F465288
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 342 | 503 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100637095|Ga0070698_1006370952 |
| Length | 219 |
| Sequence | MLPQANRTPRRLLGKPGHHRESMNNEHNIMWTPWSGPGLEHLRLVQGDHLILADGLIIGVAEEGDQPFRARYTIQCDADWHVRELRIDMLDAANRRLDLMSDGAGHWADGAGEALPGLAGCFDVDISATPFTNTLPIRRLALPPGAAADVNVVYIVLPELTVAPGMQRYTCLASDAAGARYRYESRAHDFTAELPVDVHGLVEDYPGLFRRVAGEPPTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 6 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 7 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 8 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 9 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 10 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 11 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 12 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 13 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 14 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 15 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 16 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 17 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 18 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 19 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 20 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 21 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 22 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 23 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 24 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 25 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 26 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 27 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 28 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 29 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 30 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 31 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 32 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 33 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 34 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 35 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 36 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 37 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 38 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 39 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 40 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 41 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 42 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 43 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 44 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 45 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 46 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 47 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 48 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 49 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 50 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 51 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 52 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 53 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 54 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 55 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 56 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 57 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 58 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 59 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 60 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 61 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 62 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 63 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 64 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 65 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 66 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 67 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 69 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 71 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 77 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 83 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 94 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 95 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 102 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 112 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 193 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 310 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 331 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 332 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 333 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 334 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 335 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 336 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 337 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 338 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 339 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 340 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 341 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 342 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.59 |
| Metatranscriptomes | 1.05 |
| Isolates | 12.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.76 |
| Nodule | 2.09 |
| Rhizoplane | 3.14 |
| Rhizosphere | 72.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006615 | 3300001979 | Bacteria | 4780 |
| 2 | JGI24739J22299_10007134 | 3300001989 | Bacteria | 4205 |
| 3 | JGI24739J22299_10007865 | 3300001989 | Bacteria | 3989 |
| 4 | JGI24739J22299_10039797 | 3300001989 | Bacteria | 1572 |
| 5 | JGI24735J21928_10009051 | 3300002067 | Bacteria | 3207 |
| 6 | JGI24735J21928_10116847 | 3300002067 | Bacteria | 767 |
| 7 | JGI24735J21928_10133722 | 3300002067 | Bacteria | 715 |
| 8 | JGI24738J21930_10000325 | 3300002075 | Bacteria | 13138 |
| 9 | JGI25156J39149_1000268 | 3300002705 | Bacteria | 35281 |
| 10 | JGI25156J39149_1000806 | 3300002705 | Bacteria | 16042 |
| 11 | JGI25156J39149_1007208 | 3300002705 | Bacteria | 2950 |
| 12 | JGI25151J46595_10031075 | 3300003187 | Bacteria | 2090 |
| 13 | JGI25165J46597_1000701 | 3300003214 | Bacteria | 26658 |
| 14 | rootL2_10373663 | 3300003322 | Bacteria | 1365 |
| 15 | rootL2_10376628 | 3300003322 | Bacteria | 1461 |
| 16 | Ga0055538_1000252 | 3300003751 | Bacteria | 28500 |
| 17 | Ga0055533_1000091 | 3300003756 | Bacteria | 120504 |
| 18 | Ga0055533_1007581 | 3300003756 | Bacteria | 1460 |
| 19 | Ga0055532_1000045 | 3300003758 | Bacteria | 186314 |
| 20 | Ga0055532_1000975 | 3300003758 | Bacteria | 9129 |
| 21 | Ga0055532_1001032 | 3300003758 | Bacteria | 8611 |
| 22 | Ga0055532_1001063 | 3300003758 | Bacteria | 8512 |
| 23 | Ga0055527_1000027 | 3300003760 | Bacteria | 186314 |
| 24 | Ga0055527_1000358 | 3300003760 | Bacteria | 21912 |
| 25 | Ga0055527_1009494 | 3300003760 | Bacteria | 1142 |
| 26 | Ga0055535_1000033 | 3300003761 | Bacteria | 186314 |
| 27 | Ga0055535_1000842 | 3300003761 | Bacteria | 21912 |
| 28 | Ga0055535_1001338 | 3300003761 | Bacteria | 13010 |
| 29 | Ga0055542_1000050 | 3300003762 | Bacteria | 186314 |
| 30 | Ga0055542_1001904 | 3300003762 | Bacteria | 8254 |
| 31 | Ga0055529_1000061 | 3300003763 | Bacteria | 186314 |
| 32 | Ga0055529_1000639 | 3300003763 | Bacteria | 25736 |
| 33 | Ga0055529_1005263 | 3300003763 | Bacteria | 1886 |
| 34 | Ga0055528_1003340 | 3300003790 | Bacteria | 8125 |
| 35 | Ga0055541_1009092 | 3300003841 | Bacteria | 1552 |
| 36 | Ga0058692_1000139 | 3300003856 | Bacteria | 46218 |
| 37 | Ga0058861_11200430 | 3300004800 | Bacteria | 1135 |
| 38 | Ga0058862_12827803 | 3300004803 | Bacteria | 2844 |
| 39 | Ga0070683_100893914 | 3300005329 | Bacteria | 852 |
| 40 | Ga0070670_100869891 | 3300005331 | Bacteria | 816 |
| 41 | Ga0070680_100081489 | 3300005336 | Bacteria | 2670 |
| 42 | Ga0068868_100422123 | 3300005338 | Bacteria | 1155 |
| 43 | Ga0070660_100000171 | 3300005339 | Bacteria | 42584 |
| 44 | Ga0070668_100168507 | 3300005347 | Bacteria | 1781 |
| 45 | Ga0070673_100602921 | 3300005364 | Bacteria | 1002 |
| 46 | Ga0070688_100902541 | 3300005365 | Bacteria | 697 |
| 47 | Ga0070659_100000028 | 3300005366 | Bacteria | 140665 |
| 48 | Ga0070667_100215128 | 3300005367 | Bacteria | 1709 |
| 49 | Ga0070713_100972148 | 3300005436 | Unclassified | 818 |
| 50 | Ga0070708_100671185 | 3300005445 | Archaea | 976 |
| 51 | Ga0070663_100002373 | 3300005455 | Bacteria | 10592 |
| 52 | Ga0070663_100505050 | 3300005455 | Bacteria | 1005 |
| 53 | Ga0070662_100774620 | 3300005457 | Bacteria | 815 |
| 54 | Ga0070681_10101400 | 3300005458 | Bacteria | 2824 |
| 55 | Ga0068867_101218919 | 3300005459 | Bacteria | 692 |
| 56 | Ga0070698_100637095 | 3300005471 | Bacteria | 1007 |
| 57 | Ga0070684_100256805 | 3300005535 | Bacteria | 1598 |
| 58 | Ga0070672_100022714 | 3300005543 | Bacteria | 4613 |
| 59 | Ga0070696_100158644 | 3300005546 | Bacteria | 1665 |
| 60 | Ga0068855_100010177 | 3300005563 | Bacteria | 11335 |
| 61 | Ga0068856_100670166 | 3300005614 | Bacteria | 1058 |
| 62 | Ga0068859_101904371 | 3300005617 | Bacteria | 657 |
| 63 | Ga0068864_100732940 | 3300005618 | Bacteria | 968 |
| 64 | Ga0068861_100341394 | 3300005719 | Bacteria | 1311 |
| 65 | Ga0068863_100407409 | 3300005841 | Bacteria | 1331 |
| 66 | Ga0068858_100434861 | 3300005842 | Bacteria | 1263 |
| 67 | Ga0081539_10020762 | 3300005985 | Unclassified | 4420 |
| 68 | Ga0075362_10017922 | 3300006177 | Bacteria | 2924 |
| 69 | Ga0075369_10037307 | 3300006186 | Bacteria | 2070 |
| 70 | Ga0075366_10411904 | 3300006195 | Bacteria | 832 |
| 71 | Ga0075428_100007145 | 3300006844 | Bacteria | 12370 |
| 72 | Ga0075431_100383496 | 3300006847 | Bacteria | 1409 |
