F465293
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 294 | 574 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10012290|Ga0081538_100122902 |
| Length | 137 |
| Sequence | MDITIHASFLPHDDPDASLAFYRDILGFEVRGDVGNGKMRWITVGPPDQPDTSIVLEPXXXXGTGITDEERRTIAEMMAKGTYGFINLATKNLDGTFEQLQASDAEVVQEPTDQPYGIRDCAFRDPAGNLIRIQELR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 14 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 199 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 277 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 281 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 285 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 286 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 287 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 289 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 290 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 291 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 292 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.85 |
| Nodule | 0 |
| Rhizoplane | 6.45 |
| Rhizosphere | 79.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1005511 | 3300001977 | Bacteria | 1973 |
| 2 | JGI24739J22299_10031098 | 3300001989 | Bacteria | 1847 |
| 3 | JGI24737J22298_10055191 | 3300001990 | Bacteria | 1201 |
| 4 | JGI24737J22298_10094541 | 3300001990 | Bacteria | 886 |
| 5 | JGI24737J22298_10172141 | 3300001990 | Bacteria | 639 |
| 6 | JGI24743J22301_10006415 | 3300001991 | Bacteria | 2005 |
| 7 | JGI24745J21846_1003847 | 3300002073 | Bacteria | 1586 |
| 8 | JGI24738J21930_10011625 | 3300002075 | Bacteria | 1932 |
| 9 | JGI24744J21845_10007872 | 3300002077 | Bacteria | 2201 |
| 10 | JGI24742J22300_10005704 | 3300002244 | Bacteria | 2048 |
| 11 | JGI25156J39149_1027211 | 3300002705 | Bacteria | 896 |
| 12 | JGI25154J39366_1028162 | 3300002738 | Bacteria | 502 |
| 13 | JGI25157J39369_1007493 | 3300002741 | Bacteria | 1573 |
| 14 | JGI25406J46586_10009256 | 3300003203 | Bacteria | 4415 |
| 15 | JGI25407J50210_10038829 | 3300003373 | Bacteria | 1222 |
| 16 | Ga0055527_1000071 | 3300003760 | Bacteria | 84489 |
| 17 | Ga0055535_1000213 | 3300003761 | Bacteria | 61546 |
| 18 | Ga0055542_1000161 | 3300003762 | Bacteria | 84490 |
| 19 | Ga0055529_1000272 | 3300003763 | Bacteria | 61544 |
| 20 | Ga0070658_10619519 | 3300005327 | Bacteria | 938 |
| 21 | Ga0070676_10028008 | 3300005328 | Bacteria | 3199 |
| 22 | Ga0070683_100032193 | 3300005329 | Bacteria | 4774 |
| 23 | Ga0070683_101583279 | 3300005329 | Bacteria | 630 |
| 24 | Ga0068869_100036967 | 3300005334 | Bacteria | 3470 |
| 25 | Ga0070666_10002633 | 3300005335 | Bacteria | 10846 |
| 26 | Ga0070680_100201705 | 3300005336 | Bacteria | 1678 |
| 27 | Ga0070682_100016612 | 3300005337 | Bacteria | 4283 |
| 28 | Ga0070682_100025176 | 3300005337 | Bacteria | 3549 |
| 29 | Ga0070682_100418537 | 3300005337 | Bacteria | 1018 |
| 30 | Ga0068868_100002656 | 3300005338 | Bacteria | 12403 |
| 31 | Ga0068868_100634853 | 3300005338 | Bacteria | 949 |
| 32 | Ga0070660_100060619 | 3300005339 | Bacteria | 2937 |
| 33 | Ga0070660_100328157 | 3300005339 | Bacteria | 1258 |
| 34 | Ga0070689_100016638 | 3300005340 | Bacteria | 5383 |
| 35 | Ga0070691_10134204 | 3300005341 | Bacteria | 1256 |
| 36 | Ga0070691_10274115 | 3300005341 | Bacteria | 913 |
| 37 | Ga0070661_100085923 | 3300005344 | Bacteria | 2325 |
| 38 | Ga0070668_100000347 | 3300005347 | Bacteria | 30543 |
| 39 | Ga0070668_100001780 | 3300005347 | Bacteria | 15656 |
| 40 | Ga0070668_100127838 | 3300005347 | Bacteria | 2037 |
| 41 | Ga0070669_100039437 | 3300005353 | Bacteria | 3432 |
| 42 | Ga0070675_100317031 | 3300005354 | Bacteria | 1377 |
| 43 | Ga0070671_100029440 | 3300005355 | Bacteria | 4528 |
| 44 | Ga0070674_100003233 | 3300005356 | Bacteria | 9094 |
| 45 | Ga0070674_100514865 | 3300005356 | Bacteria | 999 |
| 46 | Ga0070673_100090673 | 3300005364 | Bacteria | 2497 |
| 47 | Ga0070688_100004005 | 3300005365 | Bacteria | 7639 |
| 48 | Ga0070688_100031996 | 3300005365 | Bacteria | 3168 |
| 49 | Ga0070659_100352474 | 3300005366 | Bacteria | 1235 |
| 50 | Ga0070659_100373836 | 3300005366 | Bacteria | 1199 |
| 51 | Ga0070659_100517068 | 3300005366 | Bacteria | 1019 |
| 52 | Ga0070667_100005709 | 3300005367 | Bacteria | 10397 |
| 53 | Ga0070667_100407087 | 3300005367 | Bacteria | 1239 |
| 54 | Ga0070709_10004024 | 3300005434 | Bacteria | 7930 |
| 55 | Ga0070714_100976032 | 3300005435 | Bacteria | 824 |
| 56 | Ga0070710_10025644 | 3300005437 | Bacteria | 3123 |
| 57 | Ga0070701_10002486 | 3300005438 | Bacteria | 7121 |
| 58 | Ga0070701_10238996 | 3300005438 | Bacteria | 1092 |
| 59 | Ga0070711_100000402 | 3300005439 | Bacteria | 22353 |
| 60 | Ga0070711_100000860 | 3300005439 | Bacteria | 15973 |
| 61 | Ga0070705_100031929 | 3300005440 | Bacteria | 2921 |
| 62 | Ga0070705_100115944 | 3300005440 | Bacteria | 1721 |
| 63 | Ga0070700_100005259 | 3300005441 | Bacteria | 6845 |
| 64 | Ga0070694_100004412 | 3300005444 | Bacteria | 8459 |
| 65 | Ga0070694_100305386 | 3300005444 | Bacteria | 1220 |
| 66 | Ga0070708_101360309 | 3300005445 | Bacteria | 663 |
| 67 | Ga0070663_100069326 | 3300005455 | Bacteria | 2561 |
| 68 | Ga0070663_100182113 | 3300005455 | Bacteria | 1630 |
| 69 | Ga0070678_100000273 | 3300005456 | Bacteria | 23976 |
| 70 | Ga0070678_100026963 | 3300005456 | Bacteria | 3893 |
| 71 | Ga0070662_100098007 | 3300005457 | Bacteria | 2213 |
| 72 | Ga0070662_100182676 | 3300005457 | Bacteria | 1654 |
| 73 | Ga0070662_100386958 | 3300005457 | Bacteria | 1152 |
| 74 | Ga0068867_100002987 | 3300005459 | Bacteria | 11917 |
| 75 | Ga0068867_100410188 | 3300005459 | Bacteria | 1145 |
| 76 | Ga0070685_10026763 | 3300005466 | Bacteria | 3181 |
| 77 | Ga0070707_100602719 | 3300005468 | Bacteria | 1061 |
| 78 | Ga0070679_100653536 | 3300005530 | Bacteria | 994 |
| 79 | Ga0070684_100026869 | 3300005535 | Bacteria | 4852 |
| 80 | Ga0070697_100688219 | 3300005536 | Bacteria | 902 |
| 81 | Ga0068853_100002811 | 3300005539 | Bacteria | 13177 |
| 82 | Ga0068853_100510569 | 3300005539 | Bacteria | 1136 |
| 83 | Ga0068853_100546987 | 3300005539 | Bacteria | 1096 |
| 84 | Ga0070686_100331292 | 3300005544 | Bacteria | 1138 |
| 85 | Ga0070695_100008824 | 3300005545 | Bacteria | 5990 |
| 86 | Ga0070695_100114250 | 3300005545 | Bacteria | 1838 |
| 87 | Ga0070696_100000796 | 3300005546 | Bacteria | 20313 |
| 88 | Ga0070696_100174628 | 3300005546 | Bacteria | 1591 |
| 89 | Ga0070693_100007039 | 3300005547 | Bacteria | 5478 |
| 90 | Ga0070693_100818455 | 3300005547 | Bacteria | 692 |
| 91 | Ga0070665_100000821 | 3300005548 | Bacteria | 40648 |
| 92 | Ga0070665_100005361 | 3300005548 | Bacteria | 13239 |
| 93 | Ga0070665_100049345 | 3300005548 | Bacteria | 4224 |
| 94 | Ga0070704_100032789 | 3300005549 | Bacteria | 3507 |
| 95 | Ga0070704_100069505 | 3300005549 | Bacteria | 2551 |
| 96 | Ga0068855_100369885 | 3300005563 | Bacteria | 1576 |
| 97 | Ga0068857_100008819 | 3300005577 | Bacteria | 8735 |
| 98 | Ga0068854_100101132 | 3300005578 | Bacteria | 2161 |
| 99 | Ga0068854_100297695 | 3300005578 | Bacteria | 1304 |
| 100 | Ga0068856_100150028 | 3300005614 | Bacteria | 2340 |
| 101 | Ga0070702_100007930 | 3300005615 | Bacteria | 5114 |
| 102 | Ga0070702_100658501 | 3300005615 | Bacteria | 793 |
| 103 | Ga0068852_100692397 | 3300005616 | Bacteria | 1029 |
| 104 | Ga0068859_100005745 | 3300005617 | Bacteria | 12616 |
| 105 | Ga0068864_100236513 | 3300005618 | Bacteria | 1691 |
| 106 | Ga0068866_10000419 | 3300005718 | Bacteria | 19721 |
| 107 | Ga0068866_10148991 | 3300005718 | Bacteria | 1352 |
| 108 | Ga0068866_10259538 | 3300005718 | Bacteria | 1067 |
| 109 | Ga0068861_100301020 | 3300005719 | Bacteria | 1389 |
| 110 | Ga0068870_10663283 | 3300005840 | Bacteria | 716 |
| 111 | Ga0068863_100048870 | 3300005841 | Bacteria | 4011 |
| 112 | Ga0068863_100567042 | 3300005841 | Bacteria | 1122 |
| 113 | Ga0068858_100022886 | 3300005842 | Bacteria | 5829 |
| 114 | Ga0068858_100050241 | 3300005842 | Bacteria | 3859 |
| 115 | Ga0068860_100000035 | 3300005843 | Bacteria | 238993 |
| 116 | Ga0068860_100000775 | 3300005843 | Bacteria | 35961 |
| 117 | Ga0068860_100498305 | 3300005843 | Bacteria | 1216 |
| 118 | Ga0068862_100005734 | 3300005844 | Bacteria | 10366 |
| 119 | Ga0068862_100199094 | 3300005844 | Bacteria | 1805 |
| 120 | Ga0081455_10011687 | 3300005937 | Bacteria | 8804 |
| 121 | Ga0081455_10077189 | 3300005937 | Bacteria | 2741 |
| 122 | Ga0081455_10185414 | 3300005937 | Bacteria | 1572 |
| 123 | Ga0081538_10004521 | 3300005981 | Bacteria | 12805 |
| 124 | Ga0081538_10012290 | 3300005981 | Bacteria | 6873 |
| 125 | Ga0081538_10031865 | 3300005981 | Bacteria | 3546 |
| 126 | Ga0081539_10003298 | 3300005985 | Bacteria | 20193 |
| 127 | Ga0070717_10234650 | 3300006028 | Bacteria | 1616 |
| 128 | Ga0075365_10049058 | 3300006038 | Bacteria | 2780 |
| 129 | Ga0075365_10077920 | 3300006038 | Bacteria | 2240 |
| 130 | Ga0075365_10265683 | 3300006038 | Bacteria | 1207 |
| 131 | Ga0075365_10314292 | 3300006038 | Bacteria | 1103 |
| 132 | Ga0075368_10090096 | 3300006042 | Bacteria | 1254 |
| 133 | Ga0075363_100002031 | 3300006048 | Bacteria | 8070 |
| 134 | Ga0075363_100013855 | 3300006048 | Bacteria | 3924 |
| 135 | Ga0075363_100022561 | 3300006048 | Bacteria | 3183 |
| 136 | Ga0075363_100023916 | 3300006048 | Bacteria | 3102 |
| 137 | Ga0075363_100089770 | 3300006048 | Bacteria | 1690 |
| 138 | Ga0075363_100093897 | 3300006048 | Bacteria | 1654 |
| 139 | Ga0075364_10000303 | 3300006051 | Bacteria | 24056 |
| 140 | Ga0075364_10011745 | 3300006051 | Bacteria | 5331 |
| 141 | Ga0075364_10040679 | 3300006051 | Bacteria | 3015 |
| 142 | Ga0075364_10084199 | 3300006051 | Bacteria | 2105 |
| 143 | Ga0070716_100000471 | 3300006173 | Bacteria | 16672 |
| 144 | Ga0070716_100017054 | 3300006173 | Bacteria | 3758 |
| 145 | Ga0070712_100115385 | 3300006175 | Bacteria | 2012 |
| 146 | Ga0070712_100212556 | 3300006175 | Bacteria | 1526 |
| 147 | Ga0075362_10011769 | 3300006177 | Bacteria | 3454 |
| 148 | Ga0075362_10060613 | 3300006177 | Bacteria | 1711 |
| 149 | Ga0075369_10000129 | 3300006186 | Bacteria | 20893 |
| 150 | Ga0075369_10242427 | 3300006186 | Bacteria | 836 |
| 151 | Ga0075369_10256598 | 3300006186 | Bacteria | 812 |
| 152 | Ga0075369_10286283 | 3300006186 | Bacteria | 768 |
| 153 | Ga0097621_100033270 | 3300006237 | Bacteria | 4104 |
| 154 | Ga0097621_100704384 | 3300006237 | Bacteria | 930 |
| 155 | Ga0075370_10180480 | 3300006353 | Bacteria | 1242 |
| 156 | Ga0075370_10372709 | 3300006353 | Bacteria | 855 |
| 157 | Ga0068865_100004325 | 3300006881 | Bacteria | 8577 |
| 158 | Ga0068865_100065650 | 3300006881 | Bacteria | 2558 |
| 159 | Ga0068865_100505892 | 3300006881 | Bacteria | 1008 |
| 160 | Ga0097620_100005745 | 3300006931 | Bacteria | 12616 |
| 161 | Ga0105250_10452626 | 3300009092 | Bacteria | 576 |
| 162 | Ga0105240_10593424 | 3300009093 | Bacteria | 1220 |
| 163 | Ga0105245_10032532 | 3300009098 | Bacteria | 4617 |
| 164 | Ga0105245_10037427 | 3300009098 | Bacteria | 4314 |
| 165 | Ga0105247_10003162 | 3300009101 | Bacteria | 10855 |
| 166 | Ga0105247_10120331 | 3300009101 | Bacteria | 1700 |
| 167 | Ga0105247_10804061 | 3300009101 | Bacteria | 718 |
| 168 | Ga0114129_10306156 | 3300009147 | Bacteria | 2116 |
| 169 | Ga0105243_10001826 | 3300009148 | Bacteria | 18210 |
| 170 | Ga0105243_10547090 | 3300009148 | Bacteria | 1105 |
| 171 | Ga0105241_10059209 | 3300009174 | Bacteria | 2944 |
| 172 | Ga0105241_10076888 | 3300009174 | Bacteria | 2604 |
| 173 | Ga0105241_11566785 | 3300009174 | Bacteria | 636 |
| 174 | Ga0105242_10000459 | 3300009176 | Bacteria | 32413 |
| 175 | Ga0105242_10023936 | 3300009176 | Bacteria | 4819 |
| 176 | Ga0105242_10841038 | 3300009176 | Bacteria | 912 |
| 177 | Ga0105248_10003999 | 3300009177 | Bacteria | 16302 |
| 178 | Ga0105248_10275424 | 3300009177 | Bacteria | 1895 |
| 179 | Ga0105237_10108924 | 3300009545 | Bacteria | 2761 |
| 180 | Ga0105237_10447552 | 3300009545 | Bacteria | 1297 |
| 181 | Ga0105238_10091684 | 3300009551 | Bacteria | 3026 |
| 182 | Ga0105238_10262247 | 3300009551 | Bacteria | 1707 |
| 183 | Ga0105249_10006558 | 3300009553 | Bacteria | 10127 |
| 184 | Ga0105249_10083288 | 3300009553 | Bacteria | 2977 |
| 185 | Ga0105249_10367509 | 3300009553 | Bacteria | 1461 |
| 186 | Ga0105249_10642350 | 3300009553 | Bacteria | 1118 |
| 187 | Ga0105249_10866566 | 3300009553 | Bacteria | 969 |
| 188 | Ga0105239_10012460 | 3300010375 | Bacteria | 9470 |
| 189 | Ga0105239_10416493 | 3300010375 | Bacteria | 1521 |
| 190 | Ga0105239_10571827 | 3300010375 | Bacteria | 1288 |
| 191 | Ga0105239_10810185 | 3300010375 | Bacteria | 1073 |
| 192 | Ga0105239_11461457 | 3300010375 | Bacteria | 790 |
| 193 | Ga0105246_10002382 | 3300011119 | Bacteria | 11342 |
| 194 | Ga0105246_10321670 | 3300011119 | Bacteria | 1257 |
| 195 | Ga0157371_10647766 | 3300013102 | Bacteria | 788 |
| 196 | Ga0157369_10019113 | 3300013105 | Bacteria | 7669 |
| 197 | Ga0157369_10140861 | 3300013105 | Bacteria | 2552 |
| 198 | Ga0157369_10531931 | 3300013105 | Bacteria | 1215 |
| 199 | Ga0157369_11669617 | 3300013105 | Bacteria | 647 |
| 200 | Ga0157374_10013307 | 3300013296 | Bacteria | 7179 |
| 201 | Ga0157374_10252377 | 3300013296 | Bacteria | 1736 |
| 202 | Ga0157378_10003979 | 3300013297 | Bacteria | 13058 |
| 203 | Ga0157378_10170604 | 3300013297 | Bacteria | 2040 |
| 204 | Ga0157378_12953374 | 3300013297 | Bacteria | 527 |
| 205 | Ga0163162_10006338 | 3300013306 | Bacteria | 11457 |
| 206 | Ga0163162_10240440 | 3300013306 | Bacteria | 1941 |
| 207 | Ga0157372_10109161 | 3300013307 | Bacteria | 3168 |
| 208 | Ga0157372_10239765 | 3300013307 | Bacteria | 2104 |
| 209 | Ga0157372_10829356 | 3300013307 | Bacteria | 1074 |
| 210 | Ga0157372_12365335 | 3300013307 | Bacteria | 610 |
| 211 | Ga0157375_10009568 | 3300013308 | Bacteria | 8510 |
| 212 | Ga0157375_10209038 | 3300013308 | Bacteria | 2108 |
| 213 | Ga0163163_10088004 | 3300014325 | Bacteria | 3117 |
| 214 | Ga0157380_10001560 | 3300014326 | Bacteria | 15073 |
| 215 | Ga0157380_10407507 | 3300014326 | Bacteria | 1292 |
| 216 | Ga0157377_10068682 | 3300014745 | Bacteria | 2043 |
| 217 | Ga0157377_10086101 | 3300014745 | Bacteria | 1846 |
| 218 | Ga0157377_10130474 | 3300014745 | Bacteria | 1534 |
| 219 | Ga0157379_10013893 | 3300014968 | Bacteria | 7057 |
| 220 | Ga0157379_10017352 | 3300014968 | Bacteria | 6342 |
| 221 | Ga0157379_10033521 | 3300014968 | Bacteria | 4579 |
| 222 | Ga0157376_10446008 | 3300014969 | Bacteria | 1261 |
| 223 | Ga0163161_10003090 | 3300017792 | Bacteria | 11750 |
| 224 | Ga0163161_10595014 | 3300017792 | Bacteria | 911 |
| 225 | Ga0163161_10849656 | 3300017792 | Bacteria | 770 |
| 226 | Ga0197907_10828368 | 3300020069 | Bacteria | 1799 |
| 227 | Ga0213873_10037562 | 3300021358 | Bacteria | 1234 |
| 228 | Ga0213875_10065288 | 3300021388 | Bacteria | 1701 |
| 229 | Ga0224712_10075666 | 3300022467 | Bacteria | 1378 |
| 230 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 231 | Ga0209563_100028 | 3300025230 | Bacteria | 509539 |
| 232 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 233 | Ga0209646_1003803 | 3300025246 | Bacteria | 2885 |
| 234 | Ga0209026_1000281 | 3300025250 | Bacteria | 58797 |
| 235 | Ga0209148_1000016 | 3300025254 | Bacteria | 804369 |
| 236 | Ga0209759_1008527 | 3300025256 | Bacteria | 3184 |
| 237 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 238 | Ga0207642_10004024 | 3300025899 | Bacteria | 4702 |
| 239 | Ga0207642_10085089 | 3300025899 | Bacteria | 1547 |
| 240 | Ga0207642_10278779 | 3300025899 | Bacteria | 961 |
| 241 | Ga0207710_10004040 | 3300025900 | Bacteria | 6454 |
| 242 | Ga0207688_10010768 | 3300025901 | Bacteria | 4977 |
| 243 | Ga0207680_10003070 | 3300025903 | Bacteria | 7838 |
| 244 | Ga0207680_10010590 | 3300025903 | Bacteria | 4619 |
| 245 | Ga0207647_10066300 | 3300025904 | Bacteria | 2189 |
| 246 | Ga0207647_10080074 | 3300025904 | Bacteria | 1960 |
| 247 | Ga0207647_10248643 | 3300025904 | Bacteria | 1020 |
| 248 | Ga0207685_10001517 | 3300025905 | Bacteria | 4910 |
| 249 | Ga0207699_10014305 | 3300025906 | Bacteria | 4087 |
| 250 | Ga0207645_10038444 | 3300025907 | Bacteria | 3069 |
| 251 | Ga0207645_10166126 | 3300025907 | Bacteria | 1445 |
| 252 | Ga0207705_10765082 | 3300025909 | Bacteria | 750 |
| 253 | Ga0207654_10139797 | 3300025911 | Bacteria | 1543 |
| 254 | Ga0207654_10209233 | 3300025911 | Bacteria | 1288 |
| 255 | Ga0207654_10709275 | 3300025911 | Bacteria | 723 |
| 256 | Ga0207671_10410821 | 3300025914 | Bacteria | 1077 |
| 257 | Ga0207671_10478155 | 3300025914 | Bacteria | 993 |
| 258 | Ga0207671_10979625 | 3300025914 | Bacteria | 667 |
| 259 | Ga0207693_10000381 | 3300025915 | Bacteria | 40785 |
| 260 | Ga0207693_10001414 | 3300025915 | Bacteria | 21264 |
| 261 | Ga0207663_10004663 | 3300025916 | Bacteria | 6840 |
| 262 | Ga0207663_10324343 | 3300025916 | Bacteria | 1158 |
| 263 | Ga0207663_10505795 | 3300025916 | Bacteria | 939 |
| 264 | Ga0207660_10125433 | 3300025917 | Bacteria | 1949 |
| 265 | Ga0207662_10089950 | 3300025918 | Bacteria | 1887 |
| 266 | Ga0207657_10225338 | 3300025919 | Bacteria | 1501 |
| 267 | Ga0207657_10605984 | 3300025919 | Bacteria | 854 |
| 268 | Ga0207652_10361109 | 3300025921 | Bacteria | 1311 |
| 269 | Ga0207652_10551588 | 3300025921 | Bacteria | 1036 |
| 270 | Ga0207681_10112725 | 3300025923 | Bacteria | 1981 |
| 271 | Ga0207681_10156179 | 3300025923 | Bacteria | 1715 |
| 272 | Ga0207694_10099044 | 3300025924 | Bacteria | 2309 |
| 273 | Ga0207694_10305147 | 3300025924 | Bacteria | 1311 |
| 274 | Ga0207687_10000587 | 3300025927 | Bacteria | 24594 |
| 275 | Ga0207687_10530327 | 3300025927 | Bacteria | 986 |
| 276 | Ga0207664_10190289 | 3300025929 | Bacteria | 1766 |
| 277 | Ga0207664_11069970 | 3300025929 | Bacteria | 722 |
| 278 | Ga0207644_10308513 | 3300025931 | Bacteria | 1277 |
| 279 | Ga0207690_10532665 | 3300025932 | Bacteria | 953 |
| 280 | Ga0207690_10707389 | 3300025932 | Bacteria | 829 |
| 281 | Ga0207706_10046021 | 3300025933 | Bacteria | 3864 |
| 282 | Ga0207686_10015983 | 3300025934 | Bacteria | 4206 |
| 283 | Ga0207709_10028683 | 3300025935 | Bacteria | 3220 |
| 284 | Ga0207709_10210212 | 3300025935 | Bacteria | 1396 |
| 285 | Ga0207670_10006540 | 3300025936 | Bacteria | 6470 |
| 286 | Ga0207669_10001288 | 3300025937 | Bacteria | 10653 |
| 287 | Ga0207704_10001708 | 3300025938 | Bacteria | 9820 |
| 288 | Ga0207704_10055306 | 3300025938 | Bacteria | 2425 |
| 289 | Ga0207704_10341437 | 3300025938 | Bacteria | 1162 |
| 290 | Ga0207665_10021570 | 3300025939 | Bacteria | 4236 |
| 291 | Ga0207665_10134296 | 3300025939 | Bacteria | 1759 |
| 292 | Ga0207711_10029205 | 3300025941 | Bacteria | 4647 |
| 293 | Ga0207711_10115504 | 3300025941 | Bacteria | 2392 |
| 294 | Ga0207689_10016281 | 3300025942 | Bacteria | 6298 |
| 295 | Ga0207689_10017429 | 3300025942 | Bacteria | 6077 |
| 296 | Ga0207689_10474131 | 3300025942 | Bacteria | 1047 |
| 297 | Ga0207661_10231513 | 3300025944 | Bacteria | 1636 |
| 298 | Ga0207661_11814922 | 3300025944 | Bacteria | 555 |
| 299 | Ga0207679_10804914 | 3300025945 | Bacteria | 857 |
| 300 | Ga0207679_10986905 | 3300025945 | Bacteria | 772 |
| 301 | Ga0207667_10363536 | 3300025949 | Bacteria | 1476 |
| 302 | Ga0207651_10485760 | 3300025960 | Bacteria | 1065 |
| 303 | Ga0207712_10033254 | 3300025961 | Bacteria | 3484 |
| 304 | Ga0207712_10264942 | 3300025961 | Bacteria | 1395 |
| 305 | Ga0207712_10361870 | 3300025961 | Bacteria | 1209 |
| 306 | Ga0207712_10911101 | 3300025961 | Bacteria | 777 |
| 307 | Ga0207712_11002999 | 3300025961 | Bacteria | 741 |
| 308 | Ga0207668_10004077 | 3300025972 | Bacteria | 8587 |
| 309 | Ga0207668_10007345 | 3300025972 | Bacteria | 6549 |
| 310 | Ga0207668_11367761 | 3300025972 | Bacteria | 638 |
| 311 | Ga0207640_10013690 | 3300025981 | Bacteria | 4654 |
| 312 | Ga0207640_10274045 | 3300025981 | Bacteria | 1322 |
| 313 | Ga0207640_10508933 | 3300025981 | Bacteria | 1004 |
| 314 | Ga0207640_10848419 | 3300025981 | Bacteria | 795 |
| 315 | Ga0207658_10017204 | 3300025986 | Bacteria | 4981 |
| 316 | Ga0207677_10310657 | 3300026023 | Bacteria | 1306 |
| 317 | Ga0207677_10690804 | 3300026023 | Bacteria | 904 |
| 318 | Ga0207703_10039188 | 3300026035 | Bacteria | 3786 |
| 319 | Ga0207703_10056148 | 3300026035 | Bacteria | 3206 |
| 320 | Ga0207703_10385246 | 3300026035 | Bacteria | 1298 |
| 321 | Ga0207639_10018307 | 3300026041 | Bacteria | 4977 |
| 322 | Ga0207639_10133457 | 3300026041 | Bacteria | 2059 |
| 323 | Ga0207678_10004848 | 3300026067 | Bacteria | 12086 |
| 324 | Ga0207678_10093791 | 3300026067 | Bacteria | 2564 |
| 325 | Ga0207708_10018949 | 3300026075 | Bacteria | 5183 |
| 326 | Ga0207708_10176416 | 3300026075 | Bacteria | 1695 |
| 327 | Ga0207702_10052727 | 3300026078 | Bacteria | 3443 |
| 328 | Ga0207702_10377407 | 3300026078 | Bacteria | 1363 |
| 329 | Ga0207641_10012729 | 3300026088 | Bacteria | 6897 |
| 330 | Ga0207641_10464498 | 3300026088 | Bacteria | 1225 |
| 331 | Ga0207648_10000462 | 3300026089 | Bacteria | 45206 |
| 332 | Ga0207648_10073136 | 3300026089 | Bacteria | 2988 |
| 333 | Ga0207676_10127111 | 3300026095 | Bacteria | 2161 |
| 334 | Ga0207676_10526579 | 3300026095 | Bacteria | 1126 |
| 335 | Ga0207674_10014897 | 3300026116 | Bacteria | 8573 |
| 336 | Ga0207675_100000768 | 3300026118 | Bacteria | 31981 |
| 337 | Ga0207675_100266320 | 3300026118 | Bacteria | 1662 |
| 338 | Ga0207675_100447979 | 3300026118 | Bacteria | 1279 |
| 339 | Ga0207683_10000575 | 3300026121 | Bacteria | 33996 |
| 340 | Ga0207683_10150507 | 3300026121 | Bacteria | 2100 |
| 341 | Ga0207698_10067881 | 3300026142 | Bacteria | 2814 |
| 342 | Ga0207698_10967468 | 3300026142 | Bacteria | 861 |
| 343 | Ga0268266_10003777 | 3300028379 | Bacteria | 14835 |
| 344 | Ga0268266_10084714 | 3300028379 | Bacteria | 2768 |
| 345 | Ga0268265_10014518 | 3300028380 | Bacteria | 5369 |
| 346 | Ga0268265_10692889 | 3300028380 | Bacteria | 983 |
| 347 | Ga0268264_10000031 | 3300028381 | Bacteria | 409525 |
| 348 | Ga0268264_10004232 | 3300028381 | Bacteria | 12249 |
| 349 | Ga0268264_10420373 | 3300028381 | Bacteria | 1289 |
| 350 | Ga0268264_12157866 | 3300028381 | Bacteria | 565 |
| 351 | Ga0265338_10027056 | 3300028800 | Bacteria | 5765 |
| 352 | Ga0265327_10010227 | 3300031251 | Bacteria | 6627 |
| 353 | Ga0307409_100604709 | 3300031995 | Bacteria | 1084 |
| 354 | Ga0373949_0076523 | 3300035090 | Bacteria | 885 |
| 355 | Ga0373949_0173788 | 3300035090 | Bacteria | 634 |
| 356 | Ga0373923_0022109 | 3300035111 | Bacteria | 2490 |
| 357 | Ga0373960_0356500 | 3300035121 | Bacteria | 556 |
| 358 | Ga0373935_1288236 | 3300035692 | Bacteria | 545 |
| 359 | Ga0436364_0332337 | 3300037853 | Bacteria | 1098 |
| 360 | Ga0436364_0406475 | 3300037853 | Bacteria | 2798 |
| 361 | Ga0436364_1019987 | 3300037853 | Bacteria | 1980 |
| 362 | Ga0436362_0337613 | 3300039453 | Bacteria | 1541 |
| 363 | Ga0451797_0578190 | 3300041453 | Bacteria | 1421 |
| 364 | Ga0451807_2424073 | 3300041486 | Bacteria | 642 |
| 365 | Ga0451843_0327092 | 3300041509 | Bacteria | 981 |
| 366 | Ga0451853_2158879 | 3300041512 | Bacteria | 1305 |
| 367 | Ga0466969_0065346 | 3300044656 | Bacteria | 1759 |
| 368 | Ga0466969_0085665 | 3300044656 | Bacteria | 1498 |
| 369 | Ga0466969_0099441 | 3300044656 | Bacteria | 1371 |
| 370 | Ga0466972_0012804 | 3300044658 | Bacteria | 4212 |
| 371 | Ga0466972_0016581 | 3300044658 | Bacteria | 3683 |
| 372 | Ga0466972_0056586 | 3300044658 | Bacteria | 1886 |
| 373 | Ga0466965_0000685 | 3300044683 | Bacteria | 12514 |
| 374 | Ga0466965_0051130 | 3300044683 | Bacteria | 2050 |
| 375 | Ga0466965_0407571 | 3300044683 | Bacteria | 752 |
| 376 | Ga0466965_0519921 | 3300044683 | Bacteria | 669 |
| 377 | Ga0466966_0013868 | 3300044684 | Bacteria | 5334 |
| 378 | Ga0466966_0058391 | 3300044684 | Bacteria | 2438 |
| 379 | Ga0466966_0067623 | 3300044684 | Bacteria | 2244 |
| 380 | Ga0466966_0159544 | 3300044684 | Bacteria | 1373 |
| 381 | Ga0466966_0196883 | 3300044684 | Bacteria | 1220 |
| 382 | Ga0466961_0005936 | 3300044693 | Bacteria | 7741 |
| 383 | Ga0466961_0054471 | 3300044693 | Bacteria | 2551 |
| 384 | Ga0466961_0101936 | 3300044693 | Bacteria | 1808 |
| 385 | Ga0466961_0142303 | 3300044693 | Bacteria | 1501 |
| 386 | Ga0466961_0470870 | 3300044693 | Bacteria | 760 |
| 387 | Ga0466963_0059216 | 3300044694 | Bacteria | 2556 |
| 388 | Ga0466963_0107554 | 3300044694 | Bacteria | 1913 |
| 389 | Ga0466963_0497531 | 3300044694 | Bacteria | 861 |
| 390 | Ga0466963_0592075 | 3300044694 | Bacteria | 783 |
| 391 | Ga0466964_0052557 | 3300044706 | Bacteria | 1675 |
| 392 | Ga0466964_0086649 | 3300044706 | Bacteria | 1355 |
| 393 | Ga0466964_0141666 | 3300044706 | Bacteria | 1106 |
| 394 | Ga0466964_0202030 | 3300044706 | Bacteria | 955 |
| 395 | Ga0466971_0024229 | 3300044719 | Bacteria | 2708 |
| 396 | Ga0466971_0620940 | 3300044719 | Bacteria | 540 |
| 397 | Ga0466968_0000928 | 3300044735 | Bacteria | 10322 |
| 398 | Ga0466968_0260617 | 3300044735 | Bacteria | 825 |
| 399 | Ga0466970_0077642 | 3300044765 | Bacteria | 1790 |
| 400 | Ga0466970_0089151 | 3300044765 | Bacteria | 1673 |
| 401 | Ga0466970_0157229 | 3300044765 | Bacteria | 1256 |
| 402 | Ga0466970_0372336 | 3300044765 | Bacteria | 812 |
| 403 | Ga0466970_0524568 | 3300044765 | Bacteria | 683 |
| 404 | Ga0466957_0006881 | 3300044842 | Bacteria | 6425 |
| 405 | Ga0466957_0065269 | 3300044842 | Bacteria | 2241 |
| 406 | Ga0466957_0297004 | 3300044842 | Bacteria | 1084 |
| 407 | Ga0466960_0108912 | 3300044901 | Bacteria | 1436 |
| 408 | Ga0466960_0300440 | 3300044901 | Bacteria | 904 |
| 409 | Ga0466960_0338013 | 3300044901 | Bacteria | 856 |
| 410 | Ga0466959_0020726 | 3300045049 | Bacteria | 4844 |
| 411 | Ga0466959_0032197 | 3300045049 | Bacteria | 3881 |
| 412 | Ga0466959_0199351 | 3300045049 | Bacteria | 1394 |
| 413 | Ga0466959_0302738 | 3300045049 | Bacteria | 1094 |
| 414 | Ga0466959_0322550 | 3300045049 | Bacteria | 1056 |
| 415 | Ga0466959_0459689 | 3300045049 | Bacteria | 862 |
| 416 | Ga0466959_0527514 | 3300045049 | Bacteria | 797 |
| 417 | Ga0451576_0250245 | 3300045051 | Bacteria | 1852 |
| 418 | Ga0466958_0003414 | 3300045836 | Bacteria | 8245 |
| 419 | Ga0466958_0006577 | 3300045836 | Bacteria | 6336 |
| 420 | Ga0466958_0037102 | 3300045836 | Bacteria | 2919 |
| 421 | Ga0466958_0095622 | 3300045836 | Bacteria | 1842 |
| 422 | Ga0466958_0309393 | 3300045836 | Bacteria | 1015 |
| 423 | Ga0466958_0326190 | 3300045836 | Bacteria | 987 |
| 424 | Ga0466958_0459081 | 3300045836 | Bacteria | 825 |
| 425 | Ga0466967_0007720 | 3300045976 | Bacteria | 7798 |
| 426 | Ga0466967_0028377 | 3300045976 | Bacteria | 4672 |
| 427 | Ga0466967_0089596 | 3300045976 | Bacteria | 2793 |
| 428 | Ga0466967_0126986 | 3300045976 | Bacteria | 2363 |
| 429 | Ga0466967_0262998 | 3300045976 | Bacteria | 1651 |
| 430 | Ga0466967_0263007 | 3300045976 | Bacteria | 1651 |
| 431 | Ga0466967_0464415 | 3300045976 | Bacteria | 1238 |
| 432 | Ga0495638_0000563 | 3300046460 | Bacteria | 42248 |
| 433 | Ga0495641_0121577 | 3300046461 | Bacteria | 1165 |
| 434 | Ga0495582_0614298 | 3300046473 | Bacteria | 629 |
| 435 | Ga0495639_0111775 | 3300046475 | Bacteria | 1297 |
| 436 | Ga0495585_0120502 | 3300046492 | Bacteria | 1388 |
| 437 | Ga0495608_0285103 | 3300046511 | Bacteria | 1024 |
| 438 | Ga0495666_0095129 | 3300046526 | Bacteria | 1405 |
| 439 | Ga0495652_0711185 | 3300046529 | Bacteria | 675 |
| 440 | Ga0495665_0486225 | 3300046531 | Bacteria | 622 |
| 441 | Ga0495640_0044374 | 3300046533 | Bacteria | 3091 |
| 442 | Ga0495640_0461776 | 3300046533 | Bacteria | 775 |
| 443 | Ga0495634_0091948 | 3300046642 | Bacteria | 1969 |
| 444 | Ga0495611_0424511 | 3300046648 | Bacteria | 607 |
| 445 | Ga0495625_0148674 | 3300046660 | Bacteria | 1576 |
| 446 | Ga0495625_0534438 | 3300046660 | Bacteria | 712 |
| 447 | Ga0495635_0457265 | 3300046663 | Bacteria | 843 |
| 448 | Ga0495657_0350130 | 3300046675 | Bacteria | 874 |
| 449 | Ga0495658_0188015 | 3300046683 | Bacteria | 1283 |
| 450 | Ga0495613_0527106 | 3300046689 | Bacteria | 793 |
| 451 | Ga0495649_0201929 | 3300046694 | Bacteria | 1032 |
| 452 | Ga0495649_0415441 | 3300046694 | Bacteria | 674 |
| 453 | Ga0495674_0514288 | 3300047319 | Bacteria | 956 |
| 454 | Ga0495676_0648472 | 3300047321 | Bacteria | 685 |
| 455 | Ga0495680_0072616 | 3300047322 | Bacteria | 2617 |
| 456 | Ga0495593_0030322 | 3300047673 | Bacteria | 2960 |
| 457 | Ga0495626_0267001 | 3300048091 | Bacteria | 683 |
| 458 | Ga0496100_0007272 | 3300048903 | Bacteria | 6091 |
| 459 | Ga0496100_0480218 | 3300048903 | Bacteria | 956 |
| 460 | Ga0496101_0027794 | 3300048904 | Bacteria | 3944 |
| 461 | Ga0496102_0001190 | 3300048905 | Bacteria | 23615 |
| 462 | Ga0496102_0101907 | 3300048905 | Bacteria | 2668 |
| 463 | Ga0496102_0833475 | 3300048905 | Bacteria | 844 |
| 464 | Ga0496103_0001391 | 3300048906 | Bacteria | 16284 |
| 465 | Ga0496103_0092510 | 3300048906 | Bacteria | 1909 |
| 466 | Ga0496104_0073058 | 3300048907 | Bacteria | 3263 |
| 467 | Ga0496106_0010229 | 3300048909 | Bacteria | 6934 |
| 468 | Ga0496106_0186141 | 3300048909 | Bacteria | 1650 |
| 469 | Ga0496106_0549226 | 3300048909 | Bacteria | 927 |
| 470 | Ga0496107_0000760 | 3300048910 | Bacteria | 18575 |
| 471 | Ga0496107_0160349 | 3300048910 | Bacteria | 1667 |
| 472 | Ga0496107_0358006 | 3300048910 | Bacteria | 1086 |
| 473 | Ga0496107_0522359 | 3300048910 | Bacteria | 880 |
| 474 | Ga0496107_0558328 | 3300048910 | Bacteria | 848 |
| 475 | Ga0496107_1270335 | 3300048910 | Bacteria | 527 |
| 476 | Ga0496108_0010094 | 3300048911 | Bacteria | 7663 |
| 477 | Ga0496108_0011269 | 3300048911 | Bacteria | 7264 |
| 478 | Ga0496108_0034514 | 3300048911 | Bacteria | 4204 |
| 479 | Ga0496108_0466524 | 3300048911 | Bacteria | 1103 |
| 480 | Ga0496108_0738885 | 3300048911 | Bacteria | 852 |
| 481 | Ga0496108_0848471 | 3300048911 | Bacteria | 786 |
| 482 | Ga0496108_1753196 | 3300048911 | Bacteria | 510 |
| 483 | Ga0496109_0002148 | 3300048912 | Bacteria | 16388 |
| 484 | Ga0496109_0042367 | 3300048912 | Bacteria | 4123 |
| 485 | Ga0496110_0380003 | 3300048913 | Bacteria | 1287 |
| 486 | Ga0496111_0040429 | 3300048914 | Bacteria | 3345 |
| 487 | Ga0496111_0085836 | 3300048914 | Bacteria | 2302 |
| 488 | Ga0496111_0234739 | 3300048914 | Bacteria | 1362 |
| 489 | Ga0496113_0165653 | 3300048916 | Bacteria | 1749 |
| 490 | Ga0496113_0242246 | 3300048916 | Bacteria | 1439 |
| 491 | Ga0496114_0001875 | 3300048917 | Bacteria | 15936 |
| 492 | Ga0496115_0004439 | 3300048918 | Bacteria | 10169 |
| 493 | Ga0501034_0003091 | 3300049571 | Bacteria | 19192 |
| 494 | Ga0501034_0204785 | 3300049571 | Bacteria | 1930 |
| 495 | Ga0501037_0439646 | 3300049573 | Bacteria | 891 |
| 496 | Ga0501043_1131343 | 3300049579 | Bacteria | 552 |
| 497 | Ga0501047_0642600 | 3300049581 | Bacteria | 881 |
| 498 | Ga0501047_0857831 | 3300049581 | Bacteria | 722 |
| 499 | Ga0501047_0903648 | 3300049581 | Bacteria | 696 |
| 500 | Ga0501047_1063196 | 3300049581 | Bacteria | 623 |
| 501 | Ga0501067_0026209 | 3300049583 | Bacteria | 3230 |
| 502 | Ga0501067_0634284 | 3300049583 | Bacteria | 600 |
| 503 | Ga0501068_0003128 | 3300049584 | Bacteria | 8856 |
| 504 | Ga0501068_0083003 | 3300049584 | Bacteria | 1969 |
| 505 | Ga0501069_0000052 | 3300049585 | Bacteria | 69909 |
| 506 | Ga0501070_0000030 | 3300049586 | Bacteria | 139270 |
| 507 | Ga0501070_0069240 | 3300049586 | Bacteria | 2921 |
| 508 | Ga0501070_0420279 | 3300049586 | Bacteria | 1080 |
| 509 | Ga0501070_0505064 | 3300049586 | Bacteria | 971 |
| 510 | Ga0501070_0595798 | 3300049586 | Bacteria | 881 |
| 511 | Ga0501071_0022503 | 3300049587 | Bacteria | 4394 |
| 512 | Ga0501071_0241466 | 3300049587 | Bacteria | 1362 |
| 513 | Ga0501071_1092998 | 3300049587 | Bacteria | 616 |
| 514 | Ga0501072_0171672 | 3300049588 | Bacteria | 1730 |
| 515 | Ga0501073_0017820 | 3300049589 | Bacteria | 5140 |
| 516 | Ga0501073_0262430 | 3300049589 | Bacteria | 1192 |
| 517 | Ga0501074_0035839 | 3300049590 | Bacteria | 3594 |
| 518 | Ga0501080_0004387 | 3300049742 | Bacteria | 12532 |
| 519 | Ga0501080_0019341 | 3300049742 | Bacteria | 6309 |
| 520 | Ga0501080_0128721 | 3300049742 | Bacteria | 2344 |
| 521 | Ga0501080_0529539 | 3300049742 | Bacteria | 1051 |
| 522 | Ga0501083_0005470 | 3300049744 | Bacteria | 8996 |
| 523 | Ga0501083_0622060 | 3300049744 | Bacteria | 702 |
| 524 | Ga0501044_0265740 | 3300049823 | Bacteria | 1653 |
| 525 | nmdc:mga03683_21876_c1 | 3300050489 | Bacteria | 2472 |
| 526 | nmdc:mga03683_69745_c1 | 3300050489 | Bacteria | 1500 |
| 527 | nmdc:mga03n38_10885_c1 | 3300050490 | Bacteria | 3368 |
| 528 | nmdc:mga03n38_23297_c1 | 3300050490 | Bacteria | 2517 |
| 529 | nmdc:mga03n38_3586_c1 | 3300050490 | Bacteria | 5012 |
| 530 | nmdc:mga03n38_4344_c1 | 3300050490 | Bacteria | 4682 |
| 531 | nmdc:mga03n38_789072_c1 | 3300050490 | Bacteria | 552 |
| 532 | nmdc:mga03n38_8261_c1 | 3300050490 | Bacteria | 3727 |
| 533 | nmdc:mga03n38_829130_c1 | 3300050490 | Bacteria | 540 |
| 534 | nmdc:mga00v17_143508_c1 | 3300050491 | Bacteria | 1532 |
| 535 | nmdc:mga00v17_206426_c1 | 3300050491 | Bacteria | 1271 |
| 536 | nmdc:mga00v17_37521_c1 | 3300050491 | Bacteria | 2895 |
| 537 | nmdc:mga00v17_39824_c1 | 3300050491 | Bacteria | 2816 |
| 538 | nmdc:mga00v17_5446_c1 | 3300050491 | Bacteria | 6702 |
| 539 | nmdc:mga0yw44_142464_c1 | 3300050492 | Bacteria | 1558 |
| 540 | nmdc:mga0yw44_15301_c1 | 3300050492 | Bacteria | 4105 |
| 541 | nmdc:mga0yw44_215454_c1 | 3300050492 | Bacteria | 1271 |
| 542 | nmdc:mga0yw44_464056_c1 | 3300050492 | Bacteria | 858 |
| 543 | nmdc:mga0yw44_758273_c1 | 3300050492 | Bacteria | 659 |
| 544 | nmdc:mga0yw44_98777_c1 | 3300050492 | Bacteria | 1857 |
| 545 | nmdc:mga06z11_140360_c1 | 3300050494 | Bacteria | 1365 |
| 546 | nmdc:mga06z11_4117_c1 | 3300050494 | Bacteria | 5681 |
| 547 | nmdc:mga06z11_86081_c1 | 3300050494 | Bacteria | 1697 |
| 548 | nmdc:mga04h51_174928_c1 | 3300050495 | Bacteria | 833 |
| 549 | nmdc:mga07m45_50544_c1 | 3300050496 | Bacteria | 2343 |
| 550 | nmdc:mga07m45_80553_c1 | 3300050496 | Bacteria | 1859 |
| 551 | nmdc:mga0qj67_419368_c1 | 3300050509 | Bacteria | 1079 |
| 552 | nmdc:mga0sz30_2742_c1 | 3300050516 | Bacteria | 6286 |
| 553 | nmdc:mga0sz30_73493_c1 | 3300050516 | Bacteria | 1474 |
| 554 | nmdc:mga0sz30_93514_c1 | 3300050516 | Bacteria | 1309 |
| 555 | Ga0500610_0245956 | 3300053079 | Bacteria | 828 |
| 556 | Ga0495655_0003715 | 3300053083 | Bacteria | 2545 |
| 557 | Ga0495619_0221785 | 3300053085 | Bacteria | 1310 |
| 558 | Ga0495619_0268887 | 3300053085 | Bacteria | 1181 |
| 559 | Ga0500644_0040039 | 3300053088 | Bacteria | 1549 |
| 560 | Ga0500556_0253053 | 3300053104 | Bacteria | 693 |
| 561 | Ga0500562_040357 | 3300053108 | Bacteria | 1241 |
| 562 | Ga0500628_161399 | 3300053129 | Bacteria | 632 |
| 563 | Ga0500577_0311419 | 3300053142 | Bacteria | 687 |
| 564 | Ga0500604_0111155 | 3300053151 | Bacteria | 910 |
| 565 | Ga0590071_008796 | 3300059421 | Bacteria | 2373 |
| 566 | Ga0590074_015218 | 3300059423 | Bacteria | 1305 |
| 567 | Ga0590075_002363 | 3300059424 | Bacteria | 4530 |
| 568 | Ga0590075_022717 | 3300059424 | Bacteria | 1570 |
| 569 | Ga0590077_003731 | 3300059426 | Bacteria | 3143 |
| 570 | Ga0590077_051866 | 3300059426 | Bacteria | 921 |
| 571 | Ga0501082_0392410 | 3300060353 | Bacteria | 1211 |
| 572 | Ga0466962_0049026 | 3300061719 | Bacteria | 2018 |
| 573 | Ga0466962_0537305 | 3300061719 | Bacteria | 593 |
| 574 | Ga0466962_0546680 | 3300061719 | Bacteria | 588 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044658 | Ga0466972_0056586 | Ga0466972_0056586_517_924 | 133 |
| 2 | 3300035121 | Ga0373960_0356500 | Ga0373960_0356500_84_506 | 134 |
| 3 | 3300010375 | Ga0105239_11461457 | Ga0105239_114614572 | 135 |
| 4 | 3300013297 | Ga0157378_12953374 | Ga0157378_129533741 | 135 |
| 5 | 3300025945 | Ga0207679_10986905 | Ga0207679_109869051 | 135 |
| 6 | 3300028800 | Ga0265338_10027056 | Ga0265338_100270569 | 135 |
| 7 | 3300031251 | Ga0265327_10010227 | Ga0265327_100102273 | 135 |
| 8 | 3300044658 | Ga0466972_0016581 | Ga0466972_0016581_1742_2149 | 135 |
| 9 | 3300044684 | Ga0466966_0159544 | Ga0466966_0159544_634_1041 | 135 |
| 10 | 3300044693 | Ga0466961_0142303 | Ga0466961_0142303_331_747 | 135 |
| 11 | 3300044706 | Ga0466964_0052557 | Ga0466964_0052557_287_703 | 135 |
| 12 | 3300044719 | Ga0466971_0024229 | Ga0466971_0024229_200_616 | 135 |
| 13 | 3300044719 | Ga0466971_0620940 | Ga0466971_0620940_109_525 | 135 |
| 14 | 3300044735 | Ga0466968_0260617 | Ga0466968_0260617_128_544 | 135 |
| 15 | 3300044765 | Ga0466970_0157229 | Ga0466970_0157229_503_910 | 135 |
| 16 | 3300044842 | Ga0466957_0065269 | Ga0466957_0065269_677_1084 | 135 |
| 17 | 3300045049 | Ga0466959_0302738 | Ga0466959_0302738_313_720 | 135 |
| 18 | 3300045836 | Ga0466958_0037102 | Ga0466958_0037102_839_1255 | 135 |
| 19 | 3300061719 | Ga0466962_0049026 | Ga0466962_0049026_1091_1507 | 135 |
| 20 | 3300001977 | JGI24746J21847_1005511 | JGI24746J21847_10055112 | 136 |
| 21 | 3300001989 | JGI24739J22299_10031098 | JGI24739J22299_100310982 | 136 |
| 22 | 3300001990 | JGI24737J22298_10055191 | JGI24737J22298_100551912 | 136 |
| 23 | 3300001990 | JGI24737J22298_10094541 | JGI24737J22298_100945412 | 136 |
| 24 | 3300001990 | JGI24737J22298_10172141 | JGI24737J22298_101721411 | 136 |
| 25 | 3300001991 | JGI24743J22301_10006415 | JGI24743J22301_100064152 | 136 |
| 26 | 3300002073 | JGI24745J21846_1003847 | JGI24745J21846_10038472 | 136 |
| 27 | 3300002075 | JGI24738J21930_10011625 | JGI24738J21930_100116253 | 136 |
| 28 | 3300002077 | JGI24744J21845_10007872 | JGI24744J21845_100078723 | 136 |
| 29 | 3300002244 | JGI24742J22300_10005704 | JGI24742J22300_100057043 | 136 |
| 30 | 3300002705 | JGI25156J39149_1027211 | JGI25156J39149_10272112 | 136 |
| 31 | 3300002738 | JGI25154J39366_1028162 | JGI25154J39366_10281621 | 136 |
| 32 | 3300002741 | JGI25157J39369_1007493 | JGI25157J39369_10074932 | 136 |
| 33 | 3300003203 | JGI25406J46586_10009256 | JGI25406J46586_100092563 | 136 |
| 34 | 3300003373 | JGI25407J50210_10038829 | JGI25407J50210_100388292 | 136 |
| 35 | 3300003760 | Ga0055527_1000071 | Ga0055527_100007131 | 136 |
| 36 | 3300003761 | Ga0055535_1000213 | Ga0055535_100021323 | 136 |
| 37 | 3300003762 | Ga0055542_1000161 | Ga0055542_100016131 | 136 |
| 38 | 3300003763 | Ga0055529_1000272 | Ga0055529_100027223 | 136 |
| 39 | 3300005327 | Ga0070658_10619519 | Ga0070658_106195192 | 136 |
| 40 | 3300005328 | Ga0070676_10028008 | Ga0070676_100280082 | 136 |
| 41 | 3300005329 | Ga0070683_100032193 | Ga0070683_1000321936 | 136 |
| 42 | 3300005329 | Ga0070683_101583279 | Ga0070683_1015832791 | 136 |
| 43 | 3300005334 | Ga0068869_100036967 | Ga0068869_1000369672 | 136 |
| 44 | 3300005335 | Ga0070666_10002633 | Ga0070666_100026332 | 136 |
| 45 | 3300005336 | Ga0070680_100201705 | Ga0070680_1002017052 | 136 |
| 46 | 3300005337 | Ga0070682_100016612 | Ga0070682_1000166122 | 136 |
| 47 | 3300005337 | Ga0070682_100025176 | Ga0070682_1000251765 | 136 |
| 48 | 3300005337 | Ga0070682_100418537 | Ga0070682_1004185373 | 136 |
| 49 | 3300005338 | Ga0068868_100002656 | Ga0068868_1000026564 | 136 |
| 50 | 3300005338 | Ga0068868_100634853 | Ga0068868_1006348532 | 136 |
| 51 | 3300005339 | Ga0070660_100060619 | Ga0070660_1000606192 | 136 |
| 52 | 3300005339 | Ga0070660_100328157 | Ga0070660_1003281572 | 136 |
| 53 | 3300005340 | Ga0070689_100016638 | Ga0070689_1000166383 | 136 |
| 54 | 3300005341 | Ga0070691_10134204 | Ga0070691_101342042 | 136 |
| 55 | 3300005341 | Ga0070691_10274115 | Ga0070691_102741151 | 136 |
| 56 | 3300005344 | Ga0070661_100085923 | Ga0070661_1000859233 | 136 |
| 57 | 3300005347 | Ga0070668_100000347 | Ga0070668_1000003473 | 136 |
| 58 | 3300005347 | Ga0070668_100001780 | Ga0070668_10000178014 | 136 |
| 59 | 3300005347 | Ga0070668_100127838 | Ga0070668_1001278382 | 136 |
| 60 | 3300005353 | Ga0070669_100039437 | Ga0070669_1000394372 | 136 |
| 61 | 3300005354 | Ga0070675_100317031 | Ga0070675_1003170311 | 136 |
| 62 | 3300005355 | Ga0070671_100029440 | Ga0070671_1000294406 | 136 |
| 63 | 3300005356 | Ga0070674_100003233 | Ga0070674_1000032338 | 136 |
| 64 | 3300005356 | Ga0070674_100514865 | Ga0070674_1005148652 | 136 |
| 65 | 3300005364 | Ga0070673_100090673 | Ga0070673_1000906734 | 136 |
| 66 | 3300005365 | Ga0070688_100004005 | Ga0070688_1000040054 | 136 |
| 67 | 3300005365 | Ga0070688_100031996 | Ga0070688_1000319963 | 136 |
| 68 | 3300005366 | Ga0070659_100352474 | Ga0070659_1003524742 | 136 |
| 69 | 3300005366 | Ga0070659_100373836 | Ga0070659_1003738362 | 136 |
| 70 | 3300005366 | Ga0070659_100517068 | Ga0070659_1005170682 | 136 |
| 71 | 3300005367 | Ga0070667_100005709 | Ga0070667_1000057093 | 136 |
| 72 | 3300005367 | Ga0070667_100407087 | Ga0070667_1004070872 | 136 |
| 73 | 3300005434 | Ga0070709_10004024 | Ga0070709_100040247 | 136 |
| 74 | 3300005435 | Ga0070714_100976032 | Ga0070714_1009760322 | 136 |
| 75 | 3300005437 | Ga0070710_10025644 | Ga0070710_100256443 | 136 |
| 76 | 3300005438 | Ga0070701_10002486 | Ga0070701_100024862 | 136 |
| 77 | 3300005438 | Ga0070701_10238996 | Ga0070701_102389963 | 136 |
| 78 | 3300005439 | Ga0070711_100000402 | Ga0070711_1000004021 | 136 |
| 79 | 3300005439 | Ga0070711_100000860 | Ga0070711_10000086015 | 136 |
| 80 | 3300005440 | Ga0070705_100031929 | Ga0070705_1000319293 | 136 |
| 81 | 3300005440 | Ga0070705_100115944 | Ga0070705_1001159442 | 136 |
| 82 | 3300005441 | Ga0070700_100005259 | Ga0070700_1000052595 | 136 |
| 83 | 3300005444 | Ga0070694_100004412 | Ga0070694_1000044128 | 136 |
| 84 | 3300005444 | Ga0070694_100305386 | Ga0070694_1003053862 | 136 |
| 85 | 3300005445 | Ga0070708_101360309 | Ga0070708_1013603091 | 136 |
| 86 | 3300005455 | Ga0070663_100069326 | Ga0070663_1000693263 | 136 |
| 87 | 3300005455 | Ga0070663_100182113 | Ga0070663_1001821132 | 136 |
| 88 | 3300005456 | Ga0070678_100000273 | Ga0070678_1000002736 | 136 |
| 89 | 3300005456 | Ga0070678_100026963 | Ga0070678_1000269633 | 136 |
| 90 | 3300005457 | Ga0070662_100098007 | Ga0070662_1000980074 | 136 |
| 91 | 3300005457 | Ga0070662_100182676 | Ga0070662_1001826762 | 136 |
| 92 | 3300005457 | Ga0070662_100386958 | Ga0070662_1003869582 | 136 |
| 93 | 3300005459 | Ga0068867_100002987 | Ga0068867_10000298710 | 136 |
| 94 | 3300005459 | Ga0068867_100410188 | Ga0068867_1004101882 | 136 |
| 95 | 3300005466 | Ga0070685_10026763 | Ga0070685_100267633 | 136 |
| 96 | 3300005468 | Ga0070707_100602719 | Ga0070707_1006027192 | 136 |
| 97 | 3300005530 | Ga0070679_100653536 | Ga0070679_1006535362 | 136 |
| 98 | 3300005535 | Ga0070684_100026869 | Ga0070684_1000268697 | 136 |
| 99 | 3300005536 | Ga0070697_100688219 | Ga0070697_1006882192 | 136 |
| 100 | 3300005539 | Ga0068853_100002811 | Ga0068853_1000028114 | 136 |
| 101 | 3300005539 | Ga0068853_100510569 | Ga0068853_1005105692 | 136 |
| 102 | 3300005539 | Ga0068853_100546987 | Ga0068853_1005469872 | 136 |
| 103 | 3300005544 | Ga0070686_100331292 | Ga0070686_1003312922 | 136 |
| 104 | 3300005545 | Ga0070695_100008824 | Ga0070695_1000088246 | 136 |
| 105 | 3300005545 | Ga0070695_100114250 | Ga0070695_1001142503 | 136 |
| 106 | 3300005546 | Ga0070696_100000796 | Ga0070696_10000079615 | 136 |
| 107 | 3300005546 | Ga0070696_100174628 | Ga0070696_1001746283 | 136 |
| 108 | 3300005547 | Ga0070693_100007039 | Ga0070693_1000070396 | 136 |
| 109 | 3300005547 | Ga0070693_100818455 | Ga0070693_1008184552 | 136 |
| 110 | 3300005548 | Ga0070665_100000821 | Ga0070665_1000008219 | 136 |
| 111 | 3300005548 | Ga0070665_100005361 | Ga0070665_1000053615 | 136 |
| 112 | 3300005548 | Ga0070665_100049345 | Ga0070665_1000493453 | 136 |
| 113 | 3300005549 | Ga0070704_100032789 | Ga0070704_1000327895 | 136 |
| 114 | 3300005549 | Ga0070704_100069505 | Ga0070704_1000695051 | 136 |
| 115 | 3300005563 | Ga0068855_100369885 | Ga0068855_1003698851 | 136 |
| 116 | 3300005577 | Ga0068857_100008819 | Ga0068857_10000881912 | 136 |
| 117 | 3300005578 | Ga0068854_100101132 | Ga0068854_1001011323 | 136 |
| 118 | 3300005578 | Ga0068854_100297695 | Ga0068854_1002976951 | 136 |
| 119 | 3300005614 | Ga0068856_100150028 | Ga0068856_1001500282 | 136 |
| 120 | 3300005615 | Ga0070702_100007930 | Ga0070702_1000079302 | 136 |
| 121 | 3300005615 | Ga0070702_100658501 | Ga0070702_1006585012 | 136 |
| 122 | 3300005616 | Ga0068852_100692397 | Ga0068852_1006923972 | 136 |
| 123 | 3300005617 | Ga0068859_100005745 | Ga0068859_1000057452 | 136 |
| 124 | 3300005618 | Ga0068864_100236513 | Ga0068864_1002365132 | 136 |
| 125 | 3300005718 | Ga0068866_10000419 | Ga0068866_1000041913 | 136 |
| 126 | 3300005718 | Ga0068866_10148991 | Ga0068866_101489914 | 136 |
| 127 | 3300005718 | Ga0068866_10259538 | Ga0068866_102595382 | 136 |
| 128 | 3300005719 | Ga0068861_100301020 | Ga0068861_1003010202 | 136 |
| 129 | 3300005840 | Ga0068870_10663283 | Ga0068870_106632831 | 136 |
| 130 | 3300005841 | Ga0068863_100048870 | Ga0068863_1000488704 | 136 |
| 131 | 3300005841 | Ga0068863_100567042 | Ga0068863_1005670422 | 136 |
| 132 | 3300005842 | Ga0068858_100022886 | Ga0068858_1000228863 | 136 |
| 133 | 3300005842 | Ga0068858_100050241 | Ga0068858_1000502413 | 136 |
| 134 | 3300005843 | Ga0068860_100000035 | Ga0068860_100000035155 | 136 |
| 135 | 3300005843 | Ga0068860_100000775 | Ga0068860_1000007754 | 136 |
| 136 | 3300005843 | Ga0068860_100498305 | Ga0068860_1004983052 | 136 |
| 137 | 3300005844 | Ga0068862_100005734 | Ga0068862_1000057345 | 136 |
| 138 | 3300005844 | Ga0068862_100199094 | Ga0068862_1001990943 | 136 |
| 139 | 3300005937 | Ga0081455_10011687 | Ga0081455_1001168710 | 136 |
| 140 | 3300005937 | Ga0081455_10077189 | Ga0081455_100771893 | 136 |
| 141 | 3300005937 | Ga0081455_10185414 | Ga0081455_101854142 | 136 |
| 142 | 3300005981 | Ga0081538_10004521 | Ga0081538_1000452110 | 136 |
| 143 | 3300005981 | Ga0081538_10012290 | Ga0081538_100122902 | 136 |
| 144 | 3300005981 | Ga0081538_10031865 | Ga0081538_100318651 | 136 |
| 145 | 3300005985 | Ga0081539_10003298 | Ga0081539_1000329815 | 136 |
| 146 | 3300006028 | Ga0070717_10234650 | Ga0070717_102346503 | 136 |
| 147 | 3300006038 | Ga0075365_10049058 | Ga0075365_100490583 | 136 |
| 148 | 3300006038 | Ga0075365_10077920 | Ga0075365_100779202 | 136 |
| 149 | 3300006038 | Ga0075365_10265683 | Ga0075365_102656832 | 136 |
| 150 | 3300006038 | Ga0075365_10314292 | Ga0075365_103142922 | 136 |
| 151 | 3300006042 | Ga0075368_10090096 | Ga0075368_100900961 | 136 |
| 152 | 3300006048 | Ga0075363_100002031 | Ga0075363_1000020313 | 136 |
| 153 | 3300006048 | Ga0075363_100013855 | Ga0075363_1000138553 | 136 |
| 154 | 3300006048 | Ga0075363_100022561 | Ga0075363_1000225613 | 136 |
| 155 | 3300006048 | Ga0075363_100023916 | Ga0075363_1000239163 | 136 |
| 156 | 3300006048 | Ga0075363_100089770 | Ga0075363_1000897704 | 136 |
| 157 | 3300006048 | Ga0075363_100093897 | Ga0075363_1000938973 | 136 |
| 158 | 3300006051 | Ga0075364_10000303 | Ga0075364_1000030310 | 136 |
| 159 | 3300006051 | Ga0075364_10011745 | Ga0075364_100117453 | 136 |
| 160 | 3300006051 | Ga0075364_10040679 | Ga0075364_100406793 | 136 |
| 161 | 3300006051 | Ga0075364_10084199 | Ga0075364_100841993 | 136 |
| 162 | 3300006173 | Ga0070716_100000471 | Ga0070716_1000004719 | 136 |
| 163 | 3300006173 | Ga0070716_100017054 | Ga0070716_1000170542 | 136 |
| 164 | 3300006175 | Ga0070712_100115385 | Ga0070712_1001153852 | 136 |
| 165 | 3300006175 | Ga0070712_100212556 | Ga0070712_1002125563 | 136 |
| 166 | 3300006177 | Ga0075362_10011769 | Ga0075362_100117693 | 136 |
| 167 | 3300006177 | Ga0075362_10060613 | Ga0075362_100606132 | 136 |
| 168 | 3300006186 | Ga0075369_10000129 | Ga0075369_1000012910 | 136 |
| 169 | 3300006186 | Ga0075369_10242427 | Ga0075369_102424272 | 136 |
| 170 | 3300006186 | Ga0075369_10256598 | Ga0075369_102565981 | 136 |
| 171 | 3300006186 | Ga0075369_10286283 | Ga0075369_102862832 | 136 |
| 172 | 3300006237 | Ga0097621_100033270 | Ga0097621_1000332704 | 136 |
| 173 | 3300006237 | Ga0097621_100704384 | Ga0097621_1007043842 | 136 |
| 174 | 3300006353 | Ga0075370_10180480 | Ga0075370_101804802 | 136 |
| 175 | 3300006353 | Ga0075370_10372709 | Ga0075370_103727092 | 136 |
| 176 | 3300006881 | Ga0068865_100004325 | Ga0068865_1000043251 | 136 |
| 177 | 3300006881 | Ga0068865_100065650 | Ga0068865_1000656503 | 136 |
| 178 | 3300006881 | Ga0068865_100505892 | Ga0068865_1005058922 | 136 |
| 179 | 3300006931 | Ga0097620_100005745 | Ga0097620_1000057452 | 136 |
| 180 | 3300009092 | Ga0105250_10452626 | Ga0105250_104526262 | 136 |
| 181 | 3300009093 | Ga0105240_10593424 | Ga0105240_105934242 | 136 |
| 182 | 3300009098 | Ga0105245_10032532 | Ga0105245_100325324 | 136 |
| 183 | 3300009098 | Ga0105245_10037427 | Ga0105245_100374276 | 136 |
| 184 | 3300009101 | Ga0105247_10003162 | Ga0105247_100031622 | 136 |
| 185 | 3300009101 | Ga0105247_10120331 | Ga0105247_101203311 | 136 |
| 186 | 3300009101 | Ga0105247_10804061 | Ga0105247_108040612 | 136 |
| 187 | 3300009147 | Ga0114129_10306156 | Ga0114129_103061562 | 136 |
| 188 | 3300009148 | Ga0105243_10001826 | Ga0105243_100018268 | 136 |
| 189 | 3300009148 | Ga0105243_10547090 | Ga0105243_105470903 | 136 |
| 190 | 3300009174 | Ga0105241_10059209 | Ga0105241_100592093 | 136 |
| 191 | 3300009174 | Ga0105241_10076888 | Ga0105241_100768883 | 136 |
| 192 | 3300009174 | Ga0105241_11566785 | Ga0105241_115667851 | 136 |
| 193 | 3300009176 | Ga0105242_10000459 | Ga0105242_1000045911 | 136 |
| 194 | 3300009176 | Ga0105242_10023936 | Ga0105242_100239363 | 136 |
| 195 | 3300009176 | Ga0105242_10841038 | Ga0105242_108410383 | 136 |
| 196 | 3300009177 | Ga0105248_10003999 | Ga0105248_100039996 | 136 |
| 197 | 3300009177 | Ga0105248_10275424 | Ga0105248_102754244 | 136 |
| 198 | 3300009545 | Ga0105237_10108924 | Ga0105237_101089242 | 136 |
| 199 | 3300009545 | Ga0105237_10447552 | Ga0105237_104475523 | 136 |
| 200 | 3300009551 | Ga0105238_10091684 | Ga0105238_100916843 | 136 |
| 201 | 3300009551 | Ga0105238_10262247 | Ga0105238_102622472 | 136 |
| 202 | 3300009553 | Ga0105249_10006558 | Ga0105249_100065582 | 136 |
| 203 | 3300009553 | Ga0105249_10083288 | Ga0105249_100832883 | 136 |
| 204 | 3300009553 | Ga0105249_10367509 | Ga0105249_103675092 | 136 |
| 205 | 3300009553 | Ga0105249_10642350 | Ga0105249_106423502 | 136 |
| 206 | 3300009553 | Ga0105249_10866566 | Ga0105249_108665662 | 136 |
| 207 | 3300010375 | Ga0105239_10012460 | Ga0105239_100124608 | 136 |
| 208 | 3300010375 | Ga0105239_10416493 | Ga0105239_104164933 | 136 |
| 209 | 3300010375 | Ga0105239_10571827 | Ga0105239_105718272 | 136 |
| 210 | 3300010375 | Ga0105239_10810185 | Ga0105239_108101853 | 136 |
| 211 | 3300011119 | Ga0105246_10002382 | Ga0105246_1000238211 | 136 |
| 212 | 3300011119 | Ga0105246_10321670 | Ga0105246_103216703 | 136 |
| 213 | 3300013102 | Ga0157371_10647766 | Ga0157371_106477662 | 136 |
| 214 | 3300013105 | Ga0157369_10019113 | Ga0157369_100191137 | 136 |
| 215 | 3300013105 | Ga0157369_10140861 | Ga0157369_101408612 | 136 |
| 216 | 3300013105 | Ga0157369_10531931 | Ga0157369_105319312 | 136 |
| 217 | 3300013105 | Ga0157369_11669617 | Ga0157369_116696172 | 136 |
| 218 | 3300013296 | Ga0157374_10013307 | Ga0157374_100133076 | 136 |
| 219 | 3300013296 | Ga0157374_10252377 | Ga0157374_102523773 | 136 |
| 220 | 3300013297 | Ga0157378_10003979 | Ga0157378_100039793 | 136 |
| 221 | 3300013297 | Ga0157378_10170604 | Ga0157378_101706043 | 136 |
| 222 | 3300013306 | Ga0163162_10006338 | Ga0163162_100063384 | 136 |
| 223 | 3300013306 | Ga0163162_10240440 | Ga0163162_102404403 | 136 |
| 224 | 3300013307 | Ga0157372_10109161 | Ga0157372_101091613 | 136 |
| 225 | 3300013307 | Ga0157372_10239765 | Ga0157372_102397653 | 136 |
| 226 | 3300013307 | Ga0157372_10829356 | Ga0157372_108293563 | 136 |
| 227 | 3300013307 | Ga0157372_12365335 | Ga0157372_123653351 | 136 |
| 228 | 3300013308 | Ga0157375_10009568 | Ga0157375_100095686 | 136 |
| 229 | 3300013308 | Ga0157375_10209038 | Ga0157375_102090383 | 136 |
| 230 | 3300014325 | Ga0163163_10088004 | Ga0163163_100880043 | 136 |
| 231 | 3300014326 | Ga0157380_10001560 | Ga0157380_1000156015 | 136 |
| 232 | 3300014326 | Ga0157380_10407507 | Ga0157380_104075071 | 136 |
| 233 | 3300014745 | Ga0157377_10068682 | Ga0157377_100686823 | 136 |
| 234 | 3300014745 | Ga0157377_10086101 | Ga0157377_100861013 | 136 |
| 235 | 3300014745 | Ga0157377_10130474 | Ga0157377_101304742 | 136 |
| 236 | 3300014968 | Ga0157379_10013893 | Ga0157379_100138934 | 136 |
| 237 | 3300014968 | Ga0157379_10017352 | Ga0157379_100173522 | 136 |
| 238 | 3300014968 | Ga0157379_10033521 | Ga0157379_100335213 | 136 |
| 239 | 3300014969 | Ga0157376_10446008 | Ga0157376_104460082 | 136 |
| 240 | 3300017792 | Ga0163161_10003090 | Ga0163161_100030904 | 136 |
| 241 | 3300017792 | Ga0163161_10595014 | Ga0163161_105950142 | 136 |
| 242 | 3300017792 | Ga0163161_10849656 | Ga0163161_108496561 | 136 |
| 243 | 3300020069 | Ga0197907_10828368 | Ga0197907_108283683 | 136 |
| 244 | 3300021358 | Ga0213873_10037562 | Ga0213873_100375622 | 136 |
| 245 | 3300021388 | Ga0213875_10065288 | Ga0213875_100652882 | 136 |
| 246 | 3300022467 | Ga0224712_10075666 | Ga0224712_100756662 | 136 |
| 247 | 3300025228 | Ga0209672_100004 | Ga0209672_100004269 | 136 |
| 248 | 3300025230 | Ga0209563_100028 | Ga0209563_100028331 | 136 |
| 249 | 3300025242 | Ga0209258_100003 | Ga0209258_100003269 | 136 |
| 250 | 3300025246 | Ga0209646_1003803 | Ga0209646_10038034 | 136 |
| 251 | 3300025250 | Ga0209026_1000281 | Ga0209026_100028115 | 136 |
| 252 | 3300025254 | Ga0209148_1000016 | Ga0209148_1000016269 | 136 |
| 253 | 3300025256 | Ga0209759_1008527 | Ga0209759_10085273 | 136 |
| 254 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004269 | 136 |
| 255 | 3300025899 | Ga0207642_10004024 | Ga0207642_100040242 | 136 |
| 256 | 3300025899 | Ga0207642_10085089 | Ga0207642_100850892 | 136 |
| 257 | 3300025899 | Ga0207642_10278779 | Ga0207642_102787792 | 136 |
| 258 | 3300025900 | Ga0207710_10004040 | Ga0207710_100040403 | 136 |
| 259 | 3300025901 | Ga0207688_10010768 | Ga0207688_100107682 | 136 |
| 260 | 3300025903 | Ga0207680_10003070 | Ga0207680_100030703 | 136 |
| 261 | 3300025903 | Ga0207680_10010590 | Ga0207680_100105905 | 136 |
| 262 | 3300025904 | Ga0207647_10066300 | Ga0207647_100663003 | 136 |
| 263 | 3300025904 | Ga0207647_10080074 | Ga0207647_100800743 | 136 |
| 264 | 3300025904 | Ga0207647_10248643 | Ga0207647_102486432 | 136 |
| 265 | 3300025905 | Ga0207685_10001517 | Ga0207685_100015174 | 136 |
| 266 | 3300025906 | Ga0207699_10014305 | Ga0207699_100143053 | 136 |
| 267 | 3300025907 | Ga0207645_10038444 | Ga0207645_100384443 | 136 |
| 268 | 3300025907 | Ga0207645_10166126 | Ga0207645_101661263 | 136 |
| 269 | 3300025909 | Ga0207705_10765082 | Ga0207705_107650821 | 136 |
| 270 | 3300025911 | Ga0207654_10139797 | Ga0207654_101397973 | 136 |
| 271 | 3300025911 | Ga0207654_10209233 | Ga0207654_102092332 | 136 |
| 272 | 3300025911 | Ga0207654_10709275 | Ga0207654_107092751 | 136 |
| 273 | 3300025914 | Ga0207671_10410821 | Ga0207671_104108212 | 136 |
| 274 | 3300025914 | Ga0207671_10478155 | Ga0207671_104781552 | 136 |
| 275 | 3300025914 | Ga0207671_10979625 | Ga0207671_109796252 | 136 |
| 276 | 3300025915 | Ga0207693_10000381 | Ga0207693_100003819 | 136 |
| 277 | 3300025915 | Ga0207693_10001414 | Ga0207693_100014144 | 136 |
| 278 | 3300025916 | Ga0207663_10004663 | Ga0207663_100046632 | 136 |
| 279 | 3300025916 | Ga0207663_10324343 | Ga0207663_103243431 | 136 |
| 280 | 3300025916 | Ga0207663_10505795 | Ga0207663_105057952 | 136 |
| 281 | 3300025917 | Ga0207660_10125433 | Ga0207660_101254334 | 136 |
| 282 | 3300025918 | Ga0207662_10089950 | Ga0207662_100899503 | 136 |
| 283 | 3300025919 | Ga0207657_10225338 | Ga0207657_102253382 | 136 |
| 284 | 3300025919 | Ga0207657_10605984 | Ga0207657_106059842 | 136 |
| 285 | 3300025921 | Ga0207652_10361109 | Ga0207652_103611092 | 136 |
| 286 | 3300025921 | Ga0207652_10551588 | Ga0207652_105515881 | 136 |
| 287 | 3300025923 | Ga0207681_10112725 | Ga0207681_101127254 | 136 |
| 288 | 3300025923 | Ga0207681_10156179 | Ga0207681_101561793 | 136 |
| 289 | 3300025924 | Ga0207694_10099044 | Ga0207694_100990443 | 136 |
| 290 | 3300025924 | Ga0207694_10305147 | Ga0207694_103051472 | 136 |
| 291 | 3300025927 | Ga0207687_10000587 | Ga0207687_100005876 | 136 |
| 292 | 3300025927 | Ga0207687_10530327 | Ga0207687_105303272 | 136 |
| 293 | 3300025929 | Ga0207664_10190289 | Ga0207664_101902892 | 136 |
| 294 | 3300025929 | Ga0207664_11069970 | Ga0207664_110699702 | 136 |
| 295 | 3300025931 | Ga0207644_10308513 | Ga0207644_103085132 | 136 |
| 296 | 3300025932 | Ga0207690_10532665 | Ga0207690_105326652 | 136 |
| 297 | 3300025932 | Ga0207690_10707389 | Ga0207690_107073892 | 136 |
| 298 | 3300025933 | Ga0207706_10046021 | Ga0207706_100460212 | 136 |
| 299 | 3300025934 | Ga0207686_10015983 | Ga0207686_100159833 | 136 |
| 300 | 3300025935 | Ga0207709_10028683 | Ga0207709_100286833 | 136 |
| 301 | 3300025935 | Ga0207709_10210212 | Ga0207709_102102121 | 136 |
| 302 | 3300025936 | Ga0207670_10006540 | Ga0207670_100065404 | 136 |
| 303 | 3300025937 | Ga0207669_10001288 | Ga0207669_100012886 | 136 |
| 304 | 3300025938 | Ga0207704_10001708 | Ga0207704_100017086 | 136 |
| 305 | 3300025938 | Ga0207704_10055306 | Ga0207704_100553064 | 136 |
| 306 | 3300025938 | Ga0207704_10341437 | Ga0207704_103414372 | 136 |
| 307 | 3300025939 | Ga0207665_10021570 | Ga0207665_100215704 | 136 |
| 308 | 3300025939 | Ga0207665_10134296 | Ga0207665_101342962 | 136 |
| 309 | 3300025941 | Ga0207711_10029205 | Ga0207711_100292054 | 136 |
| 310 | 3300025941 | Ga0207711_10115504 | Ga0207711_101155043 | 136 |
| 311 | 3300025942 | Ga0207689_10016281 | Ga0207689_100162814 | 136 |
| 312 | 3300025942 | Ga0207689_10017429 | Ga0207689_100174294 | 136 |
| 313 | 3300025942 | Ga0207689_10474131 | Ga0207689_104741312 | 136 |
| 314 | 3300025944 | Ga0207661_10231513 | Ga0207661_102315132 | 136 |
| 315 | 3300025944 | Ga0207661_11814922 | Ga0207661_118149221 | 136 |
| 316 | 3300025945 | Ga0207679_10804914 | Ga0207679_108049142 | 136 |
| 317 | 3300025949 | Ga0207667_10363536 | Ga0207667_103635361 | 136 |
| 318 | 3300025960 | Ga0207651_10485760 | Ga0207651_104857602 | 136 |
| 319 | 3300025961 | Ga0207712_10033254 | Ga0207712_100332544 | 136 |
| 320 | 3300025961 | Ga0207712_10264942 | Ga0207712_102649423 | 136 |
| 321 | 3300025961 | Ga0207712_10361870 | Ga0207712_103618703 | 136 |
| 322 | 3300025961 | Ga0207712_10911101 | Ga0207712_109111012 | 136 |
| 323 | 3300025961 | Ga0207712_11002999 | Ga0207712_110029992 | 136 |
| 324 | 3300025972 | Ga0207668_10004077 | Ga0207668_100040774 | 136 |
| 325 | 3300025972 | Ga0207668_10007345 | Ga0207668_100073456 | 136 |
| 326 | 3300025972 | Ga0207668_11367761 | Ga0207668_113677611 | 136 |
| 327 | 3300025981 | Ga0207640_10013690 | Ga0207640_100136901 | 136 |
| 328 | 3300025981 | Ga0207640_10274045 | Ga0207640_102740453 | 136 |
| 329 | 3300025981 | Ga0207640_10508933 | Ga0207640_105089332 | 136 |
| 330 | 3300025981 | Ga0207640_10848419 | Ga0207640_108484191 | 136 |
| 331 | 3300025986 | Ga0207658_10017204 | Ga0207658_100172042 | 136 |
| 332 | 3300026023 | Ga0207677_10310657 | Ga0207677_103106573 | 136 |
| 333 | 3300026023 | Ga0207677_10690804 | Ga0207677_106908041 | 136 |
| 334 | 3300026035 | Ga0207703_10039188 | Ga0207703_100391883 | 136 |
| 335 | 3300026035 | Ga0207703_10056148 | Ga0207703_100561483 | 136 |
| 336 | 3300026035 | Ga0207703_10385246 | Ga0207703_103852461 | 136 |
| 337 | 3300026041 | Ga0207639_10018307 | Ga0207639_100183073 | 136 |
| 338 | 3300026041 | Ga0207639_10133457 | Ga0207639_101334573 | 136 |
| 339 | 3300026067 | Ga0207678_10004848 | Ga0207678_100048483 | 136 |
| 340 | 3300026067 | Ga0207678_10093791 | Ga0207678_100937913 | 136 |
| 341 | 3300026075 | Ga0207708_10018949 | Ga0207708_100189494 | 136 |
| 342 | 3300026075 | Ga0207708_10176416 | Ga0207708_101764162 | 136 |
| 343 | 3300026078 | Ga0207702_10052727 | Ga0207702_100527273 | 136 |
| 344 | 3300026078 | Ga0207702_10377407 | Ga0207702_103774071 | 136 |
| 345 | 3300026088 | Ga0207641_10012729 | Ga0207641_100127292 | 136 |
| 346 | 3300026088 | Ga0207641_10464498 | Ga0207641_104644982 | 136 |
| 347 | 3300026089 | Ga0207648_10000462 | Ga0207648_1000046239 | 136 |
| 348 | 3300026089 | Ga0207648_10073136 | Ga0207648_100731363 | 136 |
| 349 | 3300026095 | Ga0207676_10127111 | Ga0207676_101271113 | 136 |
| 350 | 3300026095 | Ga0207676_10526579 | Ga0207676_105265791 | 136 |
| 351 | 3300026116 | Ga0207674_10014897 | Ga0207674_100148974 | 136 |
| 352 | 3300026118 | Ga0207675_100000768 | Ga0207675_10000076822 | 136 |
| 353 | 3300026118 | Ga0207675_100266320 | Ga0207675_1002663203 | 136 |
| 354 | 3300026118 | Ga0207675_100447979 | Ga0207675_1004479792 | 136 |
| 355 | 3300026121 | Ga0207683_10000575 | Ga0207683_1000057516 | 136 |
| 356 | 3300026121 | Ga0207683_10150507 | Ga0207683_101505071 | 136 |
| 357 | 3300026142 | Ga0207698_10067881 | Ga0207698_100678813 | 136 |
| 358 | 3300026142 | Ga0207698_10967468 | Ga0207698_109674682 | 136 |
| 359 | 3300028379 | Ga0268266_10003777 | Ga0268266_100037774 | 136 |
| 360 | 3300028379 | Ga0268266_10084714 | Ga0268266_100847143 | 136 |
| 361 | 3300028380 | Ga0268265_10014518 | Ga0268265_100145184 | 136 |
| 362 | 3300028380 | Ga0268265_10692889 | Ga0268265_106928892 | 136 |
| 363 | 3300028381 | Ga0268264_10000031 | Ga0268264_10000031253 | 136 |
| 364 | 3300028381 | Ga0268264_10004232 | Ga0268264_1000423211 | 136 |
| 365 | 3300028381 | Ga0268264_10420373 | Ga0268264_104203732 | 136 |
| 366 | 3300028381 | Ga0268264_12157866 | Ga0268264_121578661 | 136 |
| 367 | 3300031995 | Ga0307409_100604709 | Ga0307409_1006047092 | 136 |
| 368 | 3300035090 | Ga0373949_0076523 | Ga0373949_0076523_32_442 | 136 |
| 369 | 3300035090 | Ga0373949_0173788 | Ga0373949_0173788_168_578 | 136 |
| 370 | 3300035111 | Ga0373923_0022109 | Ga0373923_0022109_1092_1502 | 136 |
| 371 | 3300035692 | Ga0373935_1288236 | Ga0373935_1288236_114_524 | 136 |
| 372 | 3300037853 | Ga0436364_0332337 | Ga0436364_0332337_168_578 | 136 |
| 373 | 3300037853 | Ga0436364_0406475 | Ga0436364_0406475_455_865 | 136 |
| 374 | 3300037853 | Ga0436364_1019987 | Ga0436364_1019987_936_1346 | 136 |
| 375 | 3300039453 | Ga0436362_0337613 | Ga0436362_0337613_353_763 | 136 |
| 376 | 3300041453 | Ga0451797_0578190 | Ga0451797_0578190_288_698 | 136 |
| 377 | 3300041486 | Ga0451807_2424073 | Ga0451807_2424073_167_577 | 136 |
| 378 | 3300041509 | Ga0451843_0327092 | Ga0451843_0327092_212_622 | 136 |
| 379 | 3300041512 | Ga0451853_2158879 | Ga0451853_2158879_588_1004 | 136 |
| 380 | 3300044656 | Ga0466969_0065346 | Ga0466969_0065346_239_661 | 136 |
| 381 | 3300044656 | Ga0466969_0085665 | Ga0466969_0085665_860_1270 | 136 |
| 382 | 3300044656 | Ga0466969_0099441 | Ga0466969_0099441_317_727 | 136 |
| 383 | 3300044658 | Ga0466972_0012804 | Ga0466972_0012804_1615_2034 | 136 |
| 384 | 3300044683 | Ga0466965_0000685 | Ga0466965_0000685_925_1344 | 136 |
| 385 | 3300044683 | Ga0466965_0051130 | Ga0466965_0051130_1365_1775 | 136 |
| 386 | 3300044683 | Ga0466965_0407571 | Ga0466965_0407571_138_548 | 136 |
| 387 | 3300044683 | Ga0466965_0519921 | Ga0466965_0519921_200_610 | 136 |
| 388 | 3300044684 | Ga0466966_0013868 | Ga0466966_0013868_3821_4243 | 136 |
| 389 | 3300044684 | Ga0466966_0058391 | Ga0466966_0058391_601_1011 | 136 |
| 390 | 3300044684 | Ga0466966_0067623 | Ga0466966_0067623_300_710 | 136 |
| 391 | 3300044684 | Ga0466966_0196883 | Ga0466966_0196883_178_588 | 136 |
| 392 | 3300044693 | Ga0466961_0005936 | Ga0466961_0005936_7259_7669 | 136 |
| 393 | 3300044693 | Ga0466961_0054471 | Ga0466961_0054471_436_858 | 136 |
| 394 | 3300044693 | Ga0466961_0101936 | Ga0466961_0101936_577_987 | 136 |
| 395 | 3300044693 | Ga0466961_0470870 | Ga0466961_0470870_231_641 | 136 |
| 396 | 3300044694 | Ga0466963_0059216 | Ga0466963_0059216_762_1172 | 136 |
| 397 | 3300044694 | Ga0466963_0107554 | Ga0466963_0107554_701_1111 | 136 |
| 398 | 3300044694 | Ga0466963_0497531 | Ga0466963_0497531_351_761 | 136 |
| 399 | 3300044694 | Ga0466963_0592075 | Ga0466963_0592075_181_591 | 136 |
| 400 | 3300044706 | Ga0466964_0086649 | Ga0466964_0086649_589_999 | 136 |
| 401 | 3300044706 | Ga0466964_0141666 | Ga0466964_0141666_310_729 | 136 |
| 402 | 3300044706 | Ga0466964_0202030 | Ga0466964_0202030_368_784 | 136 |
| 403 | 3300044735 | Ga0466968_0000928 | Ga0466968_0000928_9197_9616 | 136 |
| 404 | 3300044765 | Ga0466970_0077642 | Ga0466970_0077642_1214_1633 | 136 |
| 405 | 3300044765 | Ga0466970_0089151 | Ga0466970_0089151_153_563 | 136 |
| 406 | 3300044765 | Ga0466970_0372336 | Ga0466970_0372336_187_597 | 136 |
| 407 | 3300044765 | Ga0466970_0524568 | Ga0466970_0524568_101_511 | 136 |
| 408 | 3300044842 | Ga0466957_0006881 | Ga0466957_0006881_2664_3083 | 136 |
| 409 | 3300044842 | Ga0466957_0297004 | Ga0466957_0297004_604_1026 | 136 |
| 410 | 3300044901 | Ga0466960_0108912 | Ga0466960_0108912_763_1182 | 136 |
| 411 | 3300044901 | Ga0466960_0300440 | Ga0466960_0300440_455_865 | 136 |
| 412 | 3300044901 | Ga0466960_0338013 | Ga0466960_0338013_52_462 | 136 |
| 413 | 3300045049 | Ga0466959_0020726 | Ga0466959_0020726_4390_4812 | 136 |
| 414 | 3300045049 | Ga0466959_0032197 | Ga0466959_0032197_684_1094 | 136 |
| 415 | 3300045049 | Ga0466959_0199351 | Ga0466959_0199351_751_1161 | 136 |
| 416 | 3300045049 | Ga0466959_0322550 | Ga0466959_0322550_533_943 | 136 |
| 417 | 3300045049 | Ga0466959_0459689 | Ga0466959_0459689_255_674 | 136 |
| 418 | 3300045049 | Ga0466959_0527514 | Ga0466959_0527514_260_670 | 136 |
| 419 | 3300045051 | Ga0451576_0250245 | Ga0451576_0250245_613_1023 | 136 |
| 420 | 3300045836 | Ga0466958_0003414 | Ga0466958_0003414_2701_3123 | 136 |
| 421 | 3300045836 | Ga0466958_0006577 | Ga0466958_0006577_4062_4472 | 136 |
| 422 | 3300045836 | Ga0466958_0095622 | Ga0466958_0095622_1309_1719 | 136 |
| 423 | 3300045836 | Ga0466958_0309393 | Ga0466958_0309393_110_520 | 136 |
| 424 | 3300045836 | Ga0466958_0326190 | Ga0466958_0326190_80_490 | 136 |
| 425 | 3300045836 | Ga0466958_0459081 | Ga0466958_0459081_313_723 | 136 |
| 426 | 3300045976 | Ga0466967_0007720 | Ga0466967_0007720_287_706 | 136 |
| 427 | 3300045976 | Ga0466967_0028377 | Ga0466967_0028377_3346_3756 | 136 |
| 428 | 3300045976 | Ga0466967_0089596 | Ga0466967_0089596_2072_2482 | 136 |
| 429 | 3300045976 | Ga0466967_0126986 | Ga0466967_0126986_665_1075 | 136 |
| 430 | 3300045976 | Ga0466967_0262998 | Ga0466967_0262998_1049_1465 | 136 |
| 431 | 3300045976 | Ga0466967_0263007 | Ga0466967_0263007_478_888 | 136 |
| 432 | 3300045976 | Ga0466967_0464415 | Ga0466967_0464415_780_1190 | 136 |
| 433 | 3300046460 | Ga0495638_0000563 | Ga0495638_0000563_40546_40965 | 136 |
| 434 | 3300046461 | Ga0495641_0121577 | Ga0495641_0121577_413_823 | 136 |
| 435 | 3300046473 | Ga0495582_0614298 | Ga0495582_0614298_94_504 | 136 |
| 436 | 3300046475 | Ga0495639_0111775 | Ga0495639_0111775_100_510 | 136 |
| 437 | 3300046492 | Ga0495585_0120502 | Ga0495585_0120502_351_761 | 136 |
| 438 | 3300046511 | Ga0495608_0285103 | Ga0495608_0285103_486_896 | 136 |
| 439 | 3300046526 | Ga0495666_0095129 | Ga0495666_0095129_63_473 | 136 |
| 440 | 3300046529 | Ga0495652_0711185 | Ga0495652_0711185_77_487 | 136 |
| 441 | 3300046531 | Ga0495665_0486225 | Ga0495665_0486225_78_488 | 136 |
| 442 | 3300046533 | Ga0495640_0044374 | Ga0495640_0044374_2647_3057 | 136 |
| 443 | 3300046533 | Ga0495640_0461776 | Ga0495640_0461776_126_536 | 136 |
| 444 | 3300046642 | Ga0495634_0091948 | Ga0495634_0091948_1088_1498 | 136 |
| 445 | 3300046648 | Ga0495611_0424511 | Ga0495611_0424511_136_546 | 136 |
| 446 | 3300046660 | Ga0495625_0148674 | Ga0495625_0148674_942_1352 | 136 |
| 447 | 3300046660 | Ga0495625_0534438 | Ga0495625_0534438_98_517 | 136 |
| 448 | 3300046663 | Ga0495635_0457265 | Ga0495635_0457265_108_518 | 136 |
| 449 | 3300046675 | Ga0495657_0350130 | Ga0495657_0350130_325_738 | 136 |
| 450 | 3300046683 | Ga0495658_0188015 | Ga0495658_0188015_776_1186 | 136 |
| 451 | 3300046689 | Ga0495613_0527106 | Ga0495613_0527106_50_460 | 136 |
| 452 | 3300046694 | Ga0495649_0201929 | Ga0495649_0201929_100_510 | 136 |
| 453 | 3300046694 | Ga0495649_0415441 | Ga0495649_0415441_144_560 | 136 |
| 454 | 3300047319 | Ga0495674_0514288 | Ga0495674_0514288_97_507 | 136 |
| 455 | 3300047321 | Ga0495676_0648472 | Ga0495676_0648472_219_629 | 136 |
| 456 | 3300047322 | Ga0495680_0072616 | Ga0495680_0072616_787_1197 | 136 |
| 457 | 3300047673 | Ga0495593_0030322 | Ga0495593_0030322_115_525 | 136 |
| 458 | 3300048091 | Ga0495626_0267001 | Ga0495626_0267001_144_554 | 136 |
| 459 | 3300048903 | Ga0496100_0007272 | Ga0496100_0007272_2341_2751 | 136 |
| 460 | 3300048903 | Ga0496100_0480218 | Ga0496100_0480218_62_472 | 136 |
| 461 | 3300048904 | Ga0496101_0027794 | Ga0496101_0027794_2679_3089 | 136 |
| 462 | 3300048905 | Ga0496102_0001190 | Ga0496102_0001190_16563_16973 | 136 |
| 463 | 3300048905 | Ga0496102_0101907 | Ga0496102_0101907_1456_1866 | 136 |
| 464 | 3300048905 | Ga0496102_0833475 | Ga0496102_0833475_69_479 | 136 |
| 465 | 3300048906 | Ga0496103_0001391 | Ga0496103_0001391_9236_9646 | 136 |
| 466 | 3300048906 | Ga0496103_0092510 | Ga0496103_0092510_870_1280 | 136 |
| 467 | 3300048907 | Ga0496104_0073058 | Ga0496104_0073058_288_698 | 136 |
| 468 | 3300048909 | Ga0496106_0010229 | Ga0496106_0010229_4881_5291 | 136 |
| 469 | 3300048909 | Ga0496106_0186141 | Ga0496106_0186141_1107_1517 | 136 |
| 470 | 3300048909 | Ga0496106_0549226 | Ga0496106_0549226_448_858 | 136 |
| 471 | 3300048910 | Ga0496107_0000760 | Ga0496107_0000760_8926_9336 | 136 |
| 472 | 3300048910 | Ga0496107_0160349 | Ga0496107_0160349_915_1325 | 136 |
| 473 | 3300048910 | Ga0496107_0358006 | Ga0496107_0358006_411_824 | 136 |
| 474 | 3300048910 | Ga0496107_0522359 | Ga0496107_0522359_433_849 | 136 |
| 475 | 3300048910 | Ga0496107_0558328 | Ga0496107_0558328_310_720 | 136 |
| 476 | 3300048910 | Ga0496107_1270335 | Ga0496107_1270335_76_489 | 136 |
| 477 | 3300048911 | Ga0496108_0010094 | Ga0496108_0010094_5625_6038 | 136 |
| 478 | 3300048911 | Ga0496108_0011269 | Ga0496108_0011269_2524_2934 | 136 |
| 479 | 3300048911 | Ga0496108_0034514 | Ga0496108_0034514_3691_4107 | 136 |
| 480 | 3300048911 | Ga0496108_0466524 | Ga0496108_0466524_410_820 | 136 |
| 481 | 3300048911 | Ga0496108_0738885 | Ga0496108_0738885_39_458 | 136 |
| 482 | 3300048911 | Ga0496108_0848471 | Ga0496108_0848471_110_520 | 136 |
| 483 | 3300048911 | Ga0496108_1753196 | Ga0496108_1753196_38_448 | 136 |
| 484 | 3300048912 | Ga0496109_0002148 | Ga0496109_0002148_10174_10590 | 136 |
| 485 | 3300048912 | Ga0496109_0042367 | Ga0496109_0042367_3467_3880 | 136 |
| 486 | 3300048913 | Ga0496110_0380003 | Ga0496110_0380003_600_1013 | 136 |
| 487 | 3300048914 | Ga0496111_0040429 | Ga0496111_0040429_2845_3255 | 136 |
| 488 | 3300048914 | Ga0496111_0085836 | Ga0496111_0085836_901_1314 | 136 |
| 489 | 3300048914 | Ga0496111_0234739 | Ga0496111_0234739_81_491 | 136 |
| 490 | 3300048916 | Ga0496113_0165653 | Ga0496113_0165653_1127_1543 | 136 |
| 491 | 3300048916 | Ga0496113_0242246 | Ga0496113_0242246_767_1177 | 136 |
| 492 | 3300048917 | Ga0496114_0001875 | Ga0496114_0001875_9258_9668 | 136 |
| 493 | 3300048918 | Ga0496115_0004439 | Ga0496115_0004439_6275_6685 | 136 |
| 494 | 3300049571 | Ga0501034_0003091 | Ga0501034_0003091_2413_2844 | 136 |
| 495 | 3300049571 | Ga0501034_0204785 | Ga0501034_0204785_18_428 | 136 |
| 496 | 3300049573 | Ga0501037_0439646 | Ga0501037_0439646_358_789 | 136 |
| 497 | 3300049579 | Ga0501043_1131343 | Ga0501043_1131343_112_522 | 136 |
| 498 | 3300049581 | Ga0501047_0642600 | Ga0501047_0642600_38_448 | 136 |
| 499 | 3300049581 | Ga0501047_0857831 | Ga0501047_0857831_152_568 | 136 |
| 500 | 3300049581 | Ga0501047_0903648 | Ga0501047_0903648_256_666 | 136 |
| 501 | 3300049581 | Ga0501047_1063196 | Ga0501047_1063196_159_569 | 136 |
| 502 | 3300049583 | Ga0501067_0026209 | Ga0501067_0026209_816_1247 | 136 |
| 503 | 3300049583 | Ga0501067_0634284 | Ga0501067_0634284_147_557 | 136 |
| 504 | 3300049584 | Ga0501068_0003128 | Ga0501068_0003128_7642_8073 | 136 |
| 505 | 3300049584 | Ga0501068_0083003 | Ga0501068_0083003_973_1383 | 136 |
| 506 | 3300049585 | Ga0501069_0000052 | Ga0501069_0000052_46418_46828 | 136 |
| 507 | 3300049586 | Ga0501070_0000030 | Ga0501070_0000030_4074_4484 | 136 |
| 508 | 3300049586 | Ga0501070_0069240 | Ga0501070_0069240_1082_1492 | 136 |
| 509 | 3300049586 | Ga0501070_0420279 | Ga0501070_0420279_25_435 | 136 |
| 510 | 3300049586 | Ga0501070_0505064 | Ga0501070_0505064_508_918 | 136 |
| 511 | 3300049586 | Ga0501070_0595798 | Ga0501070_0595798_179_589 | 136 |
| 512 | 3300049587 | Ga0501071_0022503 | Ga0501071_0022503_2919_3329 | 136 |
| 513 | 3300049587 | Ga0501071_0241466 | Ga0501071_0241466_221_652 | 136 |
| 514 | 3300049587 | Ga0501071_1092998 | Ga0501071_1092998_26_436 | 136 |
| 515 | 3300049588 | Ga0501072_0171672 | Ga0501072_0171672_348_779 | 136 |
| 516 | 3300049589 | Ga0501073_0017820 | Ga0501073_0017820_2403_2834 | 136 |
| 517 | 3300049589 | Ga0501073_0262430 | Ga0501073_0262430_166_576 | 136 |
| 518 | 3300049590 | Ga0501074_0035839 | Ga0501074_0035839_783_1214 | 136 |
| 519 | 3300049742 | Ga0501080_0004387 | Ga0501080_0004387_4381_4791 | 136 |
| 520 | 3300049742 | Ga0501080_0019341 | Ga0501080_0019341_3695_4126 | 136 |
| 521 | 3300049742 | Ga0501080_0128721 | Ga0501080_0128721_994_1425 | 136 |
| 522 | 3300049742 | Ga0501080_0529539 | Ga0501080_0529539_125_535 | 136 |
| 523 | 3300049744 | Ga0501083_0005470 | Ga0501083_0005470_1481_1912 | 136 |
| 524 | 3300049744 | Ga0501083_0622060 | Ga0501083_0622060_128_559 | 136 |
| 525 | 3300049823 | Ga0501044_0265740 | Ga0501044_0265740_14_430 | 136 |
| 526 | 3300050489 | nmdc:mga03683_21876_c1 | nmdc:mga03683_21876_c1_1207_1617 | 136 |
| 527 | 3300050489 | nmdc:mga03683_69745_c1 | nmdc:mga03683_69745_c1_933_1343 | 136 |
| 528 | 3300050490 | nmdc:mga03n38_10885_c1 | nmdc:mga03n38_10885_c1_1073_1483 | 136 |
| 529 | 3300050490 | nmdc:mga03n38_23297_c1 | nmdc:mga03n38_23297_c1_1895_2311 | 136 |
| 530 | 3300050490 | nmdc:mga03n38_3586_c1 | nmdc:mga03n38_3586_c1_195_605 | 136 |
| 531 | 3300050490 | nmdc:mga03n38_4344_c1 | nmdc:mga03n38_4344_c1_534_944 | 136 |
| 532 | 3300050490 | nmdc:mga03n38_789072_c1 | nmdc:mga03n38_789072_c1_122_535 | 136 |
| 533 | 3300050490 | nmdc:mga03n38_8261_c1 | nmdc:mga03n38_8261_c1_1349_1759 | 136 |
| 534 | 3300050490 | nmdc:mga03n38_829130_c1 | nmdc:mga03n38_829130_c1_97_507 | 136 |
| 535 | 3300050491 | nmdc:mga00v17_143508_c1 | nmdc:mga00v17_143508_c1_968_1378 | 136 |
| 536 | 3300050491 | nmdc:mga00v17_206426_c1 | nmdc:mga00v17_206426_c1_825_1235 | 136 |
| 537 | 3300050491 | nmdc:mga00v17_37521_c1 | nmdc:mga00v17_37521_c1_2419_2829 | 136 |
| 538 | 3300050491 | nmdc:mga00v17_39824_c1 | nmdc:mga00v17_39824_c1_1503_1913 | 136 |
| 539 | 3300050491 | nmdc:mga00v17_5446_c1 | nmdc:mga00v17_5446_c1_2623_3033 | 136 |
| 540 | 3300050492 | nmdc:mga0yw44_142464_c1 | nmdc:mga0yw44_142464_c1_60_470 | 136 |
| 541 | 3300050492 | nmdc:mga0yw44_15301_c1 | nmdc:mga0yw44_15301_c1_2533_2943 | 136 |
| 542 | 3300050492 | nmdc:mga0yw44_215454_c1 | nmdc:mga0yw44_215454_c1_28_438 | 136 |
| 543 | 3300050492 | nmdc:mga0yw44_464056_c1 | nmdc:mga0yw44_464056_c1_50_460 | 136 |
| 544 | 3300050492 | nmdc:mga0yw44_758273_c1 | nmdc:mga0yw44_758273_c1_53_463 | 136 |
| 545 | 3300050492 | nmdc:mga0yw44_98777_c1 | nmdc:mga0yw44_98777_c1_33_443 | 136 |
| 546 | 3300050494 | nmdc:mga06z11_140360_c1 | nmdc:mga06z11_140360_c1_320_733 | 136 |
| 547 | 3300050494 | nmdc:mga06z11_4117_c1 | nmdc:mga06z11_4117_c1_816_1226 | 136 |
| 548 | 3300050494 | nmdc:mga06z11_86081_c1 | nmdc:mga06z11_86081_c1_1196_1606 | 136 |
| 549 | 3300050495 | nmdc:mga04h51_174928_c1 | nmdc:mga04h51_174928_c1_324_734 | 136 |
| 550 | 3300050496 | nmdc:mga07m45_50544_c1 | nmdc:mga07m45_50544_c1_745_1155 | 136 |
| 551 | 3300050496 | nmdc:mga07m45_80553_c1 | nmdc:mga07m45_80553_c1_53_463 | 136 |
| 552 | 3300050509 | nmdc:mga0qj67_419368_c1 | nmdc:mga0qj67_419368_c1_511_921 | 136 |
| 553 | 3300050516 | nmdc:mga0sz30_2742_c1 | nmdc:mga0sz30_2742_c1_1309_1719 | 136 |
| 554 | 3300050516 | nmdc:mga0sz30_73493_c1 | nmdc:mga0sz30_73493_c1_64_474 | 136 |
| 555 | 3300050516 | nmdc:mga0sz30_93514_c1 | nmdc:mga0sz30_93514_c1_211_621 | 136 |
| 556 | 3300053079 | Ga0500610_0245956 | Ga0500610_0245956_85_495 | 136 |
| 557 | 3300053083 | Ga0495655_0003715 | Ga0495655_0003715_1213_1629 | 136 |
| 558 | 3300053085 | Ga0495619_0221785 | Ga0495619_0221785_857_1267 | 136 |
| 559 | 3300053085 | Ga0495619_0268887 | Ga0495619_0268887_722_1132 | 136 |
| 560 | 3300053088 | Ga0500644_0040039 | Ga0500644_0040039_46_456 | 136 |
| 561 | 3300053104 | Ga0500556_0253053 | Ga0500556_0253053_212_622 | 136 |
| 562 | 3300053108 | Ga0500562_040357 | Ga0500562_040357_702_1112 | 136 |
| 563 | 3300053129 | Ga0500628_161399 | Ga0500628_161399_76_492 | 136 |
| 564 | 3300053142 | Ga0500577_0311419 | Ga0500577_0311419_212_631 | 136 |
| 565 | 3300053151 | Ga0500604_0111155 | Ga0500604_0111155_309_728 | 136 |
| 566 | 3300059421 | Ga0590071_008796 | Ga0590071_008796_75_485 | 136 |
| 567 | 3300059423 | Ga0590074_015218 | Ga0590074_015218_392_802 | 136 |
| 568 | 3300059424 | Ga0590075_002363 | Ga0590075_002363_3414_3824 | 136 |
| 569 | 3300059424 | Ga0590075_022717 | Ga0590075_022717_884_1294 | 136 |
| 570 | 3300059426 | Ga0590077_003731 | Ga0590077_003731_2585_2995 | 136 |
| 571 | 3300059426 | Ga0590077_051866 | Ga0590077_051866_299_709 | 136 |
| 572 | 3300060353 | Ga0501082_0392410 | Ga0501082_0392410_389_820 | 136 |
| 573 | 3300061719 | Ga0466962_0537305 | Ga0466962_0537305_42_461 | 136 |
| 574 | 3300061719 | Ga0466962_0546680 | Ga0466962_0546680_25_447 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8762 | 1 | 135 |
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8701 | 1 | 135 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.8633 | 1 | 135 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.8574 | 1 | 135 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8466 | 4 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9273 | 83 | 134 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.922 | 83 | 132 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8697 | 84 | 136 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8551 | 83 | 132 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.851 | 83 | 134 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3EIF2-F1-model_v4 | VOC family protein | 0.9831 | 85 | 136 |
|
| AF-A0A7I9UZW0-F1-model_v4 | Glyoxalase | 0.9781 | 20 | 135 |
|
| AF-A0A4V2YPG6-F1-model_v4 | VOC family protein | 0.9732 | 2 | 136 |
|
| AF-A0A7W9QEY6-F1-model_v4 | Putative glyoxalase superfamily protein PhnB | 0.9729 | 1 | 136 |
|
| AF-A0A7Y9EC75-F1-model_v4 | Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme | 0.9718 | 1 | 136 |
GO:0016829
GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar