702 136
295 3300025931 Ga0207644_10308513 Ga0207644_103085132 136
296 3300025932 Ga0207690_10532665 Ga0207690_105326652 136
297 3300025932 Ga0207690_10707389 Ga0207690_107073892 136
298 3300025933 Ga0207706_10046021 Ga0207706_100460212 136
299 3300025934 Ga0207686_10015983 Ga0207686_100159833 136
300 3300025935 Ga0207709_10028683 Ga0207709_100286833 136
301 3300025935 Ga0207709_10210212 Ga0207709_102102121 136
302 3300025936 Ga0207670_10006540 Ga0207670_100065404 136
303 3300025937 Ga0207669_10001288 Ga0207669_100012886 136
304 3300025938 Ga0207704_10001708 Ga0207704_100017086 136
305 3300025938 Ga0207704_10055306 Ga0207704_100553064 136
306 3300025938 Ga0207704_10341437 Ga0207704_103414372 136
307 3300025939 Ga0207665_10021570 Ga0207665_100215704 136
308 3300025939 Ga0207665_10134296 Ga0207665_101342962 136
309 3300025941 Ga0207711_10029205 Ga0207711_100292054 136
310 3300025941 Ga0207711_10115504 Ga0207711_101155043 136
311 3300025942 Ga0207689_10016281 Ga0207689_100162814 136
312 3300025942 Ga0207689_10017429 Ga0207689_100174294 136
313 3300025942 Ga0207689_10474131 Ga0207689_104741312 136
314 3300025944 Ga0207661_10231513 Ga0207661_102315132 136
315 3300025944 Ga0207661_11814922 Ga0207661_118149221 136
316 3300025945 Ga0207679_10804914 Ga0207679_108049142 136
317 3300025949 Ga0207667_10363536 Ga0207667_103635361 136
318 3300025960 Ga0207651_10485760 Ga0207651_104857602 136
319 3300025961 Ga0207712_10033254 Ga0207712_100332544 136
320 3300025961 Ga0207712_10264942 Ga0207712_102649423 136
321 3300025961 Ga0207712_10361870 Ga0207712_103618703 136
322 3300025961 Ga0207712_10911101 Ga0207712_109111012 136
323 3300025961 Ga0207712_11002999 Ga0207712_110029992 136
324 3300025972 Ga0207668_10004077 Ga0207668_100040774 136
325 3300025972 Ga0207668_10007345 Ga0207668_100073456 136
326 3300025972 Ga0207668_11367761 Ga0207668_113677611 136
327 3300025981 Ga0207640_10013690 Ga0207640_100136901 136
328 3300025981 Ga0207640_10274045 Ga0207640_102740453 136
329 3300025981 Ga0207640_10508933 Ga0207640_105089332 136
330 3300025981 Ga0207640_10848419 Ga0207640_108484191 136
331 3300025986 Ga0207658_10017204 Ga0207658_100172042 136
332 3300026023 Ga0207677_10310657 Ga0207677_103106573 136
333 3300026023 Ga0207677_10690804 Ga0207677_106908041 136
334 3300026035 Ga0207703_10039188 Ga0207703_100391883 136
335 3300026035 Ga0207703_10056148 Ga0207703_100561483 136
336 3300026035 Ga0207703_10385246 Ga0207703_103852461 136
337 3300026041 Ga0207639_10018307 Ga0207639_100183073 136
338 3300026041 Ga0207639_10133457 Ga0207639_101334573 136
339 3300026067 Ga0207678_10004848 Ga0207678_100048483 136
340 3300026067 Ga0207678_10093791 Ga0207678_100937913 136
341 3300026075 Ga0207708_10018949 Ga0207708_100189494 136
342 3300026075 Ga0207708_10176416 Ga0207708_101764162 136
343 3300026078 Ga0207702_10052727 Ga0207702_100527273 136
344 3300026078 Ga0207702_10377407 Ga0207702_103774071 136
345 3300026088 Ga0207641_10012729 Ga0207641_100127292 136
346 3300026088 Ga0207641_10464498 Ga0207641_104644982 136
347 3300026089 Ga0207648_10000462 Ga0207648_1000046239 136
348 3300026089 Ga0207648_10073136 Ga0207648_100731363 136
349 3300026095 Ga0207676_10127111 Ga0207676_101271113 136
350 3300026095 Ga0207676_10526579 Ga0207676_105265791 136
351 3300026116 Ga0207674_10014897 Ga0207674_100148974 136
352 3300026118 Ga0207675_100000768 Ga0207675_10000076822 136
353 3300026118 Ga0207675_100266320 Ga0207675_1002663203 136
354 3300026118 Ga0207675_100447979 Ga0207675_1004479792 136
355 3300026121 Ga0207683_10000575 Ga0207683_1000057516 136
356 3300026121 Ga0207683_10150507 Ga0207683_101505071 136
357 3300026142 Ga0207698_10067881 Ga0207698_100678813 136
358 3300026142 Ga0207698_10967468 Ga0207698_109674682 136
359 3300028379 Ga0268266_10003777 Ga0268266_100037774 136
360 3300028379 Ga0268266_10084714 Ga0268266_100847143 136
361 3300028380 Ga0268265_10014518 Ga0268265_100145184 136
362 3300028380 Ga0268265_10692889 Ga0268265_106928892 136
363 3300028381 Ga0268264_10000031 Ga0268264_10000031253 136
364 3300028381 Ga0268264_10004232 Ga0268264_1000423211 136
365 3300028381 Ga0268264_10420373 Ga0268264_104203732 136
366 3300028381 Ga0268264_12157866 Ga0268264_121578661 136
367 3300031995 Ga0307409_100604709 Ga0307409_1006047092 136
368 3300035090 Ga0373949_0076523 Ga0373949_0076523_32_442 136
369 3300035090 Ga0373949_0173788 Ga0373949_0173788_168_578 136
370 3300035111 Ga0373923_0022109 Ga0373923_0022109_1092_1502 136
371 3300035692 Ga0373935_1288236 Ga0373935_1288236_114_524 136
372 3300037853 Ga0436364_0332337 Ga0436364_0332337_168_578 136
373 3300037853 Ga0436364_0406475 Ga0436364_0406475_455_865 136
374 3300037853 Ga0436364_1019987 Ga0436364_1019987_936_1346 136
375 3300039453 Ga0436362_0337613 Ga0436362_0337613_353_763 136
376 3300041453 Ga0451797_0578190 Ga0451797_0578190_288_698 136
377 3300041486 Ga0451807_2424073 Ga0451807_2424073_167_577 136
378 3300041509 Ga0451843_0327092 Ga0451843_0327092_212_622 136
379 3300041512 Ga0451853_2158879 Ga0451853_2158879_588_1004 136
380 3300044656 Ga0466969_0065346 Ga0466969_0065346_239_661 136
381 3300044656 Ga0466969_0085665 Ga0466969_0085665_860_1270 136
382 3300044656 Ga0466969_0099441 Ga0466969_0099441_317_727 136
383 3300044658 Ga0466972_0012804 Ga0466972_0012804_1615_2034 136
384 3300044683 Ga0466965_0000685 Ga0466965_0000685_925_1344 136
385 3300044683 Ga0466965_0051130 Ga0466965_0051130_1365_1775 136
386 3300044683 Ga0466965_0407571 Ga0466965_0407571_138_548 136
387 3300044683 Ga0466965_0519921 Ga0466965_0519921_200_610 136
388 3300044684 Ga0466966_0013868 Ga0466966_0013868_3821_4243 136
389 3300044684 Ga0466966_0058391 Ga0466966_0058391_601_1011 136
390 3300044684 Ga0466966_0067623 Ga0466966_0067623_300_710 136
391 3300044684 Ga0466966_0196883 Ga0466966_0196883_178_588 136
392 3300044693 Ga0466961_0005936 Ga0466961_0005936_7259_7669 136
393 3300044693 Ga0466961_0054471 Ga0466961_0054471_436_858 136
394 3300044693 Ga0466961_0101936 Ga0466961_0101936_577_987 136
395 3300044693 Ga0466961_0470870 Ga0466961_0470870_231_641 136
396 3300044694 Ga0466963_0059216 Ga0466963_0059216_762_1172 136
397 3300044694 Ga0466963_0107554 Ga0466963_0107554_701_1111 136
398 3300044694 Ga0466963_0497531 Ga0466963_0497531_351_761 136
399 3300044694 Ga0466963_0592075 Ga0466963_0592075_181_591 136
400 3300044706 Ga0466964_0086649 Ga0466964_0086649_589_999 136
401 3300044706 Ga0466964_0141666 Ga0466964_0141666_310_729 136
402 3300044706 Ga0466964_0202030 Ga0466964_0202030_368_784 136
403 3300044735 Ga0466968_0000928 Ga0466968_0000928_9197_9616 136
404 3300044765 Ga0466970_0077642 Ga0466970_0077642_1214_1633 136
405 3300044765 Ga0466970_0089151 Ga0466970_0089151_153_563 136
406 3300044765 Ga0466970_0372336 Ga0466970_0372336_187_597 136
407 3300044765 Ga0466970_0524568 Ga0466970_0524568_101_511 136
408 3300044842 Ga0466957_0006881 Ga0466957_0006881_2664_3083 136
409 3300044842 Ga0466957_0297004 Ga0466957_0297004_604_1026 136
410 3300044901 Ga0466960_0108912 Ga0466960_0108912_763_1182 136
411 3300044901 Ga0466960_0300440 Ga0466960_0300440_455_865 136
412 3300044901 Ga0466960_0338013 Ga0466960_0338013_52_462 136
413 3300045049 Ga0466959_0020726 Ga0466959_0020726_4390_4812 136
414 3300045049 Ga0466959_0032197 Ga0466959_0032197_684_1094 136
415 3300045049 Ga0466959_0199351 Ga0466959_0199351_751_1161 136
416 3300045049 Ga0466959_0322550 Ga0466959_0322550_533_943 136
417 3300045049 Ga0466959_0459689 Ga0466959_0459689_255_674 136
418 3300045049 Ga0466959_0527514 Ga0466959_0527514_260_670 136
419 3300045051 Ga0451576_0250245 Ga0451576_0250245_613_1023 136
420 3300045836 Ga0466958_0003414 Ga0466958_0003414_2701_3123 136
421 3300045836 Ga0466958_0006577 Ga0466958_0006577_4062_4472 136
422 3300045836 Ga0466958_0095622 Ga0466958_0095622_1309_1719 136
423 3300045836 Ga0466958_0309393 Ga0466958_0309393_110_520 136
424 3300045836 Ga0466958_0326190 Ga0466958_0326190_80_490 136
425 3300045836 Ga0466958_0459081 Ga0466958_0459081_313_723 136
426 3300045976 Ga0466967_0007720 Ga0466967_0007720_287_706 136
427 3300045976 Ga0466967_0028377 Ga0466967_0028377_3346_3756 136
428 3300045976 Ga0466967_0089596 Ga0466967_0089596_2072_2482 136
429 3300045976 Ga0466967_0126986 Ga0466967_0126986_665_1075 136
430 3300045976 Ga0466967_0262998 Ga0466967_0262998_1049_1465 136
431 3300045976 Ga0466967_0263007 Ga0466967_0263007_478_888 136
432 3300045976 Ga0466967_0464415 Ga0466967_0464415_780_1190 136
433 3300046460 Ga0495638_0000563 Ga0495638_0000563_40546_40965 136
434 3300046461 Ga0495641_0121577 Ga0495641_0121577_413_823 136
435 3300046473 Ga0495582_0614298 Ga0495582_0614298_94_504 136
436 3300046475 Ga0495639_0111775 Ga0495639_0111775_100_510 136
437 3300046492 Ga0495585_0120502 Ga0495585_0120502_351_761 136
438 3300046511 Ga0495608_0285103 Ga0495608_0285103_486_896 136
439 3300046526 Ga0495666_0095129 Ga0495666_0095129_63_473 136
440 3300046529 Ga0495652_0711185 Ga0495652_0711185_77_487 136
441 3300046531 Ga0495665_0486225 Ga0495665_0486225_78_488 136
442 3300046533 Ga0495640_0044374 Ga0495640_0044374_2647_3057 136
443 3300046533 Ga0495640_0461776 Ga0495640_0461776_126_536 136
444 3300046642 Ga0495634_0091948 Ga0495634_0091948_1088_1498 136
445 3300046648 Ga0495611_0424511 Ga0495611_0424511_136_546 136
446 3300046660 Ga0495625_0148674 Ga0495625_0148674_942_1352 136
447 3300046660 Ga0495625_0534438 Ga0495625_0534438_98_517 136
448 3300046663 Ga0495635_0457265 Ga0495635_0457265_108_518 136
449 3300046675 Ga0495657_0350130 Ga0495657_0350130_325_738 136
450 3300046683 Ga0495658_0188015 Ga0495658_0188015_776_1186 136
451 3300046689 Ga0495613_0527106 Ga0495613_0527106_50_460 136
452 3300046694 Ga0495649_0201929 Ga0495649_0201929_100_510 136
453 3300046694 Ga0495649_0415441 Ga0495649_0415441_144_560 136
454 3300047319 Ga0495674_0514288 Ga0495674_0514288_97_507 136
455 3300047321 Ga0495676_0648472 Ga0495676_0648472_219_629 136
456 3300047322 Ga0495680_0072616 Ga0495680_0072616_787_1197 136
457 3300047673 Ga0495593_0030322 Ga0495593_0030322_115_525 136
458 3300048091 Ga0495626_0267001 Ga0495626_0267001_144_554 136
459 3300048903 Ga0496100_0007272 Ga0496100_0007272_2341_2751 136
460 3300048903 Ga0496100_0480218 Ga0496100_0480218_62_472 136
461 3300048904 Ga0496101_0027794 Ga0496101_0027794_2679_3089 136
462 3300048905 Ga0496102_0001190 Ga0496102_0001190_16563_16973 136
463 3300048905 Ga0496102_0101907 Ga0496102_0101907_1456_1866 136
464 3300048905 Ga0496102_0833475 Ga0496102_0833475_69_479 136
465 3300048906 Ga0496103_0001391 Ga0496103_0001391_9236_9646 136
466 3300048906 Ga0496103_0092510 Ga0496103_0092510_870_1280 136
467 3300048907 Ga0496104_0073058 Ga0496104_0073058_288_698 136
468 3300048909 Ga0496106_0010229 Ga0496106_0010229_4881_5291 136
469 3300048909 Ga0496106_0186141 Ga0496106_0186141_1107_1517 136
470 3300048909 Ga0496106_0549226 Ga0496106_0549226_448_858 136
471 3300048910 Ga0496107_0000760 Ga0496107_0000760_8926_9336 136
472 3300048910 Ga0496107_0160349 Ga0496107_0160349_915_1325 136
473 3300048910 Ga0496107_0358006 Ga0496107_0358006_411_824 136
474 3300048910 Ga0496107_0522359 Ga0496107_0522359_433_849 136
475 3300048910 Ga0496107_0558328 Ga0496107_0558328_310_720 136
476 3300048910 Ga0496107_1270335 Ga0496107_1270335_76_489 136
477 3300048911 Ga0496108_0010094 Ga0496108_0010094_5625_6038 136
478 3300048911 Ga0496108_0011269 Ga0496108_0011269_2524_2934 136
479 3300048911 Ga0496108_0034514 Ga0496108_0034514_3691_4107 136
480 3300048911 Ga0496108_0466524 Ga0496108_0466524_410_820 136
481 3300048911 Ga0496108_0738885 Ga0496108_0738885_39_458 136
482 3300048911 Ga0496108_0848471 Ga0496108_0848471_110_520 136
483 3300048911 Ga0496108_1753196 Ga0496108_1753196_38_448 136
484 3300048912 Ga0496109_0002148 Ga0496109_0002148_10174_10590 136
485 3300048912 Ga0496109_0042367 Ga0496109_0042367_3467_3880 136
486 3300048913 Ga0496110_0380003 Ga0496110_0380003_600_1013 136
487 3300048914 Ga0496111_0040429 Ga0496111_0040429_2845_3255 136
488 3300048914 Ga0496111_0085836 Ga0496111_0085836_901_1314 136
489 3300048914 Ga0496111_0234739 Ga0496111_0234739_81_491 136
490 3300048916 Ga0496113_0165653 Ga0496113_0165653_1127_1543 136
491 3300048916 Ga0496113_0242246 Ga0496113_0242246_767_1177 136
492 3300048917 Ga0496114_0001875 Ga0496114_0001875_9258_9668 136
493 3300048918 Ga0496115_0004439 Ga0496115_0004439_6275_6685 136
494 3300049571 Ga0501034_0003091 Ga0501034_0003091_2413_2844 136
495 3300049571 Ga0501034_0204785 Ga0501034_0204785_18_428 136
496 3300049573 Ga0501037_0439646 Ga0501037_0439646_358_789 136
497 3300049579 Ga0501043_1131343 Ga0501043_1131343_112_522 136
498 3300049581 Ga0501047_0642600 Ga0501047_0642600_38_448 136
499 3300049581 Ga0501047_0857831 Ga0501047_0857831_152_568 136
500 3300049581 Ga0501047_0903648 Ga0501047_0903648_256_666 136
501 3300049581 Ga0501047_1063196 Ga0501047_1063196_159_569 136
502 3300049583 Ga0501067_0026209 Ga0501067_0026209_816_1247 136
503 3300049583 Ga0501067_0634284 Ga0501067_0634284_147_557 136
504 3300049584 Ga0501068_0003128 Ga0501068_0003128_7642_8073 136
505 3300049584 Ga0501068_0083003 Ga0501068_0083003_973_1383 136
506 3300049585 Ga0501069_0000052 Ga0501069_0000052_46418_46828 136
507 3300049586 Ga0501070_0000030 Ga0501070_0000030_4074_4484 136
508 3300049586 Ga0501070_0069240 Ga0501070_0069240_1082_1492 136
509 3300049586 Ga0501070_0420279 Ga0501070_0420279_25_435 136
510 3300049586 Ga0501070_0505064 Ga0501070_0505064_508_918 136
511 3300049586 Ga0501070_0595798 Ga0501070_0595798_179_589 136
512 3300049587 Ga0501071_0022503 Ga0501071_0022503_2919_3329 136
513 3300049587 Ga0501071_0241466 Ga0501071_0241466_221_652 136
514 3300049587 Ga0501071_1092998 Ga0501071_1092998_26_436 136
515 3300049588 Ga0501072_0171672 Ga0501072_0171672_348_779 136
516 3300049589 Ga0501073_0017820 Ga0501073_0017820_2403_2834 136
517 3300049589 Ga0501073_0262430 Ga0501073_0262430_166_576 136
518 3300049590 Ga0501074_0035839 Ga0501074_0035839_783_1214 136
519 3300049742 Ga0501080_0004387 Ga0501080_0004387_4381_4791 136
520 3300049742 Ga0501080_0019341 Ga0501080_0019341_3695_4126 136
521 3300049742 Ga0501080_0128721 Ga0501080_0128721_994_1425 136
522 3300049742 Ga0501080_0529539 Ga0501080_0529539_125_535 136
523 3300049744 Ga0501083_0005470 Ga0501083_0005470_1481_1912 136
524 3300049744 Ga0501083_0622060 Ga0501083_0622060_128_559 136
525 3300049823 Ga0501044_0265740 Ga0501044_0265740_14_430 136
526 3300050489 nmdc:mga03683_21876_c1 nmdc:mga03683_21876_c1_1207_1617 136
527 3300050489 nmdc:mga03683_69745_c1 nmdc:mga03683_69745_c1_933_1343 136
528 3300050490 nmdc:mga03n38_10885_c1 nmdc:mga03n38_10885_c1_1073_1483 136
529 3300050490 nmdc:mga03n38_23297_c1 nmdc:mga03n38_23297_c1_1895_2311 136
530 3300050490 nmdc:mga03n38_3586_c1 nmdc:mga03n38_3586_c1_195_605 136
531 3300050490 nmdc:mga03n38_4344_c1 nmdc:mga03n38_4344_c1_534_944 136
532 3300050490 nmdc:mga03n38_789072_c1 nmdc:mga03n38_789072_c1_122_535 136
533 3300050490 nmdc:mga03n38_8261_c1 nmdc:mga03n38_8261_c1_1349_1759 136
534 3300050490 nmdc:mga03n38_829130_c1 nmdc:mga03n38_829130_c1_97_507 136
535 3300050491 nmdc:mga00v17_143508_c1 nmdc:mga00v17_143508_c1_968_1378 136
536 3300050491 nmdc:mga00v17_206426_c1 nmdc:mga00v17_206426_c1_825_1235 136
537 3300050491 nmdc:mga00v17_37521_c1 nmdc:mga00v17_37521_c1_2419_2829 136
538 3300050491 nmdc:mga00v17_39824_c1 nmdc:mga00v17_39824_c1_1503_1913 136
539 3300050491 nmdc:mga00v17_5446_c1 nmdc:mga00v17_5446_c1_2623_3033 136
540 3300050492 nmdc:mga0yw44_142464_c1 nmdc:mga0yw44_142464_c1_60_470 136
541 3300050492 nmdc:mga0yw44_15301_c1 nmdc:mga0yw44_15301_c1_2533_2943 136
542 3300050492 nmdc:mga0yw44_215454_c1 nmdc:mga0yw44_215454_c1_28_438 136
543 3300050492 nmdc:mga0yw44_464056_c1 nmdc:mga0yw44_464056_c1_50_460 136
544 3300050492 nmdc:mga0yw44_758273_c1 nmdc:mga0yw44_758273_c1_53_463 136
545 3300050492 nmdc:mga0yw44_98777_c1 nmdc:mga0yw44_98777_c1_33_443 136
546 3300050494 nmdc:mga06z11_140360_c1 nmdc:mga06z11_140360_c1_320_733 136
547 3300050494 nmdc:mga06z11_4117_c1 nmdc:mga06z11_4117_c1_816_1226 136
548 3300050494 nmdc:mga06z11_86081_c1 nmdc:mga06z11_86081_c1_1196_1606 136
549 3300050495 nmdc:mga04h51_174928_c1 nmdc:mga04h51_174928_c1_324_734 136
550 3300050496 nmdc:mga07m45_50544_c1 nmdc:mga07m45_50544_c1_745_1155 136
551 3300050496 nmdc:mga07m45_80553_c1 nmdc:mga07m45_80553_c1_53_463 136
552 3300050509 nmdc:mga0qj67_419368_c1 nmdc:mga0qj67_419368_c1_511_921 136
553 3300050516 nmdc:mga0sz30_2742_c1 nmdc:mga0sz30_2742_c1_1309_1719 136
554 3300050516 nmdc:mga0sz30_73493_c1 nmdc:mga0sz30_73493_c1_64_474 136
555 3300050516 nmdc:mga0sz30_93514_c1 nmdc:mga0sz30_93514_c1_211_621 136
556 3300053079 Ga0500610_0245956 Ga0500610_0245956_85_495 136
557 3300053083 Ga0495655_0003715 Ga0495655_0003715_1213_1629 136
558 3300053085 Ga0495619_0221785 Ga0495619_0221785_857_1267 136
559 3300053085 Ga0495619_0268887 Ga0495619_0268887_722_1132 136
560 3300053088 Ga0500644_0040039 Ga0500644_0040039_46_456 136
561 3300053104 Ga0500556_0253053 Ga0500556_0253053_212_622 136
562 3300053108 Ga0500562_040357 Ga0500562_040357_702_1112 136
563 3300053129 Ga0500628_161399 Ga0500628_161399_76_492 136
564 3300053142 Ga0500577_0311419 Ga0500577_0311419_212_631 136
565 3300053151 Ga0500604_0111155 Ga0500604_0111155_309_728 136
566 3300059421 Ga0590071_008796 Ga0590071_008796_75_485 136
567 3300059423 Ga0590074_015218 Ga0590074_015218_392_802 136
568 3300059424 Ga0590075_002363 Ga0590075_002363_3414_3824 136
569 3300059424 Ga0590075_022717 Ga0590075_022717_884_1294 136
570 3300059426 Ga0590077_003731 Ga0590077_003731_2585_2995 136
571 3300059426 Ga0590077_051866 Ga0590077_051866_299_709 136
572 3300060353 Ga0501082_0392410 Ga0501082_0392410_389_820 136
573 3300061719 Ga0466962_0537305 Ga0466962_0537305_42_461 136
574 3300061719 Ga0466962_0546680 Ga0466962_0546680_25_447 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

133

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

7

134

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8762 1 135
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8701 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8633 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8574 1 135
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8466 4 134
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9273 83 134 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.922 83 132 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8697 84 136 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8551 83 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.851 83 134 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6B3EIF2-F1-model_v4 VOC family protein 0.9831 85 136
AF-A0A7I9UZW0-F1-model_v4 Glyoxalase 0.9781 20 135
AF-A0A4V2YPG6-F1-model_v4 VOC family protein 0.9732 2 136
AF-A0A7W9QEY6-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9729 1 136
AF-A0A7Y9EC75-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9718 1 136 GO:0016829
GO:0051213

Feature Viewer

pLDDT pTM Quality
93.55 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map