| 73 | Ga0075433_10327920 | 3300006852 | Bacteria | 1354 |
| 74 | Ga0097620_101904392 | 3300006931 | Bacteria | 657 |
| 75 | Ga0105251_10000683 | 3300009011 | Bacteria | 31295 |
| 76 | Ga0105244_10000269 | 3300009036 | Bacteria | 52299 |
| 77 | Ga0105250_10057252 | 3300009092 | Bacteria | 1564 |
| 78 | Ga0105240_10005221 | 3300009093 | Bacteria | 19429 |
| 79 | Ga0105240_10047555 | 3300009093 | Bacteria | 5429 |
| 80 | Ga0105240_11173217 | 3300009093 | Bacteria | 814 |
| 81 | Ga0111539_10012350 | 3300009094 | Bacteria | 10704 |
| 82 | Ga0111539_11453764 | 3300009094 | Bacteria | 795 |
| 83 | Ga0114129_10152815 | 3300009147 | Bacteria | 3158 |
| 84 | Ga0105241_10053429 | 3300009174 | Bacteria | 3089 |
| 85 | Ga0105241_10557287 | 3300009174 | Bacteria | 1030 |
| 86 | Ga0105242_10243110 | 3300009176 | Bacteria | 1619 |
| 87 | Ga0105242_11339692 | 3300009176 | Unclassified | 741 |
| 88 | Ga0105237_10031570 | 3300009545 | Bacteria | 5367 |
| 89 | Ga0105237_10050021 | 3300009545 | Bacteria | 4200 |
| 90 | Ga0105238_10096060 | 3300009551 | Bacteria | 2950 |
| 91 | Ga0105238_10252350 | 3300009551 | Bacteria | 1743 |
| 92 | Ga0105239_10023248 | 3300010375 | Bacteria | 6829 |
| 93 | Ga0105246_10294864 | 3300011119 | Bacteria | 1306 |
| 94 | Ga0157373_10121499 | 3300013100 | Bacteria | 1836 |
| 95 | Ga0157370_11233314 | 3300013104 | Bacteria | 674 |
| 96 | Ga0157369_10052820 | 3300013105 | Bacteria | 4395 |
| 97 | Ga0157369_10118990 | 3300013105 | Bacteria | 2803 |
| 98 | Ga0157369_10220712 | 3300013105 | Bacteria | 1984 |
| 99 | Ga0157378_10088327 | 3300013297 | Bacteria | 2813 |
| 100 | Ga0163162_10029660 | 3300013306 | Bacteria | 5416 |
| 101 | Ga0157375_10204524 | 3300013308 | Bacteria | 2131 |
| 102 | Ga0157375_11650080 | 3300013308 | Bacteria | 758 |
| 103 | Ga0157380_10150876 | 3300014326 | Bacteria | 2009 |
| 104 | Ga0182008_10017502 | 3300014497 | Bacteria | 3717 |
| 105 | Ga0182008_10120200 | 3300014497 | Bacteria | 1305 |
| 106 | Ga0157379_10545179 | 3300014968 | Bacteria | 1079 |
| 107 | Ga0182006_1064466 | 3300015261 | Bacteria | 1374 |
| 108 | Ga0182007_10001199 | 3300015262 | Bacteria | 14075 |
| 109 | Ga0182007_10004747 | 3300015262 | Bacteria | 6112 |
| 110 | Ga0163161_10090260 | 3300017792 | Bacteria | 2267 |
| 111 | Ga0197907_11185765 | 3300020069 | Bacteria | 1008 |
| 112 | Ga0206356_11130835 | 3300020070 | Bacteria | 724 |
| 113 | Ga0206351_10791431 | 3300020077 | Bacteria | 802 |
| 114 | Ga0206353_12056884 | 3300020082 | Bacteria | 778 |
| 115 | Ga0209784_100121 | 3300025224 | Bacteria | 82273 |
| 116 | Ga0209566_101490 | 3300025225 | Bacteria | 6639 |
| 117 | Ga0209674_100074 | 3300025226 | Bacteria | 223554 |
| 118 | Ga0209674_100102 | 3300025226 | Bacteria | 155582 |
| 119 | Ga0209674_101245 | 3300025226 | Bacteria | 7190 |
| 120 | Ga0209672_100042 | 3300025228 | Bacteria | 272005 |
| 121 | Ga0209672_100053 | 3300025228 | Bacteria | 223599 |
| 122 | Ga0209672_100131 | 3300025228 | Bacteria | 74237 |
| 123 | Ga0209147_100012 | 3300025229 | Bacteria | 681990 |
| 124 | Ga0209147_100052 | 3300025229 | Bacteria | 272005 |
| 125 | Ga0209147_100070 | 3300025229 | Bacteria | 223535 |
| 126 | Ga0209147_100291 | 3300025229 | Bacteria | 42708 |
| 127 | Ga0209563_100691 | 3300025230 | Bacteria | 10638 |
| 128 | Ga0207427_103762 | 3300025231 | Bacteria | 2945 |
| 129 | Ga0209258_100030 | 3300025242 | Bacteria | 470208 |
| 130 | Ga0209258_100073 | 3300025242 | Bacteria | 272005 |
| 131 | Ga0209258_100094 | 3300025242 | Bacteria | 223535 |
| 132 | Ga0209148_1000022 | 3300025254 | Bacteria | 681990 |
| 133 | Ga0209148_1000100 | 3300025254 | Bacteria | 223604 |
| 134 | Ga0209148_1000524 | 3300025254 | Bacteria | 37800 |
| 135 | Ga0209759_1000009 | 3300025256 | Bacteria | 446623 |
| 136 | Ga0209759_1000036 | 3300025256 | Bacteria | 261374 |
| 137 | Ga0209759_1000143 | 3300025256 | Bacteria | 123727 |
| 138 | Ga0209759_1013489 | 3300025256 | Bacteria | 2207 |
| 139 | Ga0209233_1000144 | 3300025261 | Bacteria | 190024 |
| 140 | Ga0209565_1015513 | 3300025263 | Bacteria | 1717 |
| 141 | Ga0209455_1000024 | 3300025272 | Bacteria | 676133 |
| 142 | Ga0209455_1000090 | 3300025272 | Bacteria | 223604 |
| 143 | Ga0209455_1001569 | 3300025272 | Bacteria | 10072 |
| 144 | Ga0209673_1000021 | 3300025273 | Bacteria | 422978 |
| 145 | Ga0209025_1001634 | 3300025294 | Bacteria | 27854 |
| 146 | Ga0209564_1011401 | 3300025295 | Bacteria | 3987 |
| 147 | Ga0207655_1001542 | 3300025728 | Bacteria | 20809 |
| 148 | Ga0207713_1003522 | 3300025735 | Bacteria | 10613 |
| 149 | Ga0207647_10004058 | 3300025904 | Bacteria | 10904 |
| 150 | Ga0207647_10016712 | 3300025904 | Bacteria | 5001 |
| 151 | Ga0207647_10017989 | 3300025904 | Bacteria | 4791 |
| 152 | Ga0207647_10165267 | 3300025904 | Bacteria | 1290 |
| 153 | Ga0207705_10013047 | 3300025909 | Bacteria | 5996 |
| 154 | Ga0207707_10103667 | 3300025912 | Bacteria | 2486 |
| 155 | Ga0207707_10140846 | 3300025912 | Bacteria | 2109 |
| 156 | Ga0207695_10003099 | 3300025913 | Bacteria | 23798 |
| 157 | Ga0207695_10093286 | 3300025913 | Bacteria | 3020 |
| 158 | Ga0207695_10934132 | 3300025913 | Bacteria | 747 |
| 159 | Ga0207671_10024389 | 3300025914 | Bacteria | 4549 |
| 160 | Ga0207671_10205540 | 3300025914 | Bacteria | 1539 |
| 161 | Ga0207657_10000111 | 3300025919 | Bacteria | 79991 |
| 162 | Ga0207652_10021727 | 3300025921 | Bacteria | 5299 |
| 163 | Ga0207681_10119281 | 3300025923 | Bacteria | 1932 |
| 164 | Ga0207694_10368710 | 3300025924 | Bacteria | 1191 |
| 165 | Ga0207690_10000009 | 3300025932 | Bacteria | 366044 |
| 166 | Ga0207706_10016553 | 3300025933 | Bacteria | 6657 |
| 167 | Ga0207686_10233007 | 3300025934 | Bacteria | 1336 |
| 168 | Ga0207670_10306178 | 3300025936 | Bacteria | 1246 |
| 169 | Ga0207691_10067223 | 3300025940 | Bacteria | 3241 |
| 170 | Ga0207711_10136814 | 3300025941 | Bacteria | 2201 |
| 171 | Ga0207689_10351290 | 3300025942 | Bacteria | 1226 |
| 172 | Ga0207667_10003058 | 3300025949 | Bacteria | 20744 |
| 173 | Ga0207667_10386611 | 3300025949 | Bacteria | 1425 |
| 174 | Ga0207668_10070719 | 3300025972 | Bacteria | 2490 |
| 175 | Ga0207668_10359085 | 3300025972 | Bacteria | 1220 |
| 176 | Ga0207640_10482295 | 3300025981 | Archaea | 1029 |
| 177 | Ga0207677_10340599 | 3300026023 | Bacteria | 1253 |
| 178 | Ga0207678_10003675 | 3300026067 | Bacteria | 13792 |
| 179 | Ga0207678_10241666 | 3300026067 | Bacteria | 1546 |
| 180 | Ga0207702_10312262 | 3300026078 | Bacteria | 1495 |
| 181 | Ga0207641_10122291 | 3300026088 | Bacteria | 2325 |
| 182 | Ga0207676_10479600 | 3300026095 | Bacteria | 1178 |
| 183 | Ga0207675_100924449 | 3300026118 | Bacteria | 889 |
| 184 | Ga0207675_101120261 | 3300026118 | Archaea | 807 |
| 185 | Ga0207683_10349941 | 3300026121 | Bacteria | 1356 |
| 186 | Ga0207698_11015512 | 3300026142 | Bacteria | 840 |
| 187 | Ga0209371_1000128 | 3300027312 | Bacteria | 124861 |
| 188 | Ga0209371_1000421 | 3300027312 | Bacteria | 43622 |
| 189 | Ga0207428_10015492 | 3300027907 | Bacteria | 6595 |
| 190 | Ga0268265_11218629 | 3300028380 | Bacteria | 751 |
| 191 | Ga0265338_10000058 | 3300028800 | Bacteria | 198555 |
| 192 | Ga0268256_1000360 | 3300030500 | Bacteria | 43620 |
| 193 | Ga0268256_1000513 | 3300030500 | Bacteria | 32533 |
| 194 | Ga0316181_1244883 | 3300030744 | Bacteria | 1337 |
| 195 | Ga0316182_1073515 | 3300030745 | Archaea | 831 |
| 196 | Ga0265340_10077825 | 3300031247 | Bacteria | 1564 |
| 197 | Ga0265340_10148371 | 3300031247 | Bacteria | 1070 |
| 198 | Ga0265316_10184774 | 3300031344 | Bacteria | 1551 |
| 199 | Ga0265314_10217150 | 3300031711 | Bacteria | 1118 |
| 200 | Ga0307413_10159869 | 3300031824 | Archaea | 1581 |
| 201 | Ga0307410_10118072 | 3300031852 | Archaea | 1930 |
| 202 | Ga0307410_10457216 | 3300031852 | Archaea | 1043 |
| 203 | Ga0307406_10330059 | 3300031901 | Archaea | 1184 |
| 204 | Ga0307412_10000041 | 3300031911 | Bacteria | 179188 |
| 205 | Ga0307412_10316209 | 3300031911 | Bacteria | 1240 |
| 206 | Ga0307409_100256483 | 3300031995 | Archaea | 1602 |
| 207 | Ga0307409_100263650 | 3300031995 | Bacteria | 1583 |
| 208 | Ga0307416_100347452 | 3300032002 | Archaea | 1499 |
| 209 | Ga0307414_10093666 | 3300032004 | Archaea | 2240 |
| 210 | Ga0307414_10148292 | 3300032004 | Bacteria | 1847 |
| 211 | Ga0307411_10354943 | 3300032005 | Bacteria | 1197 |
| 212 | Ga0307415_100107326 | 3300032126 | Bacteria | 2063 |
| 213 | Ga0373923_0141176 | 3300035111 | Bacteria | 1089 |
| 214 | Ga0373945_0121277 | 3300035116 | Bacteria | 1040 |
| 215 | Ga0373955_0233798 | 3300035172 | Bacteria | 1100 |
| 216 | Ga0373927_0653413 | 3300035695 | Bacteria | 695 |
| 217 | Ga0373933_0502841 | 3300035724 | Bacteria | 794 |
| 218 | Ga0395898_0226552 | 3300037466 | Bacteria | 1783 |
| 219 | Ga0436364_1544520 | 3300037853 | Bacteria | 2033 |
| 220 | Ga0436361_0941473 | 3300039447 | Bacteria | 829 |
| 221 | Ga0466961_0060953 | 3300044693 | Bacteria | 2398 |
| 222 | Ga0466957_0059313 | 3300044842 | Bacteria | 2345 |
| 223 | Ga0466960_0055329 | 3300044901 | Bacteria | 1929 |
| 224 | Ga0495592_0029413 | 3300046454 | Bacteria | 4160 |
| 225 | Ga0495592_0074085 | 3300046454 | Bacteria | 2473 |
| 226 | Ga0495592_0134578 | 3300046454 | Bacteria | 1725 |
| 227 | Ga0495592_0197333 | 3300046454 | Bacteria | 1360 |
| 228 | Ga0495603_0000545 | 3300046455 | Bacteria | 21000 |
| 229 | Ga0495603_0010952 | 3300046455 | Bacteria | 5502 |
| 230 | Ga0495603_0072607 | 3300046455 | Bacteria | 2022 |
| 231 | Ga0495603_0123992 | 3300046455 | Bacteria | 1505 |
| 232 | Ga0495603_0227178 | 3300046455 | Bacteria | 1076 |
| 233 | Ga0495590_0015044 | 3300046457 | Bacteria | 2815 |
| 234 | Ga0495590_0016739 | 3300046457 | Bacteria | 2646 |
| 235 | Ga0495591_001885 | 3300046458 | Bacteria | 12336 |
| 236 | Ga0495629_0000061 | 3300046459 | Bacteria | 100620 |
| 237 | Ga0495629_0000090 | 3300046459 | Bacteria | 80615 |
| 238 | Ga0495629_0002691 | 3300046459 | Bacteria | 13617 |
| 239 | Ga0495629_0005335 | 3300046459 | Bacteria | 9601 |
| 240 | Ga0495629_0015491 | 3300046459 | Bacteria | 5474 |
| 241 | Ga0495638_0011722 | 3300046460 | Bacteria | 6038 |
| 242 | Ga0495641_0109046 | 3300046461 | Bacteria | 1235 |
| 243 | Ga0495651_0032029 | 3300046462 | Bacteria | 4101 |
| 244 | Ga0495651_0127898 | 3300046462 | Bacteria | 1858 |
| 245 | Ga0495651_0285777 | 3300046462 | Bacteria | 1112 |
| 246 | Ga0495651_0411841 | 3300046462 | Bacteria | 880 |
| 247 | Ga0495653_0000137 | 3300046463 | Bacteria | 60893 |
| 248 | Ga0495653_0042603 | 3300046463 | Bacteria | 3534 |
| 249 | Ga0495653_0049030 | 3300046463 | Bacteria | 3256 |
| 250 | Ga0495653_0055825 | 3300046463 | Bacteria | 3013 |
| 251 | Ga0495653_0074242 | 3300046463 | Bacteria | 2534 |
| 252 | Ga0495653_0147947 | 3300046463 | Bacteria | 1644 |
| 253 | Ga0495653_0550268 | 3300046463 | Bacteria | 714 |
| 254 | Ga0495650_0000374 | 3300046471 | Bacteria | 78199 |
| 255 | Ga0495650_0005494 | 3300046471 | Bacteria | 8197 |
| 256 | Ga0495650_0011621 | 3300046471 | Bacteria | 4805 |
| 257 | Ga0495650_0016353 | 3300046471 | Bacteria | 3762 |
| 258 | Ga0495650_0104794 | 3300046471 | Bacteria | 1057 |
| 259 | Ga0495580_0000399 | 3300046472 | Bacteria | 35561 |
| 260 | Ga0495580_0001516 | 3300046472 | Bacteria | 20427 |
| 261 | Ga0495580_0003829 | 3300046472 | Bacteria | 12718 |
| 262 | Ga0495580_0007048 | 3300046472 | Bacteria | 9061 |
| 263 | Ga0495580_0031518 | 3300046472 | Bacteria | 3830 |
| 264 | Ga0495580_0064197 | 3300046472 | Bacteria | 2574 |
| 265 | Ga0495580_0283719 | 3300046472 | Bacteria | 1129 |
| 266 | Ga0495580_0511378 | 3300046472 | Bacteria | 801 |
| 267 | Ga0495580_0557249 | 3300046472 | Bacteria | 760 |
| 268 | Ga0495582_0001828 | 3300046473 | Bacteria | 12026 |
| 269 | Ga0495582_0007890 | 3300046473 | Bacteria | 5884 |
| 270 | Ga0495582_0008579 | 3300046473 | Bacteria | 5635 |
| 271 | Ga0495582_0028456 | 3300046473 | Bacteria | 3067 |
| 272 | Ga0495582_0107166 | 3300046473 | Bacteria | 1568 |
| 273 | Ga0495605_0006065 | 3300046474 | Bacteria | 6982 |
| 274 | Ga0495605_0028262 | 3300046474 | Bacteria | 2896 |
| 275 | Ga0495662_0008733 | 3300046476 | Bacteria | 4983 |
| 276 | Ga0495662_0024590 | 3300046476 | Bacteria | 2906 |
| 277 | Ga0495662_0042229 | 3300046476 | Bacteria | 2201 |
| 278 | Ga0495664_0010194 | 3300046477 | Bacteria | 5273 |
| 279 | Ga0495664_0017290 | 3300046477 | Bacteria | 4121 |
| 280 | Ga0495664_0033627 | 3300046477 | Bacteria | 3013 |
| 281 | Ga0495664_0111922 | 3300046477 | Bacteria | 1648 |
| 282 | Ga0495594_0156654 | 3300046499 | Bacteria | 1294 |
| 283 | Ga0495596_0002259 | 3300046500 | Bacteria | 10478 |
| 284 | Ga0495596_0013187 | 3300046500 | Bacteria | 3515 |
| 285 | Ga0495596_0048130 | 3300046500 | Bacteria | 1672 |
| 286 | Ga0495596_0068846 | 3300046500 | Bacteria | 1375 |
| 287 | Ga0495583_0044188 | 3300046506 | Bacteria | 2069 |
| 288 | Ga0495583_0231009 | 3300046506 | Bacteria | 745 |
| 289 | Ga0495606_0097341 | 3300046507 | Bacteria | 1798 |
| 290 | Ga0495606_0176817 | 3300046507 | Bacteria | 1234 |
| 291 | Ga0495608_0054093 | 3300046511 | Bacteria | 2654 |
| 292 | Ga0495608_0116511 | 3300046511 | Bacteria | 1714 |
| 293 | Ga0495610_0023589 | 3300046512 | Bacteria | 3339 |
| 294 | Ga0495618_0001699 | 3300046514 | Bacteria | 14622 |
| 295 | Ga0495620_0057900 | 3300046515 | Bacteria | 1624 |
| 296 | Ga0495628_0002713 | 3300046516 | Bacteria | 15854 |
| 297 | Ga0495628_0044710 | 3300046516 | Bacteria | 3522 |
| 298 | Ga0495628_0081186 | 3300046516 | Bacteria | 2518 |
| 299 | Ga0495628_0090932 | 3300046516 | Bacteria | 2362 |
| 300 | Ga0495628_0445036 | 3300046516 | Bacteria | 941 |
| 301 | Ga0495630_0008234 | 3300046517 | Bacteria | 7487 |
| 302 | Ga0495630_0060344 | 3300046517 | Bacteria | 2846 |
| 303 | Ga0495630_0067558 | 3300046517 | Bacteria | 2687 |
| 304 | Ga0495630_0069753 | 3300046517 | Bacteria | 2644 |
| 305 | Ga0495630_0097572 | 3300046517 | Bacteria | 2222 |
| 306 | Ga0495631_0147959 | 3300046518 | Bacteria | 1008 |
| 307 | Ga0495643_0053921 | 3300046522 | Bacteria | 2154 |
| 308 | Ga0495643_0192414 | 3300046522 | Bacteria | 984 |
| 309 | Ga0495648_0002524 | 3300046524 | Bacteria | 16784 |
| 310 | Ga0495648_0011234 | 3300046524 | Bacteria | 6760 |
| 311 | Ga0495666_0002715 | 3300046526 | Bacteria | 8840 |
| 312 | Ga0495666_0007405 | 3300046526 | Bacteria | 5502 |
| 313 | Ga0495666_0008867 | 3300046526 | Bacteria | 5038 |
| 314 | Ga0495666_0054399 | 3300046526 | Bacteria | 1919 |
| 315 | Ga0495666_0097418 | 3300046526 | Bacteria | 1386 |
| 316 | Ga0495642_0006871 | 3300046528 | Bacteria | 4362 |
| 317 | Ga0495642_0102255 | 3300046528 | Bacteria | 1220 |
| 318 | Ga0495642_0470088 | 3300046528 | Bacteria | 556 |
| 319 | Ga0495652_0355337 | 3300046529 | Bacteria | 1048 |
| 320 | Ga0495652_0360632 | 3300046529 | Bacteria | 1039 |
| 321 | Ga0495652_0430747 | 3300046529 | Archaea | 927 |
| 322 | Ga0495652_0437933 | 3300046529 | Bacteria | 918 |
| 323 | Ga0495654_0031625 | 3300046530 | Bacteria | 2686 |
| 324 | Ga0495665_0004509 | 3300046531 | Bacteria | 7515 |
| 325 | Ga0495665_0007971 | 3300046531 | Bacteria | 5743 |
| 326 | Ga0495665_0013619 | 3300046531 | Bacteria | 4396 |
| 327 | Ga0495665_0137427 | 3300046531 | Bacteria | 1278 |
| 328 | Ga0495640_0012947 | 3300046533 | Bacteria | 6358 |
| 329 | Ga0495640_0070824 | 3300046533 | Bacteria | 2341 |
| 330 | Ga0495640_0080366 | 3300046533 | Bacteria | 2168 |
| 331 | Ga0495586_0015452 | 3300046535 | Bacteria | 4061 |
| 332 | Ga0495586_0139775 | 3300046535 | Bacteria | 1359 |
| 333 | Ga0495587_0007500 | 3300046536 | Bacteria | 7063 |
| 334 | Ga0495587_0008174 | 3300046536 | Bacteria | 6742 |
| 335 | Ga0495609_0016409 | 3300046538 | Bacteria | 3451 |
| 336 | Ga0495645_0002363 | 3300046543 | Bacteria | 12796 |
| 337 | Ga0495645_0009186 | 3300046543 | Bacteria | 6907 |
| 338 | Ga0495622_0003296 | 3300046557 | Bacteria | 7635 |
| 339 | Ga0495667_0031383 | 3300046559 | Bacteria | 3567 |
| 340 | Ga0495634_0012286 | 3300046642 | Bacteria | 6206 |
| 341 | Ga0495634_0015132 | 3300046642 | Bacteria | 5545 |
| 342 | Ga0495634_0015698 | 3300046642 | Bacteria | 5432 |
| 343 | Ga0495634_0381902 | 3300046642 | Archaea | 839 |
| 344 | Ga0495611_0027740 | 3300046648 | Bacteria | 2477 |
| 345 | Ga0495611_0298198 | 3300046648 | Bacteria | 743 |
| 346 | Ga0495625_0050666 | 3300046660 | Bacteria | 2979 |
| 347 | Ga0495625_0225209 | 3300046660 | Bacteria | 1227 |
| 348 | Ga0495635_0007375 | 3300046663 | Bacteria | 7673 |
| 349 | Ga0495635_0029430 | 3300046663 | Bacteria | 3819 |
| 350 | Ga0495661_0012011 | 3300046665 | Bacteria | 5860 |
| 351 | Ga0495661_0154210 | 3300046665 | Bacteria | 1238 |
| 352 | Ga0495588_0072219 | 3300046674 | Bacteria | 1795 |
| 353 | Ga0495657_0137947 | 3300046675 | Bacteria | 1522 |
| 354 | Ga0495599_0023487 | 3300046678 | Bacteria | 3855 |
| 355 | Ga0495599_0049478 | 3300046678 | Bacteria | 2634 |
| 356 | Ga0495623_0003385 | 3300046679 | Bacteria | 10543 |
| 357 | Ga0495623_0006011 | 3300046679 | Bacteria | 7897 |
| 358 | Ga0495623_0017147 | 3300046679 | Bacteria | 4677 |
| 359 | Ga0495623_0096302 | 3300046679 | Bacteria | 1808 |
| 360 | Ga0495623_0124068 | 3300046679 | Bacteria | 1552 |
| 361 | Ga0495646_0002486 | 3300046680 | Bacteria | 11313 |
| 362 | Ga0495646_0007426 | 3300046680 | Bacteria | 6966 |
| 363 | Ga0495646_0041094 | 3300046680 | Bacteria | 2843 |
| 364 | Ga0495646_0051918 | 3300046680 | Bacteria | 2479 |
| 365 | Ga0495646_0089864 | 3300046680 | Bacteria | 1776 |
| 366 | Ga0495646_0260082 | 3300046680 | Bacteria | 927 |
| 367 | Ga0495669_0012531 | 3300046684 | Bacteria | 3610 |
| 368 | Ga0495669_0366841 | 3300046684 | Bacteria | 696 |
| 369 | Ga0495613_0015113 | 3300046689 | Bacteria | 5733 |
| 370 | Ga0495613_0087978 | 3300046689 | Bacteria | 2251 |
| 371 | Ga0495613_0270885 | 3300046689 | Bacteria | 1181 |
| 372 | Ga0495624_0001954 | 3300046690 | Bacteria | 15681 |
| 373 | Ga0495624_0002906 | 3300046690 | Bacteria | 12810 |
| 374 | Ga0495624_0036200 | 3300046690 | Bacteria | 3184 |
| 375 | Ga0495624_0064311 | 3300046690 | Bacteria | 2292 |
| 376 | Ga0495670_0114065 | 3300046691 | Bacteria | 1400 |
| 377 | Ga0495671_0080129 | 3300046692 | Bacteria | 1600 |
| 378 | Ga0495671_0112082 | 3300046692 | Bacteria | 1332 |
| 379 | Ga0495671_0219859 | 3300046692 | Bacteria | 919 |
| 380 | Ga0495649_0015997 | 3300046694 | Bacteria | 4259 |
| 381 | Ga0495649_0025996 | 3300046694 | Bacteria | 3258 |
| 382 | Ga0495589_0061757 | 3300046794 | Bacteria | 1838 |
| 383 | Ga0495589_0065606 | 3300046794 | Bacteria | 1779 |
| 384 | Ga0495589_0253649 | 3300046794 | Bacteria | 821 |
| 385 | Ga0495600_0027105 | 3300046809 | Bacteria | 3702 |
| 386 | Ga0495600_0058450 | 3300046809 | Bacteria | 2519 |
| 387 | Ga0495581_0006415 | 3300047315 | Bacteria | 6826 |
| 388 | Ga0495581_0008365 | 3300047315 | Bacteria | 5996 |
| 389 | Ga0495581_0125202 | 3300047315 | Bacteria | 1496 |
| 390 | Ga0495604_0006883 | 3300047317 | Bacteria | 9017 |
| 391 | Ga0495604_0011173 | 3300047317 | Bacteria | 7130 |
| 392 | Ga0495604_0047585 | 3300047317 | Bacteria | 3339 |
| 393 | Ga0495604_0147055 | 3300047317 | Bacteria | 1678 |
| 394 | Ga0495604_0401122 | 3300047317 | Bacteria | 903 |
| 395 | Ga0495604_0404563 | 3300047317 | Bacteria | 898 |
| 396 | Ga0495674_0005420 | 3300047319 | Bacteria | 12247 |
| 397 | Ga0495674_0304743 | 3300047319 | Bacteria | 1300 |
| 398 | Ga0495674_0331059 | 3300047319 | Bacteria | 1239 |
| 399 | Ga0495672_0052833 | 3300047320 | Bacteria | 2384 |
| 400 | Ga0495672_0407332 | 3300047320 | Bacteria | 621 |
| 401 | Ga0495676_0010656 | 3300047321 | Bacteria | 8326 |
| 402 | Ga0495676_0028717 | 3300047321 | Bacteria | 4746 |
| 403 | Ga0495676_0059310 | 3300047321 | Bacteria | 3006 |
| 404 | Ga0495676_0153261 | 3300047321 | Bacteria | 1637 |
| 405 | Ga0495680_0182359 | 3300047322 | Bacteria | 1514 |
| 406 | Ga0495680_0210916 | 3300047322 | Bacteria | 1390 |
| 407 | Ga0495680_0497986 | 3300047322 | Bacteria | 827 |
| 408 | Ga0495680_0756867 | 3300047322 | Bacteria | 637 |
| 409 | Ga0495683_0007609 | 3300047323 | Bacteria | 5835 |
| 410 | Ga0495683_0011002 | 3300047323 | Bacteria | 4771 |
| 411 | Ga0495683_0015440 | 3300047323 | Bacteria | 3974 |
| 412 | Ga0495687_011743 | 3300047443 | Bacteria | 4684 |
| 413 | Ga0495687_013687 | 3300047443 | Bacteria | 4216 |
| 414 | Ga0495675_0006688 | 3300047444 | Bacteria | 7063 |
| 415 | Ga0495675_0012339 | 3300047444 | Bacteria | 5377 |
| 416 | Ga0495675_0050322 | 3300047444 | Bacteria | 2648 |
| 417 | Ga0495675_0184382 | 3300047444 | Bacteria | 1276 |
| 418 | Ga0495675_0352537 | 3300047444 | Archaea | 865 |
| 419 | Ga0495679_000026 | 3300047446 | Bacteria | 196639 |
| 420 | Ga0495679_000708 | 3300047446 | Bacteria | 21613 |
| 421 | Ga0495679_002155 | 3300047446 | Bacteria | 10341 |
| 422 | Ga0495679_016721 | 3300047446 | Bacteria | 2647 |
| 423 | Ga0495673_0003485 | 3300047469 | Bacteria | 10349 |
| 424 | Ga0495681_0063494 | 3300047470 | Bacteria | 1694 |
| 425 | Ga0495684_0030195 | 3300047471 | Bacteria | 4161 |
| 426 | Ga0495684_0208803 | 3300047471 | Bacteria | 1437 |
| 427 | Ga0495686_0312085 | 3300047472 | Bacteria | 864 |
| 428 | Ga0495593_0001493 | 3300047673 | Bacteria | 13761 |
| 429 | Ga0495593_0003020 | 3300047673 | Bacteria | 10134 |
| 430 | Ga0495593_0015460 | 3300047673 | Bacteria | 4321 |
| 431 | Ga0495593_0037926 | 3300047673 | Bacteria | 2604 |
| 432 | Ga0495593_0176960 | 3300047673 | Bacteria | 1074 |
| 433 | Ga0495602_0001347 | 3300048088 | Bacteria | 24240 |
| 434 | Ga0495602_0125765 | 3300048088 | Bacteria | 2054 |
| 435 | Ga0495602_0282669 | 3300048088 | Bacteria | 1221 |
| 436 | Ga0495602_0306362 | 3300048088 | Bacteria | 1160 |
| 437 | Ga0495602_0349435 | 3300048088 | Bacteria | 1067 |
| 438 | Ga0495614_0001197 | 3300048089 | Bacteria | 11145 |
| 439 | Ga0495614_0024782 | 3300048089 | Bacteria | 2590 |
| 440 | Ga0495614_0063661 | 3300048089 | Bacteria | 1585 |
| 441 | Ga0495614_0209585 | 3300048089 | Bacteria | 883 |
| 442 | Ga0495626_0040058 | 3300048091 | Bacteria | 2214 |
| 443 | Ga0496100_0227636 | 3300048903 | Bacteria | 1370 |
| 444 | Ga0496101_0102345 | 3300048904 | Bacteria | 2145 |
| 445 | Ga0496102_0021246 | 3300048905 | Bacteria | 5741 |
| 446 | Ga0496103_0004217 | 3300048906 | Bacteria | 8726 |
| 447 | Ga0496103_0471881 | 3300048906 | Bacteria | 804 |
| 448 | Ga0496104_0123594 | 3300048907 | Bacteria | 2484 |
| 449 | Ga0496104_0364958 | 3300048907 | Bacteria | 1356 |
| 450 | Ga0496106_0491580 | 3300048909 | Bacteria | 986 |
| 451 | Ga0496110_1180823 | 3300048913 | Archaea | 674 |
| 452 | Ga0496112_0644483 | 3300048915 | Bacteria | 989 |
| 453 | Ga0496113_1175747 | 3300048916 | Bacteria | 600 |
| 454 | Ga0496114_0001900 | 3300048917 | Bacteria | 15893 |
| 455 | Ga0496115_0020550 | 3300048918 | Bacteria | 5094 |
| 456 | Ga0496116_0042346 | 3300048919 | Bacteria | 3114 |
| 457 | Ga0496116_0086167 | 3300048919 | Bacteria | 1928 |
| 458 | Ga0496116_0163263 | 3300048919 | Bacteria | 1219 |
| 459 | Ga0496116_0194776 | 3300048919 | Bacteria | 1068 |
| 460 | Ga0496117_0000254 | 3300048920 | Bacteria | 101006 |
| 461 | Ga0496117_0009122 | 3300048920 | Bacteria | 9314 |
| 462 | Ga0496117_0011464 | 3300048920 | Bacteria | 7940 |
| 463 | Ga0496117_0026296 | 3300048920 | Bacteria | 4556 |
| 464 | Ga0496117_0099255 | 3300048920 | Bacteria | 1848 |
| 465 | Ga0496117_0131802 | 3300048920 | Bacteria | 1513 |
| 466 | Ga0496118_0000820 | 3300048921 | Bacteria | 49454 |
| 467 | Ga0496118_0001936 | 3300048921 | Bacteria | 29330 |
| 468 | Ga0496118_0009709 | 3300048921 | Bacteria | 9662 |
| 469 | Ga0496118_0012350 | 3300048921 | Bacteria | 8212 |
| 470 | Ga0496118_0050922 | 3300048921 | Bacteria | 3172 |
| 471 | Ga0496118_0145993 | 3300048921 | Bacteria | 1489 |
| 472 | Ga0496120_0301978 | 3300048923 | Bacteria | 733 |
| 473 | Ga0496121_0029862 | 3300048924 | Bacteria | 5023 |
| 474 | Ga0496121_0037376 | 3300048924 | Bacteria | 4313 |
| 475 | Ga0496121_0046685 | 3300048924 | Bacteria | 3704 |
| 476 | Ga0496122_0001780 | 3300048925 | Bacteria | 33010 |
| 477 | Ga0496122_0047929 | 3300048925 | Bacteria | 3292 |
| 478 | Ga0496122_0087988 | 3300048925 | Bacteria | 2131 |
| 479 | Ga0496123_0013477 | 3300048926 | Bacteria | 6857 |
| 480 | Ga0496123_0015265 | 3300048926 | Bacteria | 6310 |
| 481 | Ga0496124_0000275 | 3300048927 | Bacteria | 98848 |
| 482 | Ga0496124_0047927 | 3300048927 | Bacteria | 3653 |
| 483 | Ga0496125_0053082 | 3300048928 | Bacteria | 3327 |
| 484 | Ga0496125_0082303 | 3300048928 | Bacteria | 2454 |
| 485 | Ga0496126_0000698 | 3300048929 | Bacteria | 61406 |
| 486 | Ga0496126_0008500 | 3300048929 | Bacteria | 11061 |
| 487 | Ga0495678_051660 | 3300049459 | Bacteria | 1587 |
| 488 | Ga0495682_0029750 | 3300049460 | Bacteria | 2023 |
| 489 | Ga0495682_0032056 | 3300049460 | Bacteria | 1941 |
| 490 | Ga0501040_0268398 | 3300049576 | Bacteria | 1218 |
| 491 | Ga0501046_0444872 | 3300049580 | Bacteria | 932 |
| 492 | Ga0501070_0243506 | 3300049586 | Bacteria | 1472 |
| 493 | Ga0501079_0094039 | 3300049741 | Unclassified | 2323 |
| 494 | Ga0501081_0192203 | 3300049743 | Bacteria | 1478 |
| 495 | nmdc:mga05p37_886388_c1 | 3300050507 | Bacteria | 964 |
| 496 | nmdc:mga06r32_491243_c1 | 3300050510 | Bacteria | 1205 |
| 497 | nmdc:mga08y16_1957_c1 | 3300050511 | Bacteria | 20989 |
| 498 | nmdc:mga0sz30_56125_c1 | 3300050516 | Bacteria | 1677 |
| 499 | Ga0495655_0054634 | 3300053083 | Bacteria | 1069 |
| 500 | Ga0500608_112223 | 3300053122 | Bacteria | 1248 |
| 501 | Ga0500616_0000079 | 3300053153 | Bacteria | 200717 |
| 502 | Ga0501084_0133599 | 3300054114 | Bacteria | 2089 |
| 503 | Ga0501082_0393700 | 3300060353 | Bacteria | 1209 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046528 | Ga0495642_0470088 | Ga0495642_0470088_15_500 | 155 |
| 2 | 3300009093 | Ga0105240_11173217 | Ga0105240_111732172 | 168 |
| 3 | 3300014968 | Ga0157379_10545179 | Ga0157379_105451792 | 168 |
| 4 | iso_pu_bacteria | 2852646457 | 2852647715 | 169 |
| 5 | 3300047319 | Ga0495674_0331059 | Ga0495674_0331059_509_1063 | 173 |
| 6 | 3300025256 | Ga0209759_1013489 | Ga0209759_10134892 | 174 |
| 7 | 3300001989 | JGI24739J22299_10039797 | JGI24739J22299_100397972 | 176 |
| 8 | 3300003322 | rootL2_10376628 | rootL2_103766282 | 176 |
| 9 | 3300003758 | Ga0055532_1000975 | Ga0055532_10009755 | 176 |
| 10 | 3300003758 | Ga0055532_1001032 | Ga0055532_10010325 | 176 |
| 11 | 3300003758 | Ga0055532_1001063 | Ga0055532_10010634 | 176 |
| 12 | 3300003760 | Ga0055527_1000358 | Ga0055527_10003584 | 176 |
| 13 | 3300003760 | Ga0055527_1009494 | Ga0055527_10094941 | 176 |
| 14 | 3300003761 | Ga0055535_1000842 | Ga0055535_10008424 | 176 |
| 15 | 3300003761 | Ga0055535_1001338 | Ga0055535_100133810 | 176 |
| 16 | 3300003762 | Ga0055542_1001904 | Ga0055542_10019046 | 176 |
| 17 | 3300003763 | Ga0055529_1000639 | Ga0055529_100063918 | 176 |
| 18 | 3300003763 | Ga0055529_1005263 | Ga0055529_10052632 | 176 |
| 19 | 3300003790 | Ga0055528_1003340 | Ga0055528_10033401 | 176 |
| 20 | 3300003841 | Ga0055541_1009092 | Ga0055541_10090922 | 176 |
| 21 | 3300005329 | Ga0070683_100893914 | Ga0070683_1008939142 | 176 |
| 22 | 3300005339 | Ga0070660_100000171 | Ga0070660_10000017112 | 176 |
| 23 | 3300005366 | Ga0070659_100000028 | Ga0070659_100000028108 | 176 |
| 24 | 3300005455 | Ga0070663_100002373 | Ga0070663_1000023732 | 176 |
| 25 | 3300005535 | Ga0070684_100256805 | Ga0070684_1002568052 | 176 |
| 26 | 3300005563 | Ga0068855_100010177 | Ga0068855_10001017712 | 176 |
| 27 | 3300005614 | Ga0068856_100670166 | Ga0068856_1006701662 | 176 |
| 28 | 3300009092 | Ga0105250_10057252 | Ga0105250_100572522 | 176 |
| 29 | 3300009093 | Ga0105240_10005221 | Ga0105240_1000522118 | 176 |
| 30 | 3300009093 | Ga0105240_10047555 | Ga0105240_100475554 | 176 |
| 31 | 3300009545 | Ga0105237_10050021 | Ga0105237_100500213 | 176 |
| 32 | 3300009551 | Ga0105238_10096060 | Ga0105238_100960603 | 176 |
| 33 | 3300010375 | Ga0105239_10023248 | Ga0105239_100232484 | 176 |
| 34 | 3300013100 | Ga0157373_10121499 | Ga0157373_101214992 | 176 |
| 35 | 3300013104 | Ga0157370_11233314 | Ga0157370_112333141 | 176 |
| 36 | 3300013105 | Ga0157369_10118990 | Ga0157369_101189903 | 176 |
| 37 | 3300013105 | Ga0157369_10220712 | Ga0157369_102207122 | 176 |
| 38 | 3300014497 | Ga0182008_10120200 | Ga0182008_101202002 | 176 |
| 39 | 3300015261 | Ga0182006_1064466 | Ga0182006_10644662 | 176 |
| 40 | 3300015262 | Ga0182007_10004747 | Ga0182007_100047475 | 176 |
| 41 | 3300020082 | Ga0206353_12056884 | Ga0206353_120568841 | 176 |
| 42 | 3300025225 | Ga0209566_101490 | Ga0209566_1014902 | 176 |
| 43 | 3300025226 | Ga0209674_101245 | Ga0209674_1012455 | 176 |
| 44 | 3300025228 | Ga0209672_100042 | Ga0209672_10004217 | 176 |
| 45 | 3300025228 | Ga0209672_100131 | Ga0209672_10013156 | 176 |
| 46 | 3300025229 | Ga0209147_100012 | Ga0209147_100012348 | 176 |
| 47 | 3300025229 | Ga0209147_100052 | Ga0209147_10005217 | 176 |
| 48 | 3300025229 | Ga0209147_100291 | Ga0209147_10029131 | 176 |
| 49 | 3300025242 | Ga0209258_100030 | Ga0209258_100030345 | 176 |
| 50 | 3300025242 | Ga0209258_100073 | Ga0209258_10007317 | 176 |
| 51 | 3300025254 | Ga0209148_1000022 | Ga0209148_1000022279 | 176 |
| 52 | 3300025254 | Ga0209148_1000524 | Ga0209148_100052432 | 176 |
| 53 | 3300025263 | Ga0209565_1015513 | Ga0209565_10155131 | 176 |
| 54 | 3300025272 | Ga0209455_1000024 | Ga0209455_1000024344 | 176 |
| 55 | 3300025272 | Ga0209455_1001569 | Ga0209455_10015696 | 176 |
| 56 | 3300025273 | Ga0209673_1000021 | Ga0209673_1000021232 | 176 |
| 57 | 3300025295 | Ga0209564_1011401 | Ga0209564_10114015 | 176 |
| 58 | 3300025904 | Ga0207647_10004058 | Ga0207647_1000405810 | 176 |
| 59 | 3300025909 | Ga0207705_10013047 | Ga0207705_100130472 | 176 |
| 60 | 3300025913 | Ga0207695_10003099 | Ga0207695_100030997 | 176 |
| 61 | 3300025913 | Ga0207695_10093286 | Ga0207695_100932863 | 176 |
| 62 | 3300025914 | Ga0207671_10024389 | Ga0207671_100243892 | 176 |
| 63 | 3300025919 | Ga0207657_10000111 | Ga0207657_1000011112 | 176 |
| 64 | 3300025932 | Ga0207690_10000009 | Ga0207690_10000009259 | 176 |
| 65 | 3300025949 | Ga0207667_10003058 | Ga0207667_1000305818 | 176 |
| 66 | 3300025949 | Ga0207667_10386611 | Ga0207667_103866112 | 176 |
| 67 | 3300026067 | Ga0207678_10003675 | Ga0207678_100036752 | 176 |
| 68 | 3300026078 | Ga0207702_10312262 | Ga0207702_103122622 | 176 |
| 69 | 3300027312 | Ga0209371_1000128 | Ga0209371_1000128104 | 176 |
| 70 | 3300030500 | Ga0268256_1000513 | Ga0268256_100051310 | 176 |
| 71 | 3300037466 | Ga0395898_0226552 | Ga0395898_0226552_486_1040 | 176 |
| 72 | 3300044693 | Ga0466961_0060953 | Ga0466961_0060953_508_1062 | 176 |
| 73 | 3300044842 | Ga0466957_0059313 | Ga0466957_0059313_1046_1600 | 176 |
| 74 | 3300044901 | Ga0466960_0055329 | Ga0466960_0055329_336_890 | 176 |
| 75 | 3300046455 | Ga0495603_0000545 | Ga0495603_0000545_20159_20689 | 176 |
| 76 | 3300046459 | Ga0495629_0000061 | Ga0495629_0000061_37931_38461 | 176 |
| 77 | 3300046462 | Ga0495651_0411841 | Ga0495651_0411841_45_575 | 176 |
| 78 | 3300046463 | Ga0495653_0147947 | Ga0495653_0147947_839_1369 | 176 |
| 79 | 3300046471 | Ga0495650_0000374 | Ga0495650_0000374_15709_16239 | 176 |
| 80 | 3300046472 | Ga0495580_0031518 | Ga0495580_0031518_2520_3050 | 176 |
| 81 | 3300046473 | Ga0495582_0107166 | Ga0495582_0107166_315_845 | 176 |
| 82 | 3300046500 | Ga0495596_0048130 | Ga0495596_0048130_118_648 | 176 |
| 83 | 3300046506 | Ga0495583_0044188 | Ga0495583_0044188_423_953 | 176 |
| 84 | 3300046507 | Ga0495606_0097341 | Ga0495606_0097341_504_1034 | 176 |
| 85 | 3300046518 | Ga0495631_0147959 | Ga0495631_0147959_277_807 | 176 |
| 86 | 3300046528 | Ga0495642_0006871 | Ga0495642_0006871_985_1515 | 176 |
| 87 | 3300046529 | Ga0495652_0430747 | Ga0495652_0430747_164_694 | 176 |
| 88 | 3300046530 | Ga0495654_0031625 | Ga0495654_0031625_1930_2460 | 176 |
| 89 | 3300046531 | Ga0495665_0137427 | Ga0495665_0137427_704_1234 | 176 |
| 90 | 3300046543 | Ga0495645_0002363 | Ga0495645_0002363_1036_1566 | 176 |
| 91 | 3300046642 | Ga0495634_0381902 | Ga0495634_0381902_266_796 | 176 |
| 92 | 3300046680 | Ga0495646_0089864 | Ga0495646_0089864_196_726 | 176 |
| 93 | 3300046684 | Ga0495669_0012531 | Ga0495669_0012531_2072_2602 | 176 |
| 94 | 3300046689 | Ga0495613_0087978 | Ga0495613_0087978_214_744 | 176 |
| 95 | 3300046691 | Ga0495670_0114065 | Ga0495670_0114065_345_875 | 176 |
| 96 | 3300046692 | Ga0495671_0080129 | Ga0495671_0080129_672_1202 | 176 |
| 97 | 3300046794 | Ga0495589_0253649 | Ga0495589_0253649_274_804 | 176 |
| 98 | 3300047443 | Ga0495687_011743 | Ga0495687_011743_1372_1902 | 176 |
| 99 | 3300047444 | Ga0495675_0352537 | Ga0495675_0352537_170_700 | 176 |
| 100 | 3300047470 | Ga0495681_0063494 | Ga0495681_0063494_108_638 | 176 |
| 101 | 3300047673 | Ga0495593_0037926 | Ga0495593_0037926_703_1233 | 176 |
| 102 | 3300048089 | Ga0495614_0024782 | Ga0495614_0024782_989_1519 | 176 |
| 103 | 3300048903 | Ga0496100_0227636 | Ga0496100_0227636_71_601 | 176 |
| 104 | 3300048904 | Ga0496101_0102345 | Ga0496101_0102345_46_576 | 176 |
| 105 | 3300048907 | Ga0496104_0123594 | Ga0496104_0123594_31_588 | 176 |
| 106 | 3300048907 | Ga0496104_0364958 | Ga0496104_0364958_248_778 | 176 |
| 107 | 3300048913 | Ga0496110_1180823 | Ga0496110_1180823_109_639 | 176 |
| 108 | 3300048915 | Ga0496112_0644483 | Ga0496112_0644483_156_713 | 176 |
| 109 | 3300048917 | Ga0496114_0001900 | Ga0496114_0001900_11991_12521 | 176 |
| 110 | 3300048918 | Ga0496115_0020550 | Ga0496115_0020550_4303_4833 | 176 |
| 111 | 3300048919 | Ga0496116_0194776 | Ga0496116_0194776_349_903 | 176 |
| 112 | 3300048920 | Ga0496117_0131802 | Ga0496117_0131802_646_1203 | 176 |
| 113 | 3300048921 | Ga0496118_0050922 | Ga0496118_0050922_2018_2575 | 176 |
| 114 | 3300048921 | Ga0496118_0145993 | Ga0496118_0145993_19_573 | 176 |
| 115 | 3300048923 | Ga0496120_0301978 | Ga0496120_0301978_83_637 | 176 |
| 116 | 3300048924 | Ga0496121_0046685 | Ga0496121_0046685_2691_3248 | 176 |
| 117 | 3300048925 | Ga0496122_0047929 | Ga0496122_0047929_1997_2554 | 176 |
| 118 | 3300048928 | Ga0496125_0053082 | Ga0496125_0053082_2453_3010 | 176 |
| 119 | 3300003187 | JGI25151J46595_10031075 | JGI25151J46595_100310752 | 177 |
| 120 | 3300003751 | Ga0055538_1000252 | Ga0055538_100025218 | 177 |
| 121 | 3300005364 | Ga0070673_100602921 | Ga0070673_1006029212 | 177 |
| 122 | 3300005457 | Ga0070662_100774620 | Ga0070662_1007746202 | 177 |
| 123 | 3300005459 | Ga0068867_101218919 | Ga0068867_1012189191 | 177 |
| 124 | 3300005543 | Ga0070672_100022714 | Ga0070672_1000227142 | 177 |
| 125 | 3300005719 | Ga0068861_100341394 | Ga0068861_1003413943 | 177 |
| 126 | 3300005841 | Ga0068863_100407409 | Ga0068863_1004074093 | 177 |
| 127 | 3300006844 | Ga0075428_100007145 | Ga0075428_1000071457 | 177 |
| 128 | 3300009094 | Ga0111539_10012350 | Ga0111539_100123503 | 177 |
| 129 | 3300009174 | Ga0105241_10053429 | Ga0105241_100534294 | 177 |
| 130 | 3300009176 | Ga0105242_10243110 | Ga0105242_102431102 | 177 |
| 131 | 3300013297 | Ga0157378_10088327 | Ga0157378_100883275 | 177 |
| 132 | 3300013306 | Ga0163162_10029660 | Ga0163162_100296607 | 177 |
| 133 | 3300014326 | Ga0157380_10150876 | Ga0157380_101508762 | 177 |
| 134 | 3300017792 | Ga0163161_10090260 | Ga0163161_100902604 | 177 |
| 135 | 3300025224 | Ga0209784_100121 | Ga0209784_10012138 | 177 |
| 136 | 3300025294 | Ga0209025_1001634 | Ga0209025_100163414 | 177 |
| 137 | 3300025923 | Ga0207681_10119281 | Ga0207681_101192812 | 177 |
| 138 | 3300025933 | Ga0207706_10016553 | Ga0207706_100165532 | 177 |
| 139 | 3300025934 | Ga0207686_10233007 | Ga0207686_102330072 | 177 |
| 140 | 3300025940 | Ga0207691_10067223 | Ga0207691_100672233 | 177 |
| 141 | 3300025972 | Ga0207668_10359085 | Ga0207668_103590852 | 177 |
| 142 | 3300025981 | Ga0207640_10482295 | Ga0207640_104822952 | 177 |
| 143 | 3300026088 | Ga0207641_10122291 | Ga0207641_101222912 | 177 |
| 144 | 3300026118 | Ga0207675_100924449 | Ga0207675_1009244491 | 177 |
| 145 | 3300026118 | Ga0207675_101120261 | Ga0207675_1011202612 | 177 |
| 146 | 3300027907 | Ga0207428_10015492 | Ga0207428_100154927 | 177 |
| 147 | 3300046463 | Ga0495653_0550268 | Ga0495653_0550268_152_688 | 177 |
| 148 | 3300046499 | Ga0495594_0156654 | Ga0495594_0156654_45_599 | 177 |
| 149 | 3300048909 | Ga0496106_0491580 | Ga0496106_0491580_115_669 | 177 |
| 150 | 3300050511 | nmdc:mga08y16_1957_c1 | nmdc:mga08y16_1957_c1_2630_3184 | 177 |
| 151 | 3300005546 | Ga0070696_100158644 | Ga0070696_1001586442 | 178 |
| 152 | 3300030745 | Ga0316182_1073515 | Ga0316182_10735151 | 178 |
| 153 | 3300031995 | Ga0307409_100263650 | Ga0307409_1002636503 | 178 |
| 154 | 3300032126 | Ga0307415_100107326 | Ga0307415_1001073262 | 178 |
| 155 | iso_pu_bacteria | 2856287931 | 2856288215 | 178 |
| 156 | iso_pu_bacteria | 2857357740 | 2857360280 | 178 |
| 157 | iso_pu_bacteria | 2883087390 | 2883090696 | 178 |
| 158 | iso_pu_bacteria | 2919186247 | 2919186802 | 178 |
| 159 | iso_pu_bacteria | 2939664404 | 2939665929 | 178 |
| 160 | 3300005331 | Ga0070670_100869891 | Ga0070670_1008698911 | 179 |
| 161 | 3300009174 | Ga0105241_10557287 | Ga0105241_105572872 | 179 |
| 162 | 3300009545 | Ga0105237_10031570 | Ga0105237_100315705 | 179 |
| 163 | 3300025914 | Ga0207671_10205540 | Ga0207671_102055402 | 179 |
| 164 | 3300048920 | Ga0496117_0000254 | Ga0496117_0000254_7279_7857 | 179 |
| 165 | 3300048925 | Ga0496122_0001780 | Ga0496122_0001780_2077_2643 | 179 |
| 166 | 3300048926 | Ga0496123_0013477 | Ga0496123_0013477_3379_3945 | 179 |
| 167 | iso_pu_bacteria | 2501025501 | 2501073122 | 179 |
| 168 | iso_pu_bacteria | 2501025502 | 2501084820 | 179 |
| 169 | iso_pu_bacteria | 2501025504 | 2501412894 | 179 |
| 170 | iso_pu_bacteria | 2510917013 | 2511088769 | 179 |
| 171 | iso_pu_bacteria | 2510917014 | 2511100610 | 179 |
| 172 | iso_pu_bacteria | 2510917015 | 2511107682 | 179 |
| 173 | iso_pu_bacteria | 2513237082 | 2513557159 | 179 |
| 174 | iso_pu_bacteria | 2513237083 | 2513564806 | 179 |
| 175 | iso_pu_bacteria | 2515154189 | 2516021147 | 179 |
| 176 | iso_pu_bacteria | 8003955200 | 8003961329 | 179 |
| 177 | iso_pu_bacteria | 8039098773 | 8039103821 | 179 |
| 178 | iso_pu_bacteria | 8057345674 | 8057349630 | 179 |
| 179 | 3300005347 | Ga0070668_100168507 | Ga0070668_1001685072 | 180 |
| 180 | 3300006186 | Ga0075369_10037307 | Ga0075369_100373072 | 180 |
| 181 | 3300006847 | Ga0075431_100383496 | Ga0075431_1003834962 | 180 |
| 182 | 3300025972 | Ga0207668_10070719 | Ga0207668_100707192 | 180 |
| 183 | 3300046506 | Ga0495583_0231009 | Ga0495583_0231009_176_730 | 180 |
| 184 | 3300046512 | Ga0495610_0023589 | Ga0495610_0023589_1449_2000 | 180 |
| 185 | 3300046522 | Ga0495643_0053921 | Ga0495643_0053921_802_1356 | 180 |
| 186 | 3300047320 | Ga0495672_0407332 | Ga0495672_0407332_33_605 | 180 |
| 187 | 3300048919 | Ga0496116_0042346 | Ga0496116_0042346_1615_2181 | 180 |
| 188 | 3300048920 | Ga0496117_0026296 | Ga0496117_0026296_1414_1992 | 180 |
| 189 | 3300048924 | Ga0496121_0037376 | Ga0496121_0037376_2319_2873 | 180 |
| 190 | 3300048925 | Ga0496122_0087988 | Ga0496122_0087988_474_1052 | 180 |
| 191 | 3300048926 | Ga0496123_0015265 | Ga0496123_0015265_5156_5734 | 180 |
| 192 | 3300048927 | Ga0496124_0047927 | Ga0496124_0047927_1596_2174 | 180 |
| 193 | 3300048928 | Ga0496125_0082303 | Ga0496125_0082303_1631_2209 | 180 |
| 194 | 3300050510 | nmdc:mga06r32_491243_c1 | nmdc:mga06r32_491243_c1_507_1058 | 180 |
| 195 | 3300050516 | nmdc:mga0sz30_56125_c1 | nmdc:mga0sz30_56125_c1_518_1096 | 180 |
| 196 | 3300053122 | Ga0500608_112223 | Ga0500608_112223_408_962 | 180 |
| 197 | 3300053153 | Ga0500616_0000079 | Ga0500616_0000079_1988_2560 | 180 |
| 198 | iso_pu_bacteria | 2508501125 | 2509130662 | 180 |
| 199 | iso_pu_bacteria | 2510917030 | 2511199347 | 180 |
| 200 | iso_pu_bacteria | 2513237151 | 2513961780 | 180 |
| 201 | iso_pu_bacteria | 2526164713 | 2527078377 | 180 |
| 202 | iso_pu_bacteria | 2582581298 | 2585225320 | 180 |
| 203 | iso_pu_bacteria | 2585427529 | 2585547876 | 180 |
| 204 | iso_pu_bacteria | 2599185239 | 2599734545 | 180 |
| 205 | iso_pu_bacteria | 2599185240 | 2599747915 | 180 |
| 206 | iso_pu_bacteria | 2599185355 | 2600209934 | 180 |
| 207 | iso_pu_bacteria | 2675903129 | 2676741362 | 180 |
| 208 | iso_pu_bacteria | 2718217991 | 2719644175 | 180 |
| 209 | iso_pu_bacteria | 2738541296 | 2738823537 | 180 |
| 210 | iso_pu_bacteria | 2738541298 | 2738835928 | 180 |
| 211 | iso_pu_bacteria | 2738541306 | 2738877465 | 180 |
| 212 | iso_pu_bacteria | 2738543002 | 2739189171 | 180 |
| 213 | iso_pu_bacteria | 2738543008 | 2739224058 | 180 |
| 214 | iso_pu_bacteria | 2744054900 | 2746091544 | 180 |
| 215 | iso_pu_bacteria | 2744054901 | 2746099301 | 180 |
| 216 | iso_pu_bacteria | 2751185846 | 2753571126 | 180 |
| 217 | iso_pu_bacteria | 2818991450 | 2819624372 | 180 |
| 218 | iso_pu_bacteria | 2818991452 | 2819634349 | 180 |
| 219 | iso_pu_bacteria | 2842324504 | 2842330372 | 180 |
| 220 | iso_pu_bacteria | 2842348783 | 2842355011 | 180 |
| 221 | iso_pu_bacteria | 2842454564 | 2842460429 | 180 |
| 222 | iso_pu_bacteria | 2863421361 | 2863426831 | 180 |
| 223 | iso_pu_bacteria | 2870068957 | 2870075164 | 180 |
| 224 | iso_pu_bacteria | 2885270888 | 2885274855 | 180 |
| 225 | iso_pu_bacteria | 2900634093 | 2900641297 | 180 |
| 226 | iso_pu_bacteria | 2904483920 | 2904489766 | 180 |
| 227 | iso_pu_bacteria | 2904564687 | 2904570517 | 180 |
| 228 | iso_pu_bacteria | 2904571731 | 2904577694 | 180 |
| 229 | iso_pu_bacteria | 2919100787 | 2919106138 | 180 |
| 230 | iso_pu_bacteria | 2928108538 | 2928111690 | 180 |
| 231 | iso_pu_bacteria | 2928135762 | 2928138930 | 180 |
| 232 | iso_pu_bacteria | 2928157003 | 2928158958 | 180 |
| 233 | iso_pu_bacteria | 2928163908 | 2928167779 | 180 |
| 234 | iso_pu_bacteria | 2928170801 | 2928177425 | 180 |
| 235 | iso_pu_bacteria | 2928503688 | 2928509355 | 180 |
| 236 | iso_pu_bacteria | 2928536128 | 2928541894 | 180 |
| 237 | iso_pu_bacteria | 2945934425 | 2945939853 | 180 |
| 238 | iso_pu_bacteria | 2981990288 | 2981992339 | 180 |
| 239 | iso_pu_bacteria | 2990703756 | 2990706974 | 180 |
| 240 | iso_pu_bacteria | 641736151 | 642426647 | 180 |
| 241 | iso_pu_bacteria | 641736154 | 642420636 | 180 |
| 242 | iso_pu_bacteria | 642555113 | 642615962 | 180 |
| 243 | iso_pu_bacteria | 8018845410 | 8018846706 | 180 |
| 244 | iso_pu_bacteria | 8020938398 | 8020941731 | 180 |
| 245 | iso_pu_bacteria | 8020945358 | 8020949083 | 180 |
| 246 | iso_pu_bacteria | 8020953355 | 8020958794 | 180 |
| 247 | iso_pu_bacteria | 8021120328 | 8021121580 | 180 |
| 248 | iso_pu_bacteria | 8055266321 | 8055270414 | 180 |
| 249 | iso_pu_bacteria | 8055301274 | 8055306455 | 180 |
| 250 | 3300004800 | Ga0058861_11200430 | Ga0058861_112004302 | 181 |
| 251 | 3300004803 | Ga0058862_12827803 | Ga0058862_128278033 | 181 |
| 252 | 3300005336 | Ga0070680_100081489 | Ga0070680_1000814893 | 181 |
| 253 | 3300005458 | Ga0070681_10101400 | Ga0070681_101014002 | 181 |
| 254 | 3300006177 | Ga0075362_10017922 | Ga0075362_100179222 | 181 |
| 255 | 3300009036 | Ga0105244_10000269 | Ga0105244_1000026913 | 181 |
| 256 | 3300009147 | Ga0114129_10152815 | Ga0114129_101528152 | 181 |
| 257 | 3300009176 | Ga0105242_11339692 | Ga0105242_113396921 | 181 |
| 258 | 3300020069 | Ga0197907_11185765 | Ga0197907_111857652 | 181 |
| 259 | 3300020070 | Ga0206356_11130835 | Ga0206356_111308351 | 181 |
| 260 | 3300020077 | Ga0206351_10791431 | Ga0206351_107914311 | 181 |
| 261 | 3300025728 | Ga0207655_1001542 | Ga0207655_10015426 | 181 |
| 262 | 3300025912 | Ga0207707_10103667 | Ga0207707_101036672 | 181 |
| 263 | 3300025912 | Ga0207707_10140846 | Ga0207707_101408462 | 181 |
| 264 | 3300025921 | Ga0207652_10021727 | Ga0207652_100217274 | 181 |
| 265 | 3300030744 | Ga0316181_1244883 | Ga0316181_12448831 | 181 |
| 266 | 3300031247 | Ga0265340_10077825 | Ga0265340_100778252 | 181 |
| 267 | 3300031344 | Ga0265316_10184774 | Ga0265316_101847742 | 181 |
| 268 | 3300031711 | Ga0265314_10217150 | Ga0265314_102171502 | 181 |
| 269 | 3300035111 | Ga0373923_0141176 | Ga0373923_0141176_447_1025 | 181 |
| 270 | 3300035116 | Ga0373945_0121277 | Ga0373945_0121277_444_1022 | 181 |
| 271 | 3300035172 | Ga0373955_0233798 | Ga0373955_0233798_95_673 | 181 |
| 272 | 3300035724 | Ga0373933_0502841 | Ga0373933_0502841_89_667 | 181 |
| 273 | 3300037853 | Ga0436364_1544520 | Ga0436364_1544520_154_732 | 181 |
| 274 | 3300046472 | Ga0495580_0511378 | Ga0495580_0511378_148_726 | 181 |
| 275 | 3300049576 | Ga0501040_0268398 | Ga0501040_0268398_522_1097 | 181 |
| 276 | 3300049580 | Ga0501046_0444872 | Ga0501046_0444872_147_734 | 181 |
| 277 | 3300049586 | Ga0501070_0243506 | Ga0501070_0243506_787_1359 | 181 |
| 278 | 3300049741 | Ga0501079_0094039 | Ga0501079_0094039_1293_1874 | 181 |
| 279 | 3300049743 | Ga0501081_0192203 | Ga0501081_0192203_854_1441 | 181 |
| 280 | 3300050507 | nmdc:mga05p37_886388_c1 | nmdc:mga05p37_886388_c1_162_734 | 181 |
| 281 | 3300054114 | Ga0501084_0133599 | Ga0501084_0133599_537_1124 | 181 |
| 282 | 3300060353 | Ga0501082_0393700 | Ga0501082_0393700_24_611 | 181 |
| 283 | 3300003856 | Ga0058692_1000139 | Ga0058692_100013941 | 182 |
| 284 | 3300005436 | Ga0070713_100972148 | Ga0070713_1009721481 | 182 |
| 285 | 3300005445 | Ga0070708_100671185 | Ga0070708_1006711851 | 182 |
| 286 | 3300005985 | Ga0081539_10020762 | Ga0081539_100207623 | 182 |
| 287 | 3300025941 | Ga0207711_10136814 | Ga0207711_101368142 | 182 |
| 288 | 3300027312 | Ga0209371_1000421 | Ga0209371_100042113 | 182 |
| 289 | 3300030500 | Ga0268256_1000360 | Ga0268256_100036040 | 182 |
| 290 | 3300031824 | Ga0307413_10159869 | Ga0307413_101598692 | 182 |
| 291 | 3300031852 | Ga0307410_10118072 | Ga0307410_101180724 | 182 |
| 292 | 3300031852 | Ga0307410_10457216 | Ga0307410_104572161 | 182 |
| 293 | 3300031901 | Ga0307406_10330059 | Ga0307406_103300593 | 182 |
| 294 | 3300031995 | Ga0307409_100256483 | Ga0307409_1002564833 | 182 |
| 295 | 3300032002 | Ga0307416_100347452 | Ga0307416_1003474522 | 182 |
| 296 | 3300032004 | Ga0307414_10093666 | Ga0307414_100936662 | 182 |
| 297 | 3300032004 | Ga0307414_10148292 | Ga0307414_101482922 | 182 |
| 298 | 3300032005 | Ga0307411_10354943 | Ga0307411_103549432 | 182 |
| 299 | 3300039447 | Ga0436361_0941473 | Ga0436361_0941473_125_679 | 182 |
| 300 | 3300048927 | Ga0496124_0000275 | Ga0496124_0000275_45065_45613 | 182 |
| 301 | 3300003322 | rootL2_10373663 | rootL2_103736632 | 183 |
| 302 | 3300005338 | Ga0068868_100422123 | Ga0068868_1004221231 | 183 |
| 303 | 3300005365 | Ga0070688_100902541 | Ga0070688_1009025411 | 183 |
| 304 | 3300005471 | Ga0070698_100637095 | Ga0070698_1006370952 | 183 |
| 305 | 3300005617 | Ga0068859_101904371 | Ga0068859_1019043711 | 183 |
| 306 | 3300005618 | Ga0068864_100732940 | Ga0068864_1007329401 | 183 |
| 307 | 3300005842 | Ga0068858_100434861 | Ga0068858_1004348612 | 183 |
| 308 | 3300006931 | Ga0097620_101904392 | Ga0097620_1019043921 | 183 |
| 309 | 3300009094 | Ga0111539_11453764 | Ga0111539_114537641 | 183 |
| 310 | 3300011119 | Ga0105246_10294864 | Ga0105246_102948641 | 183 |
| 311 | 3300013308 | Ga0157375_10204524 | Ga0157375_102045243 | 183 |
| 312 | 3300013308 | Ga0157375_11650080 | Ga0157375_116500801 | 183 |
| 313 | 3300025936 | Ga0207670_10306178 | Ga0207670_103061781 | 183 |
| 314 | 3300025942 | Ga0207689_10351290 | Ga0207689_103512902 | 183 |
| 315 | 3300026023 | Ga0207677_10340599 | Ga0207677_103405991 | 183 |
| 316 | 3300026095 | Ga0207676_10479600 | Ga0207676_104796002 | 183 |
| 317 | 3300026121 | Ga0207683_10349941 | Ga0207683_103499412 | 183 |
| 318 | 3300028380 | Ga0268265_11218629 | Ga0268265_112186292 | 183 |
| 319 | 3300035695 | Ga0373927_0653413 | Ga0373927_0653413_19_630 | 183 |
| 320 | 3300001979 | JGI24740J21852_10006615 | JGI24740J21852_100066152 | 184 |
| 321 | 3300001989 | JGI24739J22299_10007134 | JGI24739J22299_100071346 | 184 |
| 322 | 3300001989 | JGI24739J22299_10007865 | JGI24739J22299_100078652 | 184 |
| 323 | 3300002067 | JGI24735J21928_10009051 | JGI24735J21928_100090512 | 184 |
| 324 | 3300002067 | JGI24735J21928_10116847 | JGI24735J21928_101168472 | 184 |
| 325 | 3300002067 | JGI24735J21928_10133722 | JGI24735J21928_101337221 | 184 |
| 326 | 3300002075 | JGI24738J21930_10000325 | JGI24738J21930_1000032510 | 184 |
| 327 | 3300002705 | JGI25156J39149_1000268 | JGI25156J39149_10002684 | 184 |
| 328 | 3300002705 | JGI25156J39149_1000806 | JGI25156J39149_100080614 | 184 |
| 329 | 3300002705 | JGI25156J39149_1007208 | JGI25156J39149_10072083 | 184 |
| 330 | 3300003214 | JGI25165J46597_1000701 | JGI25165J46597_10007011 | 184 |
| 331 | 3300003756 | Ga0055533_1000091 | Ga0055533_100009173 | 184 |
| 332 | 3300003756 | Ga0055533_1007581 | Ga0055533_10075812 | 184 |
| 333 | 3300003758 | Ga0055532_1000045 | Ga0055532_100004574 | 184 |
| 334 | 3300003760 | Ga0055527_1000027 | Ga0055527_100002774 | 184 |
| 335 | 3300003761 | Ga0055535_1000033 | Ga0055535_100003374 | 184 |
| 336 | 3300003762 | Ga0055542_1000050 | Ga0055542_100005074 | 184 |
| 337 | 3300003763 | Ga0055529_1000061 | Ga0055529_100006174 | 184 |
| 338 | 3300005367 | Ga0070667_100215128 | Ga0070667_1002151282 | 184 |
| 339 | 3300005455 | Ga0070663_100505050 | Ga0070663_1005050502 | 184 |
| 340 | 3300006195 | Ga0075366_10411904 | Ga0075366_104119042 | 184 |
| 341 | 3300006852 | Ga0075433_10327920 | Ga0075433_103279202 | 184 |
| 342 | 3300009011 | Ga0105251_10000683 | Ga0105251_1000068322 | 184 |
| 343 | 3300009551 | Ga0105238_10252350 | Ga0105238_102523502 | 184 |
| 344 | 3300013105 | Ga0157369_10052820 | Ga0157369_100528202 | 184 |
| 345 | 3300014497 | Ga0182008_10017502 | Ga0182008_100175025 | 184 |
| 346 | 3300015262 | Ga0182007_10001199 | Ga0182007_1000119910 | 184 |
| 347 | 3300025226 | Ga0209674_100074 | Ga0209674_10007474 | 184 |
| 348 | 3300025226 | Ga0209674_100102 | Ga0209674_10010269 | 184 |
| 349 | 3300025228 | Ga0209672_100053 | Ga0209672_10005374 | 184 |
| 350 | 3300025229 | Ga0209147_100070 | Ga0209147_10007074 | 184 |
| 351 | 3300025230 | Ga0209563_100691 | Ga0209563_1006918 | 184 |
| 352 | 3300025231 | Ga0207427_103762 | Ga0207427_1037624 | 184 |
| 353 | 3300025242 | Ga0209258_100094 | Ga0209258_10009474 | 184 |
| 354 | 3300025254 | Ga0209148_1000100 | Ga0209148_100010074 | 184 |
| 355 | 3300025256 | Ga0209759_1000009 | Ga0209759_100000974 | 184 |
| 356 | 3300025256 | Ga0209759_1000036 | Ga0209759_100003649 | 184 |
| 357 | 3300025256 | Ga0209759_1000143 | Ga0209759_100014384 | 184 |
| 358 | 3300025261 | Ga0209233_1000144 | Ga0209233_100014473 | 184 |
| 359 | 3300025272 | Ga0209455_1000090 | Ga0209455_100009074 | 184 |
| 360 | 3300025735 | Ga0207713_1003522 | Ga0207713_10035226 | 184 |
| 361 | 3300025904 | Ga0207647_10016712 | Ga0207647_100167125 | 184 |
| 362 | 3300025904 | Ga0207647_10017989 | Ga0207647_100179893 | 184 |
| 363 | 3300025904 | Ga0207647_10165267 | Ga0207647_101652671 | 184 |
| 364 | 3300025913 | Ga0207695_10934132 | Ga0207695_109341321 | 184 |
| 365 | 3300025924 | Ga0207694_10368710 | Ga0207694_103687102 | 184 |
| 366 | 3300026067 | Ga0207678_10241666 | Ga0207678_102416662 | 184 |
| 367 | 3300026142 | Ga0207698_11015512 | Ga0207698_110155122 | 184 |
| 368 | 3300028800 | Ga0265338_10000058 | Ga0265338_10000058157 | 184 |
| 369 | 3300031247 | Ga0265340_10148371 | Ga0265340_101483711 | 184 |
| 370 | 3300031911 | Ga0307412_10000041 | Ga0307412_1000004195 | 184 |
| 371 | 3300031911 | Ga0307412_10316209 | Ga0307412_103162092 | 184 |
| 372 | 3300046454 | Ga0495592_0029413 | Ga0495592_0029413_422_976 | 184 |
| 373 | 3300046454 | Ga0495592_0074085 | Ga0495592_0074085_397_951 | 184 |
| 374 | 3300046454 | Ga0495592_0134578 | Ga0495592_0134578_466_1020 | 184 |
| 375 | 3300046454 | Ga0495592_0197333 | Ga0495592_0197333_145_699 | 184 |
| 376 | 3300046455 | Ga0495603_0010952 | Ga0495603_0010952_1765_2319 | 184 |
| 377 | 3300046455 | Ga0495603_0072607 | Ga0495603_0072607_1291_1845 | 184 |
| 378 | 3300046455 | Ga0495603_0123992 | Ga0495603_0123992_143_697 | 184 |
| 379 | 3300046455 | Ga0495603_0227178 | Ga0495603_0227178_430_984 | 184 |
| 380 | 3300046457 | Ga0495590_0015044 | Ga0495590_0015044_2133_2687 | 184 |
| 381 | 3300046457 | Ga0495590_0016739 | Ga0495590_0016739_1055_1609 | 184 |
| 382 | 3300046458 | Ga0495591_001885 | Ga0495591_001885_8455_9009 | 184 |
| 383 | 3300046459 | Ga0495629_0000090 | Ga0495629_0000090_19558_20112 | 184 |
| 384 | 3300046459 | Ga0495629_0002691 | Ga0495629_0002691_6421_6975 | 184 |
| 385 | 3300046459 | Ga0495629_0005335 | Ga0495629_0005335_404_958 | 184 |
| 386 | 3300046459 | Ga0495629_0015491 | Ga0495629_0015491_676_1230 | 184 |
| 387 | 3300046460 | Ga0495638_0011722 | Ga0495638_0011722_576_1130 | 184 |
| 388 | 3300046461 | Ga0495641_0109046 | Ga0495641_0109046_535_1089 | 184 |
| 389 | 3300046462 | Ga0495651_0032029 | Ga0495651_0032029_1050_1613 | 184 |
| 390 | 3300046462 | Ga0495651_0127898 | Ga0495651_0127898_969_1523 | 184 |
| 391 | 3300046462 | Ga0495651_0285777 | Ga0495651_0285777_312_866 | 184 |
| 392 | 3300046463 | Ga0495653_0000137 | Ga0495653_0000137_29170_29724 | 184 |
| 393 | 3300046463 | Ga0495653_0042603 | Ga0495653_0042603_2430_2984 | 184 |
| 394 | 3300046463 | Ga0495653_0049030 | Ga0495653_0049030_2017_2571 | 184 |
| 395 | 3300046463 | Ga0495653_0055825 | Ga0495653_0055825_613_1167 | 184 |
| 396 | 3300046463 | Ga0495653_0074242 | Ga0495653_0074242_227_781 | 184 |
| 397 | 3300046471 | Ga0495650_0005494 | Ga0495650_0005494_5338_5892 | 184 |
| 398 | 3300046471 | Ga0495650_0011621 | Ga0495650_0011621_3523_4077 | 184 |
| 399 | 3300046471 | Ga0495650_0016353 | Ga0495650_0016353_1838_2392 | 184 |
| 400 | 3300046471 | Ga0495650_0104794 | Ga0495650_0104794_194_748 | 184 |
| 401 | 3300046472 | Ga0495580_0000399 | Ga0495580_0000399_11641_12195 | 184 |
| 402 | 3300046472 | Ga0495580_0001516 | Ga0495580_0001516_17239_17793 | 184 |
| 403 | 3300046472 | Ga0495580_0003829 | Ga0495580_0003829_20_574 | 184 |
| 404 | 3300046472 | Ga0495580_0007048 | Ga0495580_0007048_2121_2675 | 184 |
| 405 | 3300046472 | Ga0495580_0064197 | Ga0495580_0064197_1339_1893 | 184 |
| 406 | 3300046472 | Ga0495580_0283719 | Ga0495580_0283719_131_685 | 184 |
| 407 | 3300046472 | Ga0495580_0557249 | Ga0495580_0557249_108_662 | 184 |
| 408 | 3300046473 | Ga0495582_0001828 | Ga0495582_0001828_1765_2319 | 184 |
| 409 | 3300046473 | Ga0495582_0007890 | Ga0495582_0007890_1992_2546 | 184 |
| 410 | 3300046473 | Ga0495582_0008579 | Ga0495582_0008579_968_1522 | 184 |
| 411 | 3300046473 | Ga0495582_0028456 | Ga0495582_0028456_543_1097 | 184 |
| 412 | 3300046474 | Ga0495605_0006065 | Ga0495605_0006065_1269_1823 | 184 |
| 413 | 3300046474 | Ga0495605_0028262 | Ga0495605_0028262_112_666 | 184 |
| 414 | 3300046476 | Ga0495662_0008733 | Ga0495662_0008733_4215_4769 | 184 |
| 415 | 3300046476 | Ga0495662_0024590 | Ga0495662_0024590_1311_1865 | 184 |
| 416 | 3300046476 | Ga0495662_0042229 | Ga0495662_0042229_1215_1769 | 184 |
| 417 | 3300046477 | Ga0495664_0010194 | Ga0495664_0010194_4577_5131 | 184 |
| 418 | 3300046477 | Ga0495664_0017290 | Ga0495664_0017290_2690_3244 | 184 |
| 419 | 3300046477 | Ga0495664_0033627 | Ga0495664_0033627_99_653 | 184 |
| 420 | 3300046477 | Ga0495664_0111922 | Ga0495664_0111922_48_602 | 184 |
| 421 | 3300046500 | Ga0495596_0002259 | Ga0495596_0002259_8133_8687 | 184 |
| 422 | 3300046500 | Ga0495596_0013187 | Ga0495596_0013187_2928_3482 | 184 |
| 423 | 3300046500 | Ga0495596_0068846 | Ga0495596_0068846_758_1312 | 184 |
| 424 | 3300046507 | Ga0495606_0176817 | Ga0495606_0176817_88_642 | 184 |
| 425 | 3300046511 | Ga0495608_0054093 | Ga0495608_0054093_1550_2104 | 184 |
| 426 | 3300046511 | Ga0495608_0116511 | Ga0495608_0116511_339_893 | 184 |
| 427 | 3300046514 | Ga0495618_0001699 | Ga0495618_0001699_13817_14371 | 184 |
| 428 | 3300046515 | Ga0495620_0057900 | Ga0495620_0057900_919_1473 | 184 |
| 429 | 3300046516 | Ga0495628_0002713 | Ga0495628_0002713_12663_13217 | 184 |
| 430 | 3300046516 | Ga0495628_0044710 | Ga0495628_0044710_832_1386 | 184 |
| 431 | 3300046516 | Ga0495628_0081186 | Ga0495628_0081186_20_574 | 184 |
| 432 | 3300046516 | Ga0495628_0090932 | Ga0495628_0090932_967_1569 | 184 |
| 433 | 3300046516 | Ga0495628_0445036 | Ga0495628_0445036_85_639 | 184 |
| 434 | 3300046517 | Ga0495630_0008234 | Ga0495630_0008234_5819_6373 | 184 |
| 435 | 3300046517 | Ga0495630_0060344 | Ga0495630_0060344_419_973 | 184 |
| 436 | 3300046517 | Ga0495630_0067558 | Ga0495630_0067558_1569_2123 | 184 |
| 437 | 3300046517 | Ga0495630_0069753 | Ga0495630_0069753_1091_1645 | 184 |
| 438 | 3300046517 | Ga0495630_0097572 | Ga0495630_0097572_90_644 | 184 |
| 439 | 3300046522 | Ga0495643_0192414 | Ga0495643_0192414_292_846 | 184 |
| 440 | 3300046524 | Ga0495648_0002524 | Ga0495648_0002524_12443_12997 | 184 |
| 441 | 3300046524 | Ga0495648_0011234 | Ga0495648_0011234_3768_4322 | 184 |
| 442 | 3300046526 | Ga0495666_0002715 | Ga0495666_0002715_5448_6002 | 184 |
| 443 | 3300046526 | Ga0495666_0007405 | Ga0495666_0007405_2875_3429 | 184 |
| 444 | 3300046526 | Ga0495666_0008867 | Ga0495666_0008867_3397_3951 | 184 |
| 445 | 3300046526 | Ga0495666_0054399 | Ga0495666_0054399_1113_1667 | 184 |
| 446 | 3300046526 | Ga0495666_0097418 | Ga0495666_0097418_220_774 | 184 |
| 447 | 3300046528 | Ga0495642_0102255 | Ga0495642_0102255_81_635 | 184 |
| 448 | 3300046529 | Ga0495652_0355337 | Ga0495652_0355337_430_984 | 184 |
| 449 | 3300046529 | Ga0495652_0360632 | Ga0495652_0360632_150_704 | 184 |
| 450 | 3300046529 | Ga0495652_0437933 | Ga0495652_0437933_165_719 | 184 |
| 451 | 3300046531 | Ga0495665_0004509 | Ga0495665_0004509_4087_4641 | 184 |
| 452 | 3300046531 | Ga0495665_0007971 | Ga0495665_0007971_2960_3514 | 184 |
| 453 | 3300046531 | Ga0495665_0013619 | Ga0495665_0013619_216_770 | 184 |
| 454 | 3300046533 | Ga0495640_0012947 | Ga0495640_0012947_5683_6237 | 184 |
| 455 | 3300046533 | Ga0495640_0070824 | Ga0495640_0070824_980_1534 | 184 |
| 456 | 3300046533 | Ga0495640_0080366 | Ga0495640_0080366_725_1279 | 184 |
| 457 | 3300046535 | Ga0495586_0015452 | Ga0495586_0015452_1563_2117 | 184 |
| 458 | 3300046535 | Ga0495586_0139775 | Ga0495586_0139775_705_1259 | 184 |
| 459 | 3300046536 | Ga0495587_0007500 | Ga0495587_0007500_2829_3383 | 184 |
| 460 | 3300046536 | Ga0495587_0008174 | Ga0495587_0008174_5788_6342 | 184 |
| 461 | 3300046538 | Ga0495609_0016409 | Ga0495609_0016409_90_644 | 184 |
| 462 | 3300046543 | Ga0495645_0009186 | Ga0495645_0009186_6204_6758 | 184 |
| 463 | 3300046557 | Ga0495622_0003296 | Ga0495622_0003296_2701_3255 | 184 |
| 464 | 3300046559 | Ga0495667_0031383 | Ga0495667_0031383_1978_2532 | 184 |
| 465 | 3300046642 | Ga0495634_0012286 | Ga0495634_0012286_455_1009 | 184 |
| 466 | 3300046642 | Ga0495634_0015132 | Ga0495634_0015132_809_1363 | 184 |
| 467 | 3300046642 | Ga0495634_0015698 | Ga0495634_0015698_807_1361 | 184 |
| 468 | 3300046648 | Ga0495611_0027740 | Ga0495611_0027740_1572_2126 | 184 |
| 469 | 3300046648 | Ga0495611_0298198 | Ga0495611_0298198_152_706 | 184 |
| 470 | 3300046660 | Ga0495625_0050666 | Ga0495625_0050666_115_669 | 184 |
| 471 | 3300046660 | Ga0495625_0225209 | Ga0495625_0225209_201_755 | 184 |
| 472 | 3300046663 | Ga0495635_0007375 | Ga0495635_0007375_4112_4666 | 184 |
| 473 | 3300046663 | Ga0495635_0029430 | Ga0495635_0029430_1633_2187 | 184 |
| 474 | 3300046665 | Ga0495661_0012011 | Ga0495661_0012011_2374_2928 | 184 |
| 475 | 3300046665 | Ga0495661_0154210 | Ga0495661_0154210_203_757 | 184 |
| 476 | 3300046674 | Ga0495588_0072219 | Ga0495588_0072219_167_721 | 184 |
| 477 | 3300046675 | Ga0495657_0137947 | Ga0495657_0137947_559_1113 | 184 |
| 478 | 3300046678 | Ga0495599_0023487 | Ga0495599_0023487_419_973 | 184 |
| 479 | 3300046678 | Ga0495599_0049478 | Ga0495599_0049478_229_783 | 184 |
| 480 | 3300046679 | Ga0495623_0003385 | Ga0495623_0003385_1289_1852 | 184 |
| 481 | 3300046679 | Ga0495623_0006011 | Ga0495623_0006011_5548_6102 | 184 |
| 482 | 3300046679 | Ga0495623_0017147 | Ga0495623_0017147_3176_3730 | 184 |
| 483 | 3300046679 | Ga0495623_0096302 | Ga0495623_0096302_195_749 | 184 |
| 484 | 3300046679 | Ga0495623_0124068 | Ga0495623_0124068_53_607 | 184 |
| 485 | 3300046680 | Ga0495646_0002486 | Ga0495646_0002486_8817_9371 | 184 |
| 486 | 3300046680 | Ga0495646_0007426 | Ga0495646_0007426_3568_4122 | 184 |
| 487 | 3300046680 | Ga0495646_0041094 | Ga0495646_0041094_1171_1725 | 184 |
| 488 | 3300046680 | Ga0495646_0051918 | Ga0495646_0051918_420_974 | 184 |
| 489 | 3300046680 | Ga0495646_0260082 | Ga0495646_0260082_39_593 | 184 |
| 490 | 3300046684 | Ga0495669_0366841 | Ga0495669_0366841_82_636 | 184 |
| 491 | 3300046689 | Ga0495613_0015113 | Ga0495613_0015113_3117_3671 | 184 |
| 492 | 3300046689 | Ga0495613_0270885 | Ga0495613_0270885_199_753 | 184 |
| 493 | 3300046690 | Ga0495624_0001954 | Ga0495624_0001954_3690_4244 | 184 |
| 494 | 3300046690 | Ga0495624_0002906 | Ga0495624_0002906_6233_6787 | 184 |
| 495 | 3300046690 | Ga0495624_0036200 | Ga0495624_0036200_1702_2256 | 184 |
| 496 | 3300046690 | Ga0495624_0064311 | Ga0495624_0064311_125_679 | 184 |
| 497 | 3300046692 | Ga0495671_0112082 | Ga0495671_0112082_163_717 | 184 |
| 498 | 3300046692 | Ga0495671_0219859 | Ga0495671_0219859_55_609 | 184 |
| 499 | 3300046694 | Ga0495649_0015997 | Ga0495649_0015997_1345_1899 | 184 |
| 500 | 3300046694 | Ga0495649_0025996 | Ga0495649_0025996_946_1500 | 184 |
| 501 | 3300046794 | Ga0495589_0061757 | Ga0495589_0061757_57_611 | 184 |
| 502 | 3300046794 | Ga0495589_0065606 | Ga0495589_0065606_848_1402 | 184 |
| 503 | 3300046809 | Ga0495600_0027105 | Ga0495600_0027105_2397_2951 | 184 |
| 504 | 3300046809 | Ga0495600_0058450 | Ga0495600_0058450_1229_1783 | 184 |
| 505 | 3300047315 | Ga0495581_0006415 | Ga0495581_0006415_410_964 | 184 |
| 506 | 3300047315 | Ga0495581_0008365 | Ga0495581_0008365_1393_1947 | 184 |
| 507 | 3300047315 | Ga0495581_0125202 | Ga0495581_0125202_700_1254 | 184 |
| 508 | 3300047317 | Ga0495604_0006883 | Ga0495604_0006883_3407_3961 | 184 |
| 509 | 3300047317 | Ga0495604_0011173 | Ga0495604_0011173_4866_5429 | 184 |
| 510 | 3300047317 | Ga0495604_0047585 | Ga0495604_0047585_1577_2131 | 184 |
| 511 | 3300047317 | Ga0495604_0147055 | Ga0495604_0147055_39_593 | 184 |
| 512 | 3300047317 | Ga0495604_0401122 | Ga0495604_0401122_90_644 | 184 |
| 513 | 3300047317 | Ga0495604_0404563 | Ga0495604_0404563_112_666 | 184 |
| 514 | 3300047319 | Ga0495674_0005420 | Ga0495674_0005420_2516_3070 | 184 |
| 515 | 3300047319 | Ga0495674_0304743 | Ga0495674_0304743_20_574 | 184 |
| 516 | 3300047320 | Ga0495672_0052833 | Ga0495672_0052833_235_789 | 184 |
| 517 | 3300047321 | Ga0495676_0010656 | Ga0495676_0010656_3478_4032 | 184 |
| 518 | 3300047321 | Ga0495676_0028717 | Ga0495676_0028717_308_862 | 184 |
| 519 | 3300047321 | Ga0495676_0059310 | Ga0495676_0059310_1209_1763 | 184 |
| 520 | 3300047321 | Ga0495676_0153261 | Ga0495676_0153261_303_857 | 184 |
| 521 | 3300047322 | Ga0495680_0182359 | Ga0495680_0182359_39_593 | 184 |
| 522 | 3300047322 | Ga0495680_0210916 | Ga0495680_0210916_682_1236 | 184 |
| 523 | 3300047322 | Ga0495680_0497986 | Ga0495680_0497986_77_640 | 184 |
| 524 | 3300047322 | Ga0495680_0756867 | Ga0495680_0756867_55_609 | 184 |
| 525 | 3300047323 | Ga0495683_0007609 | Ga0495683_0007609_2547_3101 | 184 |
| 526 | 3300047323 | Ga0495683_0011002 | Ga0495683_0011002_1228_1782 | 184 |
| 527 | 3300047323 | Ga0495683_0015440 | Ga0495683_0015440_784_1338 | 184 |
| 528 | 3300047443 | Ga0495687_013687 | Ga0495687_013687_1086_1640 | 184 |
| 529 | 3300047444 | Ga0495675_0006688 | Ga0495675_0006688_1879_2433 | 184 |
| 530 | 3300047444 | Ga0495675_0012339 | Ga0495675_0012339_3962_4525 | 184 |
| 531 | 3300047444 | Ga0495675_0050322 | Ga0495675_0050322_1039_1641 | 184 |
| 532 | 3300047444 | Ga0495675_0184382 | Ga0495675_0184382_420_974 | 184 |
| 533 | 3300047446 | Ga0495679_000026 | Ga0495679_000026_104615_105169 | 184 |
| 534 | 3300047446 | Ga0495679_000708 | Ga0495679_000708_2805_3359 | 184 |
| 535 | 3300047446 | Ga0495679_002155 | Ga0495679_002155_5497_6051 | 184 |
| 536 | 3300047446 | Ga0495679_016721 | Ga0495679_016721_1298_1852 | 184 |
| 537 | 3300047469 | Ga0495673_0003485 | Ga0495673_0003485_5377_5931 | 184 |
| 538 | 3300047471 | Ga0495684_0030195 | Ga0495684_0030195_2588_3142 | 184 |
| 539 | 3300047471 | Ga0495684_0208803 | Ga0495684_0208803_401_955 | 184 |
| 540 | 3300047472 | Ga0495686_0312085 | Ga0495686_0312085_229_783 | 184 |
| 541 | 3300047673 | Ga0495593_0001493 | Ga0495593_0001493_11087_11641 | 184 |
| 542 | 3300047673 | Ga0495593_0003020 | Ga0495593_0003020_6331_6885 | 184 |
| 543 | 3300047673 | Ga0495593_0015460 | Ga0495593_0015460_3192_3746 | 184 |
| 544 | 3300047673 | Ga0495593_0176960 | Ga0495593_0176960_272_826 | 184 |
| 545 | 3300048088 | Ga0495602_0001347 | Ga0495602_0001347_13904_14458 | 184 |
| 546 | 3300048088 | Ga0495602_0125765 | Ga0495602_0125765_489_1043 | 184 |
| 547 | 3300048088 | Ga0495602_0282669 | Ga0495602_0282669_639_1193 | 184 |
| 548 | 3300048088 | Ga0495602_0306362 | Ga0495602_0306362_79_642 | 184 |
| 549 | 3300048088 | Ga0495602_0349435 | Ga0495602_0349435_211_765 | 184 |
| 550 | 3300048089 | Ga0495614_0001197 | Ga0495614_0001197_2643_3197 | 184 |
| 551 | 3300048089 | Ga0495614_0063661 | Ga0495614_0063661_780_1334 | 184 |
| 552 | 3300048089 | Ga0495614_0209585 | Ga0495614_0209585_166_720 | 184 |
| 553 | 3300048091 | Ga0495626_0040058 | Ga0495626_0040058_1478_2032 | 184 |
| 554 | 3300048905 | Ga0496102_0021246 | Ga0496102_0021246_1562_2116 | 184 |
| 555 | 3300048906 | Ga0496103_0004217 | Ga0496103_0004217_2065_2619 | 184 |
| 556 | 3300048906 | Ga0496103_0471881 | Ga0496103_0471881_240_794 | 184 |
| 557 | 3300048916 | Ga0496113_1175747 | Ga0496113_1175747_17_571 | 184 |
| 558 | 3300048919 | Ga0496116_0086167 | Ga0496116_0086167_76_630 | 184 |
| 559 | 3300048919 | Ga0496116_0163263 | Ga0496116_0163263_16_570 | 184 |
| 560 | 3300048920 | Ga0496117_0009122 | Ga0496117_0009122_581_1135 | 184 |
| 561 | 3300048920 | Ga0496117_0011464 | Ga0496117_0011464_4726_5280 | 184 |
| 562 | 3300048920 | Ga0496117_0099255 | Ga0496117_0099255_373_927 | 184 |
| 563 | 3300048921 | Ga0496118_0000820 | Ga0496118_0000820_29099_29653 | 184 |
| 564 | 3300048921 | Ga0496118_0001936 | Ga0496118_0001936_10353_10907 | 184 |
| 565 | 3300048921 | Ga0496118_0009709 | Ga0496118_0009709_3013_3567 | 184 |
| 566 | 3300048921 | Ga0496118_0012350 | Ga0496118_0012350_7405_7959 | 184 |
| 567 | 3300048924 | Ga0496121_0029862 | Ga0496121_0029862_2228_2782 | 184 |
| 568 | 3300048929 | Ga0496126_0000698 | Ga0496126_0000698_15634_16188 | 184 |
| 569 | 3300048929 | Ga0496126_0008500 | Ga0496126_0008500_9696_10250 | 184 |
| 570 | 3300049459 | Ga0495678_051660 | Ga0495678_051660_898_1452 | 184 |
| 571 | 3300049460 | Ga0495682_0029750 | Ga0495682_0029750_915_1469 | 184 |
| 572 | 3300049460 | Ga0495682_0032056 | Ga0495682_0032056_807_1361 | 184 |
| 573 | 3300053083 | Ga0495655_0054634 | Ga0495655_0054634_437_991 | 184 |
| 574 | iso_pu_bacteria | 2919527303 | 2919532832 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h1t-assembly1.cif.gz_B | crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution | 0.9164 | 15 | 180 |
| 6s5l-assembly1.cif.gz_D | anabaena apo-c-terminal domain homolog of the orange carotenoid protein in native conditions | 0.7539 | 17 | 62 |
| 6s5l-assembly1.cif.gz_I | anabaena apo-c-terminal domain homolog of the orange carotenoid protein in native conditions | 0.6633 | 17 | 66 |
| 5kpe-assembly1.cif.gz_A | solution nmr structure of denovo beta sheet design protein, northeast structural genomics consortium (nesg) target or664 | 0.637 | 4 | 51 |
| 5wlw-assembly1.cif.gz_H | crystal structure of the human mitochondrial cysteine desulfurase with active cysteine loop within iscu1 active site, coordinating zn ion. complexed with human isd11 and e. coli acp1 at 3.3a. | 0.6353 | 31 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ke7A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8491 | 17 | 50 | 3.10.450.50 |
| af_P9WM93_4_131_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.6976 | 10 | 51 | 3.10.450.50 |
| af_Q1JUZ1_228_427_3.90.380.10 | Alpha Beta;Alpha-Beta Complex;Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1;Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 | 0.6689 | 11 | 70 | 3.90.380.10 |
| 1srqA01 | Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; | 0.6632 | 1 | 50 | 3.30.1120.160 |
| af_I1M0K3_150_241_3.10.450.10 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.6615 | 6 | 52 | 3.10.450.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q5PIU4-F1-model_v4 | Transcriptional regulator | 0.9932 | 1 | 181 |
|
| AF-A0A2A4EMG7-F1-model_v4 | Transcriptional regulator | 0.9929 | 1 | 184 |
|
| AF-A0A7X3J452-F1-model_v4 | deleted | 0.9908 | 1 | 184 |
|
| AF-C4APT3-F1-model_v4 | deleted | 0.9885 | 1 | 180 |
|
| AF-A0A0E1VV87-F1-model_v4 | Transcriptional regulator | 0.9882 | 1 | 180 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar