F465288

General Info

Members Datasets Scaffolds Average Seq Length
574 342 503 184

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100637095|Ga0070698_1006370952
Length 219
Sequence MLPQANRTPRRLLGKPGHHRESMNNEHNIMWTPWSGPGLEHLRLVQGDHLILADGLIIGVAEEGDQPFRARYTIQCDADWHVRELRIDMLDAANRRLDLMSDGAGHWADGAGEALPGLAGCFDVDISATPFTNTLPIRRLALPPGAAADVNVVYIVLPELTVAPGMQRYTCLASDAAGARYRYESRAHDFTAELPVDVHGLVEDYPGLFRRVAGEPPTE

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
14 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
15 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
16 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
17 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
18 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
19 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
20 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
21 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
22 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
23 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
24 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
25 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
26 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
27 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
28 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
29 2818991450 Burkholderia sp. 604 Isolate Unclassified
30 2818991452 Burkholderia cepacia 561 Isolate Unclassified
31 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
32 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
33 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
34 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
35 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
36 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
37 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
38 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
39 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
40 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
41 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
42 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
43 2904564687 Burkholderia sp. 571 Isolate Unclassified
44 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
45 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
46 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
47 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
48 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
49 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
50 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
51 2928163908 Burkholderia sp. 567 Isolate Unclassified
52 2928170801 Burkholderia sp. 572 Isolate Unclassified
53 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
54 2928536128 Burkholderia sola 565 Isolate Unclassified
55 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
56 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
57 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
58 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
59 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
62 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
68 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
69 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
70 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
71 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
72 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
73 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
77 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
90 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
94 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
95 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
102 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
192 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
193 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
285 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
286 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
325 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
326 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
331 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
332 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
333 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
334 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
335 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
336 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
337 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
338 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
339 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
340 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
341 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
342 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.59
Metatranscriptomes 1.05
Isolates 12.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 2.09
Rhizoplane 3.14
Rhizosphere 72.65
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006615 3300001979 Bacteria 4780
2 JGI24739J22299_10007134 3300001989 Bacteria 4205
3 JGI24739J22299_10007865 3300001989 Bacteria 3989
4 JGI24739J22299_10039797 3300001989 Bacteria 1572
5 JGI24735J21928_10009051 3300002067 Bacteria 3207
6 JGI24735J21928_10116847 3300002067 Bacteria 767
7 JGI24735J21928_10133722 3300002067 Bacteria 715
8 JGI24738J21930_10000325 3300002075 Bacteria 13138
9 JGI25156J39149_1000268 3300002705 Bacteria 35281
10 JGI25156J39149_1000806 3300002705 Bacteria 16042
11 JGI25156J39149_1007208 3300002705 Bacteria 2950
12 JGI25151J46595_10031075 3300003187 Bacteria 2090
13 JGI25165J46597_1000701 3300003214 Bacteria 26658
14 rootL2_10373663 3300003322 Bacteria 1365
15 rootL2_10376628 3300003322 Bacteria 1461
16 Ga0055538_1000252 3300003751 Bacteria 28500
17 Ga0055533_1000091 3300003756 Bacteria 120504
18 Ga0055533_1007581 3300003756 Bacteria 1460
19 Ga0055532_1000045 3300003758 Bacteria 186314
20 Ga0055532_1000975 3300003758 Bacteria 9129
21 Ga0055532_1001032 3300003758 Bacteria 8611
22 Ga0055532_1001063 3300003758 Bacteria 8512
23 Ga0055527_1000027 3300003760 Bacteria 186314
24 Ga0055527_1000358 3300003760 Bacteria 21912
25 Ga0055527_1009494 3300003760 Bacteria 1142
26 Ga0055535_1000033 3300003761 Bacteria 186314
27 Ga0055535_1000842 3300003761 Bacteria 21912
28 Ga0055535_1001338 3300003761 Bacteria 13010
29 Ga0055542_1000050 3300003762 Bacteria 186314
30 Ga0055542_1001904 3300003762 Bacteria 8254
31 Ga0055529_1000061 3300003763 Bacteria 186314
32 Ga0055529_1000639 3300003763 Bacteria 25736
33 Ga0055529_1005263 3300003763 Bacteria 1886
34 Ga0055528_1003340 3300003790 Bacteria 8125
35 Ga0055541_1009092 3300003841 Bacteria 1552
36 Ga0058692_1000139 3300003856 Bacteria 46218
37 Ga0058861_11200430 3300004800 Bacteria 1135
38 Ga0058862_12827803 3300004803 Bacteria 2844
39 Ga0070683_100893914 3300005329 Bacteria 852
40 Ga0070670_100869891 3300005331 Bacteria 816
41 Ga0070680_100081489 3300005336 Bacteria 2670
42 Ga0068868_100422123 3300005338 Bacteria 1155
43 Ga0070660_100000171 3300005339 Bacteria 42584
44 Ga0070668_100168507 3300005347 Bacteria 1781
45 Ga0070673_100602921 3300005364 Bacteria 1002
46 Ga0070688_100902541 3300005365 Bacteria 697
47 Ga0070659_100000028 3300005366 Bacteria 140665
48 Ga0070667_100215128 3300005367 Bacteria 1709
49 Ga0070713_100972148 3300005436 Unclassified 818
50 Ga0070708_100671185 3300005445 Archaea 976
51 Ga0070663_100002373 3300005455 Bacteria 10592
52 Ga0070663_100505050 3300005455 Bacteria 1005
53 Ga0070662_100774620 3300005457 Bacteria 815
54 Ga0070681_10101400 3300005458 Bacteria 2824
55 Ga0068867_101218919 3300005459 Bacteria 692
56 Ga0070698_100637095 3300005471 Bacteria 1007
57 Ga0070684_100256805 3300005535 Bacteria 1598
58 Ga0070672_100022714 3300005543 Bacteria 4613
59 Ga0070696_100158644 3300005546 Bacteria 1665
60 Ga0068855_100010177 3300005563 Bacteria 11335
61 Ga0068856_100670166 3300005614 Bacteria 1058
62 Ga0068859_101904371 3300005617 Bacteria 657
63 Ga0068864_100732940 3300005618 Bacteria 968
64 Ga0068861_100341394 3300005719 Bacteria 1311
65 Ga0068863_100407409 3300005841 Bacteria 1331
66 Ga0068858_100434861 3300005842 Bacteria 1263
67 Ga0081539_10020762 3300005985 Unclassified 4420
68 Ga0075362_10017922 3300006177 Bacteria 2924
69 Ga0075369_10037307 3300006186 Bacteria 2070
70 Ga0075366_10411904 3300006195 Bacteria 832
71 Ga0075428_100007145 3300006844 Bacteria 12370
72 Ga0075431_100383496 3300006847 Bacteria 1409
73 Ga0075433_10327920 3300006852 Bacteria 1354
74 Ga0097620_101904392 3300006931 Bacteria 657
75 Ga0105251_10000683 3300009011 Bacteria 31295
76 Ga0105244_10000269 3300009036 Bacteria 52299
77 Ga0105250_10057252 3300009092 Bacteria 1564
78 Ga0105240_10005221 3300009093 Bacteria 19429
79 Ga0105240_10047555 3300009093 Bacteria 5429
80 Ga0105240_11173217 3300009093 Bacteria 814
81 Ga0111539_10012350 3300009094 Bacteria 10704
82 Ga0111539_11453764 3300009094 Bacteria 795
83 Ga0114129_10152815 3300009147 Bacteria 3158
84 Ga0105241_10053429 3300009174 Bacteria 3089
85 Ga0105241_10557287 3300009174 Bacteria 1030
86 Ga0105242_10243110 3300009176 Bacteria 1619
87 Ga0105242_11339692 3300009176 Unclassified 741
88 Ga0105237_10031570 3300009545 Bacteria 5367
89 Ga0105237_10050021 3300009545 Bacteria 4200
90 Ga0105238_10096060 3300009551 Bacteria 2950
91 Ga0105238_10252350 3300009551 Bacteria 1743
92 Ga0105239_10023248 3300010375 Bacteria 6829
93 Ga0105246_10294864 3300011119 Bacteria 1306
94 Ga0157373_10121499 3300013100 Bacteria 1836
95 Ga0157370_11233314 3300013104 Bacteria 674
96 Ga0157369_10052820 3300013105 Bacteria 4395
97 Ga0157369_10118990 3300013105 Bacteria 2803
98 Ga0157369_10220712 3300013105 Bacteria 1984
99 Ga0157378_10088327 3300013297 Bacteria 2813
100 Ga0163162_10029660 3300013306 Bacteria 5416
101 Ga0157375_10204524 3300013308 Bacteria 2131
102 Ga0157375_11650080 3300013308 Bacteria 758
103 Ga0157380_10150876 3300014326 Bacteria 2009
104 Ga0182008_10017502 3300014497 Bacteria 3717
105 Ga0182008_10120200 3300014497 Bacteria 1305
106 Ga0157379_10545179 3300014968 Bacteria 1079
107 Ga0182006_1064466 3300015261 Bacteria 1374
108 Ga0182007_10001199 3300015262 Bacteria 14075
109 Ga0182007_10004747 3300015262 Bacteria 6112
110 Ga0163161_10090260 3300017792 Bacteria 2267
111 Ga0197907_11185765 3300020069 Bacteria 1008
112 Ga0206356_11130835 3300020070 Bacteria 724
113 Ga0206351_10791431 3300020077 Bacteria 802
114 Ga0206353_12056884 3300020082 Bacteria 778
115 Ga0209784_100121 3300025224 Bacteria 82273
116 Ga0209566_101490 3300025225 Bacteria 6639
117 Ga0209674_100074 3300025226 Bacteria 223554
118 Ga0209674_100102 3300025226 Bacteria 155582
119 Ga0209674_101245 3300025226 Bacteria 7190
120 Ga0209672_100042 3300025228 Bacteria 272005
121 Ga0209672_100053 3300025228 Bacteria 223599
122 Ga0209672_100131 3300025228 Bacteria 74237
123 Ga0209147_100012 3300025229 Bacteria 681990
124 Ga0209147_100052 3300025229 Bacteria 272005
125 Ga0209147_100070 3300025229 Bacteria 223535
126 Ga0209147_100291 3300025229 Bacteria 42708
127 Ga0209563_100691 3300025230 Bacteria 10638
128 Ga0207427_103762 3300025231 Bacteria 2945
129 Ga0209258_100030 3300025242 Bacteria 470208
130 Ga0209258_100073 3300025242 Bacteria 272005
131 Ga0209258_100094 3300025242 Bacteria 223535
132 Ga0209148_1000022 3300025254 Bacteria 681990
133 Ga0209148_1000100 3300025254 Bacteria 223604
134 Ga0209148_1000524 3300025254 Bacteria 37800
135 Ga0209759_1000009 3300025256 Bacteria 446623
136 Ga0209759_1000036 3300025256 Bacteria 261374
137 Ga0209759_1000143 3300025256 Bacteria 123727
138 Ga0209759_1013489 3300025256 Bacteria 2207
139 Ga0209233_1000144 3300025261 Bacteria 190024
140 Ga0209565_1015513 3300025263 Bacteria 1717
141 Ga0209455_1000024 3300025272 Bacteria 676133
142 Ga0209455_1000090 3300025272 Bacteria 223604
143 Ga0209455_1001569 3300025272 Bacteria 10072
144 Ga0209673_1000021 3300025273 Bacteria 422978
145 Ga0209025_1001634 3300025294 Bacteria 27854
146 Ga0209564_1011401 3300025295 Bacteria 3987
147 Ga0207655_1001542 3300025728 Bacteria 20809
148 Ga0207713_1003522 3300025735 Bacteria 10613
149 Ga0207647_10004058 3300025904 Bacteria 10904
150 Ga0207647_10016712 3300025904 Bacteria 5001
151 Ga0207647_10017989 3300025904 Bacteria 4791
152 Ga0207647_10165267 3300025904 Bacteria 1290
153 Ga0207705_10013047 3300025909 Bacteria 5996
154 Ga0207707_10103667 3300025912 Bacteria 2486
155 Ga0207707_10140846 3300025912 Bacteria 2109
156 Ga0207695_10003099 3300025913 Bacteria 23798
157 Ga0207695_10093286 3300025913 Bacteria 3020
158 Ga0207695_10934132 3300025913 Bacteria 747
159 Ga0207671_10024389 3300025914 Bacteria 4549
160 Ga0207671_10205540 3300025914 Bacteria 1539
161 Ga0207657_10000111 3300025919 Bacteria 79991
162 Ga0207652_10021727 3300025921 Bacteria 5299
163 Ga0207681_10119281 3300025923 Bacteria 1932
164 Ga0207694_10368710 3300025924 Bacteria 1191
165 Ga0207690_10000009 3300025932 Bacteria 366044
166 Ga0207706_10016553 3300025933 Bacteria 6657
167 Ga0207686_10233007 3300025934 Bacteria 1336
168 Ga0207670_10306178 3300025936 Bacteria 1246
169 Ga0207691_10067223 3300025940 Bacteria 3241
170 Ga0207711_10136814 3300025941 Bacteria 2201
171 Ga0207689_10351290 3300025942 Bacteria 1226
172 Ga0207667_10003058 3300025949 Bacteria 20744
173 Ga0207667_10386611 3300025949 Bacteria 1425
174 Ga0207668_10070719 3300025972 Bacteria 2490
175 Ga0207668_10359085 3300025972 Bacteria 1220
176 Ga0207640_10482295 3300025981 Archaea 1029
177 Ga0207677_10340599 3300026023 Bacteria 1253
178 Ga0207678_10003675 3300026067 Bacteria 13792
179 Ga0207678_10241666 3300026067 Bacteria 1546
180 Ga0207702_10312262 3300026078 Bacteria 1495
181 Ga0207641_10122291 3300026088 Bacteria 2325
182 Ga0207676_10479600 3300026095 Bacteria 1178
183 Ga0207675_100924449 3300026118 Bacteria 889
184 Ga0207675_101120261 3300026118 Archaea 807
185 Ga0207683_10349941 3300026121 Bacteria 1356
186 Ga0207698_11015512 3300026142 Bacteria 840
187 Ga0209371_1000128 3300027312 Bacteria 124861
188 Ga0209371_1000421 3300027312 Bacteria 43622
189 Ga0207428_10015492 3300027907 Bacteria 6595
190 Ga0268265_11218629 3300028380 Bacteria 751
191 Ga0265338_10000058 3300028800 Bacteria 198555
192 Ga0268256_1000360 3300030500 Bacteria 43620
193 Ga0268256_1000513 3300030500 Bacteria 32533
194 Ga0316181_1244883 3300030744 Bacteria 1337
195 Ga0316182_1073515 3300030745 Archaea 831
196 Ga0265340_10077825 3300031247 Bacteria 1564
197 Ga0265340_10148371 3300031247 Bacteria 1070
198 Ga0265316_10184774 3300031344 Bacteria 1551
199 Ga0265314_10217150 3300031711 Bacteria 1118
200 Ga0307413_10159869 3300031824 Archaea 1581
201 Ga0307410_10118072 3300031852 Archaea 1930
202 Ga0307410_10457216 3300031852 Archaea 1043
203 Ga0307406_10330059 3300031901 Archaea 1184
204 Ga0307412_10000041 3300031911 Bacteria 179188
205 Ga0307412_10316209 3300031911 Bacteria 1240
206 Ga0307409_100256483 3300031995 Archaea 1602
207 Ga0307409_100263650 3300031995 Bacteria 1583
208 Ga0307416_100347452 3300032002 Archaea 1499
209 Ga0307414_10093666 3300032004 Archaea 2240
210 Ga0307414_10148292 3300032004 Bacteria 1847
211 Ga0307411_10354943 3300032005 Bacteria 1197
212 Ga0307415_100107326 3300032126 Bacteria 2063
213 Ga0373923_0141176 3300035111 Bacteria 1089
214 Ga0373945_0121277 3300035116 Bacteria 1040
215 Ga0373955_0233798 3300035172 Bacteria 1100
216 Ga0373927_0653413 3300035695 Bacteria 695
217 Ga0373933_0502841 3300035724 Bacteria 794
218 Ga0395898_0226552 3300037466 Bacteria 1783
219 Ga0436364_1544520 3300037853 Bacteria 2033
220 Ga0436361_0941473 3300039447 Bacteria 829
221 Ga0466961_0060953 3300044693 Bacteria 2398
222 Ga0466957_0059313 3300044842 Bacteria 2345
223 Ga0466960_0055329 3300044901 Bacteria 1929
224 Ga0495592_0029413 3300046454 Bacteria 4160
225 Ga0495592_0074085 3300046454 Bacteria 2473
226 Ga0495592_0134578 3300046454 Bacteria 1725
227 Ga0495592_0197333 3300046454 Bacteria 1360
228 Ga0495603_0000545 3300046455 Bacteria 21000
229 Ga0495603_0010952 3300046455 Bacteria 5502
230 Ga0495603_0072607 3300046455 Bacteria 2022
231 Ga0495603_0123992 3300046455 Bacteria 1505
232 Ga0495603_0227178 3300046455 Bacteria 1076
233 Ga0495590_0015044 3300046457 Bacteria 2815
234 Ga0495590_0016739 3300046457 Bacteria 2646
235 Ga0495591_001885 3300046458 Bacteria 12336
236 Ga0495629_0000061 3300046459 Bacteria 100620
237 Ga0495629_0000090 3300046459 Bacteria 80615
238 Ga0495629_0002691 3300046459 Bacteria 13617
239 Ga0495629_0005335 3300046459 Bacteria 9601
240 Ga0495629_0015491 3300046459 Bacteria 5474
241 Ga0495638_0011722 3300046460 Bacteria 6038
242 Ga0495641_0109046 3300046461 Bacteria 1235
243 Ga0495651_0032029 3300046462 Bacteria 4101
244 Ga0495651_0127898 3300046462 Bacteria 1858
245 Ga0495651_0285777 3300046462 Bacteria 1112
246 Ga0495651_0411841 3300046462 Bacteria 880
247 Ga0495653_0000137 3300046463 Bacteria 60893
248 Ga0495653_0042603 3300046463 Bacteria 3534
249 Ga0495653_0049030 3300046463 Bacteria 3256
250 Ga0495653_0055825 3300046463 Bacteria 3013
251 Ga0495653_0074242 3300046463 Bacteria 2534
252 Ga0495653_0147947 3300046463 Bacteria 1644
253 Ga0495653_0550268 3300046463 Bacteria 714
254 Ga0495650_0000374 3300046471 Bacteria 78199
255 Ga0495650_0005494 3300046471 Bacteria 8197
256 Ga0495650_0011621 3300046471 Bacteria 4805
257 Ga0495650_0016353 3300046471 Bacteria 3762
258 Ga0495650_0104794 3300046471 Bacteria 1057
259 Ga0495580_0000399 3300046472 Bacteria 35561
260 Ga0495580_0001516 3300046472 Bacteria 20427
261 Ga0495580_0003829 3300046472 Bacteria 12718
262 Ga0495580_0007048 3300046472 Bacteria 9061
263 Ga0495580_0031518 3300046472 Bacteria 3830
264 Ga0495580_0064197 3300046472 Bacteria 2574
265 Ga0495580_0283719 3300046472 Bacteria 1129
266 Ga0495580_0511378 3300046472 Bacteria 801
267 Ga0495580_0557249 3300046472 Bacteria 760
268 Ga0495582_0001828 3300046473 Bacteria 12026
269 Ga0495582_0007890 3300046473 Bacteria 5884
270 Ga0495582_0008579 3300046473 Bacteria 5635
271 Ga0495582_0028456 3300046473 Bacteria 3067
272 Ga0495582_0107166 3300046473 Bacteria 1568
273 Ga0495605_0006065 3300046474 Bacteria 6982
274 Ga0495605_0028262 3300046474 Bacteria 2896
275 Ga0495662_0008733 3300046476 Bacteria 4983
276 Ga0495662_0024590 3300046476 Bacteria 2906
277 Ga0495662_0042229 3300046476 Bacteria 2201
278 Ga0495664_0010194 3300046477 Bacteria 5273
279 Ga0495664_0017290 3300046477 Bacteria 4121
280 Ga0495664_0033627 3300046477 Bacteria 3013
281 Ga0495664_0111922 3300046477 Bacteria 1648
282 Ga0495594_0156654 3300046499 Bacteria 1294
283 Ga0495596_0002259 3300046500 Bacteria 10478
284 Ga0495596_0013187 3300046500 Bacteria 3515
285 Ga0495596_0048130 3300046500 Bacteria 1672
286 Ga0495596_0068846 3300046500 Bacteria 1375
287 Ga0495583_0044188 3300046506 Bacteria 2069
288 Ga0495583_0231009 3300046506 Bacteria 745
289 Ga0495606_0097341 3300046507 Bacteria 1798
290 Ga0495606_0176817 3300046507 Bacteria 1234
291 Ga0495608_0054093 3300046511 Bacteria 2654
292 Ga0495608_0116511 3300046511 Bacteria 1714
293 Ga0495610_0023589 3300046512 Bacteria 3339
294 Ga0495618_0001699 3300046514 Bacteria 14622
295 Ga0495620_0057900 3300046515 Bacteria 1624
296 Ga0495628_0002713 3300046516 Bacteria 15854
297 Ga0495628_0044710 3300046516 Bacteria 3522
298 Ga0495628_0081186 3300046516 Bacteria 2518
299 Ga0495628_0090932 3300046516 Bacteria 2362
300 Ga0495628_0445036 3300046516 Bacteria 941
301 Ga0495630_0008234 3300046517 Bacteria 7487
302 Ga0495630_0060344 3300046517 Bacteria 2846
303 Ga0495630_0067558 3300046517 Bacteria 2687
304 Ga0495630_0069753 3300046517 Bacteria 2644
305 Ga0495630_0097572 3300046517 Bacteria 2222
306 Ga0495631_0147959 3300046518 Bacteria 1008
307 Ga0495643_0053921 3300046522 Bacteria 2154
308 Ga0495643_0192414 3300046522 Bacteria 984
309 Ga0495648_0002524 3300046524 Bacteria 16784
310 Ga0495648_0011234 3300046524 Bacteria 6760
311 Ga0495666_0002715 3300046526 Bacteria 8840
312 Ga0495666_0007405 3300046526 Bacteria 5502
313 Ga0495666_0008867 3300046526 Bacteria 5038
314 Ga0495666_0054399 3300046526 Bacteria 1919
315 Ga0495666_0097418 3300046526 Bacteria 1386
316 Ga0495642_0006871 3300046528 Bacteria 4362
317 Ga0495642_0102255 3300046528 Bacteria 1220
318 Ga0495642_0470088 3300046528 Bacteria 556
319 Ga0495652_0355337 3300046529 Bacteria 1048
320 Ga0495652_0360632 3300046529 Bacteria 1039
321 Ga0495652_0430747 3300046529 Archaea 927
322 Ga0495652_0437933 3300046529 Bacteria 918
323 Ga0495654_0031625 3300046530 Bacteria 2686
324 Ga0495665_0004509 3300046531 Bacteria 7515
325 Ga0495665_0007971 3300046531 Bacteria 5743
326 Ga0495665_0013619 3300046531 Bacteria 4396
327 Ga0495665_0137427 3300046531 Bacteria 1278
328 Ga0495640_0012947 3300046533 Bacteria 6358
329 Ga0495640_0070824 3300046533 Bacteria 2341
330 Ga0495640_0080366 3300046533 Bacteria 2168
331 Ga0495586_0015452 3300046535 Bacteria 4061
332 Ga0495586_0139775 3300046535 Bacteria 1359
333 Ga0495587_0007500 3300046536 Bacteria 7063
334 Ga0495587_0008174 3300046536 Bacteria 6742
335 Ga0495609_0016409 3300046538 Bacteria 3451
336 Ga0495645_0002363 3300046543 Bacteria 12796
337 Ga0495645_0009186 3300046543 Bacteria 6907
338 Ga0495622_0003296 3300046557 Bacteria 7635
339 Ga0495667_0031383 3300046559 Bacteria 3567
340 Ga0495634_0012286 3300046642 Bacteria 6206
341 Ga0495634_0015132 3300046642 Bacteria 5545
342 Ga0495634_0015698 3300046642 Bacteria 5432
343 Ga0495634_0381902 3300046642 Archaea 839
344 Ga0495611_0027740 3300046648 Bacteria 2477
345 Ga0495611_0298198 3300046648 Bacteria 743
346 Ga0495625_0050666 3300046660 Bacteria 2979
347 Ga0495625_0225209 3300046660 Bacteria 1227
348 Ga0495635_0007375 3300046663 Bacteria 7673
349 Ga0495635_0029430 3300046663 Bacteria 3819
350 Ga0495661_0012011 3300046665 Bacteria 5860
351 Ga0495661_0154210 3300046665 Bacteria 1238
352 Ga0495588_0072219 3300046674 Bacteria 1795
353 Ga0495657_0137947 3300046675 Bacteria 1522
354 Ga0495599_0023487 3300046678 Bacteria 3855
355 Ga0495599_0049478 3300046678 Bacteria 2634
356 Ga0495623_0003385 3300046679 Bacteria 10543
357 Ga0495623_0006011 3300046679 Bacteria 7897
358 Ga0495623_0017147 3300046679 Bacteria 4677
359 Ga0495623_0096302 3300046679 Bacteria 1808
360 Ga0495623_0124068 3300046679 Bacteria 1552
361 Ga0495646_0002486 3300046680 Bacteria 11313
362 Ga0495646_0007426 3300046680 Bacteria 6966
363 Ga0495646_0041094 3300046680 Bacteria 2843
364 Ga0495646_0051918 3300046680 Bacteria 2479
365 Ga0495646_0089864 3300046680 Bacteria 1776
366 Ga0495646_0260082 3300046680 Bacteria 927
367 Ga0495669_0012531 3300046684 Bacteria 3610
368 Ga0495669_0366841 3300046684 Bacteria 696
369 Ga0495613_0015113 3300046689 Bacteria 5733
370 Ga0495613_0087978 3300046689 Bacteria 2251
371 Ga0495613_0270885 3300046689 Bacteria 1181
372 Ga0495624_0001954 3300046690 Bacteria 15681
373 Ga0495624_0002906 3300046690 Bacteria 12810
374 Ga0495624_0036200 3300046690 Bacteria 3184
375 Ga0495624_0064311 3300046690 Bacteria 2292
376 Ga0495670_0114065 3300046691 Bacteria 1400
377 Ga0495671_0080129 3300046692 Bacteria 1600
378 Ga0495671_0112082 3300046692 Bacteria 1332
379 Ga0495671_0219859 3300046692 Bacteria 919
380 Ga0495649_0015997 3300046694 Bacteria 4259
381 Ga0495649_0025996 3300046694 Bacteria 3258
382 Ga0495589_0061757 3300046794 Bacteria 1838
383 Ga0495589_0065606 3300046794 Bacteria 1779
384 Ga0495589_0253649 3300046794 Bacteria 821
385 Ga0495600_0027105 3300046809 Bacteria 3702
386 Ga0495600_0058450 3300046809 Bacteria 2519
387 Ga0495581_0006415 3300047315 Bacteria 6826
388 Ga0495581_0008365 3300047315 Bacteria 5996
389 Ga0495581_0125202 3300047315 Bacteria 1496
390 Ga0495604_0006883 3300047317 Bacteria 9017
391 Ga0495604_0011173 3300047317 Bacteria 7130
392 Ga0495604_0047585 3300047317 Bacteria 3339
393 Ga0495604_0147055 3300047317 Bacteria 1678
394 Ga0495604_0401122 3300047317 Bacteria 903
395 Ga0495604_0404563 3300047317 Bacteria 898
396 Ga0495674_0005420 3300047319 Bacteria 12247
397 Ga0495674_0304743 3300047319 Bacteria 1300
398 Ga0495674_0331059 3300047319 Bacteria 1239
399 Ga0495672_0052833 3300047320 Bacteria 2384
400 Ga0495672_0407332 3300047320 Bacteria 621
401 Ga0495676_0010656 3300047321 Bacteria 8326
402 Ga0495676_0028717 3300047321 Bacteria 4746
403 Ga0495676_0059310 3300047321 Bacteria 3006
404 Ga0495676_0153261 3300047321 Bacteria 1637
405 Ga0495680_0182359 3300047322 Bacteria 1514
406 Ga0495680_0210916 3300047322 Bacteria 1390
407 Ga0495680_0497986 3300047322 Bacteria 827
408 Ga0495680_0756867 3300047322 Bacteria 637
409 Ga0495683_0007609 3300047323 Bacteria 5835
410 Ga0495683_0011002 3300047323 Bacteria 4771
411 Ga0495683_0015440 3300047323 Bacteria 3974
412 Ga0495687_011743 3300047443 Bacteria 4684
413 Ga0495687_013687 3300047443 Bacteria 4216
414 Ga0495675_0006688 3300047444 Bacteria 7063
415 Ga0495675_0012339 3300047444 Bacteria 5377
416 Ga0495675_0050322 3300047444 Bacteria 2648
417 Ga0495675_0184382 3300047444 Bacteria 1276
418 Ga0495675_0352537 3300047444 Archaea 865
419 Ga0495679_000026 3300047446 Bacteria 196639
420 Ga0495679_000708 3300047446 Bacteria 21613
421 Ga0495679_002155 3300047446 Bacteria 10341
422 Ga0495679_016721 3300047446 Bacteria 2647
423 Ga0495673_0003485 3300047469 Bacteria 10349
424 Ga0495681_0063494 3300047470 Bacteria 1694
425 Ga0495684_0030195 3300047471 Bacteria 4161
426 Ga0495684_0208803 3300047471 Bacteria 1437
427 Ga0495686_0312085 3300047472 Bacteria 864
428 Ga0495593_0001493 3300047673 Bacteria 13761
429 Ga0495593_0003020 3300047673 Bacteria 10134
430 Ga0495593_0015460 3300047673 Bacteria 4321
431 Ga0495593_0037926 3300047673 Bacteria 2604
432 Ga0495593_0176960 3300047673 Bacteria 1074
433 Ga0495602_0001347 3300048088 Bacteria 24240
434 Ga0495602_0125765 3300048088 Bacteria 2054
435 Ga0495602_0282669 3300048088 Bacteria 1221
436 Ga0495602_0306362 3300048088 Bacteria 1160
437 Ga0495602_0349435 3300048088 Bacteria 1067
438 Ga0495614_0001197 3300048089 Bacteria 11145
439 Ga0495614_0024782 3300048089 Bacteria 2590
440 Ga0495614_0063661 3300048089 Bacteria 1585
441 Ga0495614_0209585 3300048089 Bacteria 883
442 Ga0495626_0040058 3300048091 Bacteria 2214
443 Ga0496100_0227636 3300048903 Bacteria 1370
444 Ga0496101_0102345 3300048904 Bacteria 2145
445 Ga0496102_0021246 3300048905 Bacteria 5741
446 Ga0496103_0004217 3300048906 Bacteria 8726
447 Ga0496103_0471881 3300048906 Bacteria 804
448 Ga0496104_0123594 3300048907 Bacteria 2484
449 Ga0496104_0364958 3300048907 Bacteria 1356
450 Ga0496106_0491580 3300048909 Bacteria 986
451 Ga0496110_1180823 3300048913 Archaea 674
452 Ga0496112_0644483 3300048915 Bacteria 989
453 Ga0496113_1175747 3300048916 Bacteria 600
454 Ga0496114_0001900 3300048917 Bacteria 15893
455 Ga0496115_0020550 3300048918 Bacteria 5094
456 Ga0496116_0042346 3300048919 Bacteria 3114
457 Ga0496116_0086167 3300048919 Bacteria 1928
458 Ga0496116_0163263 3300048919 Bacteria 1219
459 Ga0496116_0194776 3300048919 Bacteria 1068
460 Ga0496117_0000254 3300048920 Bacteria 101006
461 Ga0496117_0009122 3300048920 Bacteria 9314
462 Ga0496117_0011464 3300048920 Bacteria 7940
463 Ga0496117_0026296 3300048920 Bacteria 4556
464 Ga0496117_0099255 3300048920 Bacteria 1848
465 Ga0496117_0131802 3300048920 Bacteria 1513
466 Ga0496118_0000820 3300048921 Bacteria 49454
467 Ga0496118_0001936 3300048921 Bacteria 29330
468 Ga0496118_0009709 3300048921 Bacteria 9662
469 Ga0496118_0012350 3300048921 Bacteria 8212
470 Ga0496118_0050922 3300048921 Bacteria 3172
471 Ga0496118_0145993 3300048921 Bacteria 1489
472 Ga0496120_0301978 3300048923 Bacteria 733
473 Ga0496121_0029862 3300048924 Bacteria 5023
474 Ga0496121_0037376 3300048924 Bacteria 4313
475 Ga0496121_0046685 3300048924 Bacteria 3704
476 Ga0496122_0001780 3300048925 Bacteria 33010
477 Ga0496122_0047929 3300048925 Bacteria 3292
478 Ga0496122_0087988 3300048925 Bacteria 2131
479 Ga0496123_0013477 3300048926 Bacteria 6857
480 Ga0496123_0015265 3300048926 Bacteria 6310
481 Ga0496124_0000275 3300048927 Bacteria 98848
482 Ga0496124_0047927 3300048927 Bacteria 3653
483 Ga0496125_0053082 3300048928 Bacteria 3327
484 Ga0496125_0082303 3300048928 Bacteria 2454
485 Ga0496126_0000698 3300048929 Bacteria 61406
486 Ga0496126_0008500 3300048929 Bacteria 11061
487 Ga0495678_051660 3300049459 Bacteria 1587
488 Ga0495682_0029750 3300049460 Bacteria 2023
489 Ga0495682_0032056 3300049460 Bacteria 1941
490 Ga0501040_0268398 3300049576 Bacteria 1218
491 Ga0501046_0444872 3300049580 Bacteria 932
492 Ga0501070_0243506 3300049586 Bacteria 1472
493 Ga0501079_0094039 3300049741 Unclassified 2323
494 Ga0501081_0192203 3300049743 Bacteria 1478
495 nmdc:mga05p37_886388_c1 3300050507 Bacteria 964
496 nmdc:mga06r32_491243_c1 3300050510 Bacteria 1205
497 nmdc:mga08y16_1957_c1 3300050511 Bacteria 20989
498 nmdc:mga0sz30_56125_c1 3300050516 Bacteria 1677
499 Ga0495655_0054634 3300053083 Bacteria 1069
500 Ga0500608_112223 3300053122 Bacteria 1248
501 Ga0500616_0000079 3300053153 Bacteria 200717
502 Ga0501084_0133599 3300054114 Bacteria 2089
503 Ga0501082_0393700 3300060353 Bacteria 1209

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0470088 Ga0495642_0470088_15_500 155
2 3300009093 Ga0105240_11173217 Ga0105240_111732172 168
3 3300014968 Ga0157379_10545179 Ga0157379_105451792 168
4 iso_pu_bacteria 2852646457 2852647715 169
5 3300047319 Ga0495674_0331059 Ga0495674_0331059_509_1063 173
6 3300025256 Ga0209759_1013489 Ga0209759_10134892 174
7 3300001989 JGI24739J22299_10039797 JGI24739J22299_100397972 176
8 3300003322 rootL2_10376628 rootL2_103766282 176
9 3300003758 Ga0055532_1000975 Ga0055532_10009755 176
10 3300003758 Ga0055532_1001032 Ga0055532_10010325 176
11 3300003758 Ga0055532_1001063 Ga0055532_10010634 176
12 3300003760 Ga0055527_1000358 Ga0055527_10003584 176
13 3300003760 Ga0055527_1009494 Ga0055527_10094941 176
14 3300003761 Ga0055535_1000842 Ga0055535_10008424 176
15 3300003761 Ga0055535_1001338 Ga0055535_100133810 176
16 3300003762 Ga0055542_1001904 Ga0055542_10019046 176
17 3300003763 Ga0055529_1000639 Ga0055529_100063918 176
18 3300003763 Ga0055529_1005263 Ga0055529_10052632 176
19 3300003790 Ga0055528_1003340 Ga0055528_10033401 176
20 3300003841 Ga0055541_1009092 Ga0055541_10090922 176
21 3300005329 Ga0070683_100893914 Ga0070683_1008939142 176
22 3300005339 Ga0070660_100000171 Ga0070660_10000017112 176
23 3300005366 Ga0070659_100000028 Ga0070659_100000028108 176
24 3300005455 Ga0070663_100002373 Ga0070663_1000023732 176
25 3300005535 Ga0070684_100256805 Ga0070684_1002568052 176
26 3300005563 Ga0068855_100010177 Ga0068855_10001017712 176
27 3300005614 Ga0068856_100670166 Ga0068856_1006701662 176
28 3300009092 Ga0105250_10057252 Ga0105250_100572522 176
29 3300009093 Ga0105240_10005221 Ga0105240_1000522118 176
30 3300009093 Ga0105240_10047555 Ga0105240_100475554 176
31 3300009545 Ga0105237_10050021 Ga0105237_100500213 176
32 3300009551 Ga0105238_10096060 Ga0105238_100960603 176
33 3300010375 Ga0105239_10023248 Ga0105239_100232484 176
34 3300013100 Ga0157373_10121499 Ga0157373_101214992 176
35 3300013104 Ga0157370_11233314 Ga0157370_112333141 176
36 3300013105 Ga0157369_10118990 Ga0157369_101189903 176
37 3300013105 Ga0157369_10220712 Ga0157369_102207122 176
38 3300014497 Ga0182008_10120200 Ga0182008_101202002 176
39 3300015261 Ga0182006_1064466 Ga0182006_10644662 176
40 3300015262 Ga0182007_10004747 Ga0182007_100047475 176
41 3300020082 Ga0206353_12056884 Ga0206353_120568841 176
42 3300025225 Ga0209566_101490 Ga0209566_1014902 176
43 3300025226 Ga0209674_101245 Ga0209674_1012455 176
44 3300025228 Ga0209672_100042 Ga0209672_10004217 176
45 3300025228 Ga0209672_100131 Ga0209672_10013156 176
46 3300025229 Ga0209147_100012 Ga0209147_100012348 176
47 3300025229 Ga0209147_100052 Ga0209147_10005217 176
48 3300025229 Ga0209147_100291 Ga0209147_10029131 176
49 3300025242 Ga0209258_100030 Ga0209258_100030345 176
50 3300025242 Ga0209258_100073 Ga0209258_10007317 176
51 3300025254 Ga0209148_1000022 Ga0209148_1000022279 176
52 3300025254 Ga0209148_1000524 Ga0209148_100052432 176
53 3300025263 Ga0209565_1015513 Ga0209565_10155131 176
54 3300025272 Ga0209455_1000024 Ga0209455_1000024344 176
55 3300025272 Ga0209455_1001569 Ga0209455_10015696 176
56 3300025273 Ga0209673_1000021 Ga0209673_1000021232 176
57 3300025295 Ga0209564_1011401 Ga0209564_10114015 176
58 3300025904 Ga0207647_10004058 Ga0207647_1000405810 176
59 3300025909 Ga0207705_10013047 Ga0207705_100130472 176
60 3300025913 Ga0207695_10003099 Ga0207695_100030997 176
61 3300025913 Ga0207695_10093286 Ga0207695_100932863 176
62 3300025914 Ga0207671_10024389 Ga0207671_100243892 176
63 3300025919 Ga0207657_10000111 Ga0207657_1000011112 176
64 3300025932 Ga0207690_10000009 Ga0207690_10000009259 176
65 3300025949 Ga0207667_10003058 Ga0207667_1000305818 176
66 3300025949 Ga0207667_10386611 Ga0207667_103866112 176
67 3300026067 Ga0207678_10003675 Ga0207678_100036752 176
68 3300026078 Ga0207702_10312262 Ga0207702_103122622 176
69 3300027312 Ga0209371_1000128 Ga0209371_1000128104 176
70 3300030500 Ga0268256_1000513 Ga0268256_100051310 176
71 3300037466 Ga0395898_0226552 Ga0395898_0226552_486_1040 176
72 3300044693 Ga0466961_0060953 Ga0466961_0060953_508_1062 176
73 3300044842 Ga0466957_0059313 Ga0466957_0059313_1046_1600 176
74 3300044901 Ga0466960_0055329 Ga0466960_0055329_336_890 176
75 3300046455 Ga0495603_0000545 Ga0495603_0000545_20159_20689 176
76 3300046459 Ga0495629_0000061 Ga0495629_0000061_37931_38461 176
77 3300046462 Ga0495651_0411841 Ga0495651_0411841_45_575 176
78 3300046463 Ga0495653_0147947 Ga0495653_0147947_839_1369 176
79 3300046471 Ga0495650_0000374 Ga0495650_0000374_15709_16239 176
80 3300046472 Ga0495580_0031518 Ga0495580_0031518_2520_3050 176
81 3300046473 Ga0495582_0107166 Ga0495582_0107166_315_845 176
82 3300046500 Ga0495596_0048130 Ga0495596_0048130_118_648 176
83 3300046506 Ga0495583_0044188 Ga0495583_0044188_423_953 176
84 3300046507 Ga0495606_0097341 Ga0495606_0097341_504_1034 176
85 3300046518 Ga0495631_0147959 Ga0495631_0147959_277_807 176
86 3300046528 Ga0495642_0006871 Ga0495642_0006871_985_1515 176
87 3300046529 Ga0495652_0430747 Ga0495652_0430747_164_694 176
88 3300046530 Ga0495654_0031625 Ga0495654_0031625_1930_2460 176
89 3300046531 Ga0495665_0137427 Ga0495665_0137427_704_1234 176
90 3300046543 Ga0495645_0002363 Ga0495645_0002363_1036_1566 176
91 3300046642 Ga0495634_0381902 Ga0495634_0381902_266_796 176
92 3300046680 Ga0495646_0089864 Ga0495646_0089864_196_726 176
93 3300046684 Ga0495669_0012531 Ga0495669_0012531_2072_2602 176
94 3300046689 Ga0495613_0087978 Ga0495613_0087978_214_744 176
95 3300046691 Ga0495670_0114065 Ga0495670_0114065_345_875 176
96 3300046692 Ga0495671_0080129 Ga0495671_0080129_672_1202 176
97 3300046794 Ga0495589_0253649 Ga0495589_0253649_274_804 176
98 3300047443 Ga0495687_011743 Ga0495687_011743_1372_1902 176
99 3300047444 Ga0495675_0352537 Ga0495675_0352537_170_700 176
100 3300047470 Ga0495681_0063494 Ga0495681_0063494_108_638 176
101 3300047673 Ga0495593_0037926 Ga0495593_0037926_703_1233 176
102 3300048089 Ga0495614_0024782 Ga0495614_0024782_989_1519 176
103 3300048903 Ga0496100_0227636 Ga0496100_0227636_71_601 176
104 3300048904 Ga0496101_0102345 Ga0496101_0102345_46_576 176
105 3300048907 Ga0496104_0123594 Ga0496104_0123594_31_588 176
106 3300048907 Ga0496104_0364958 Ga0496104_0364958_248_778 176
107 3300048913 Ga0496110_1180823 Ga0496110_1180823_109_639 176
108 3300048915 Ga0496112_0644483 Ga0496112_0644483_156_713 176
109 3300048917 Ga0496114_0001900 Ga0496114_0001900_11991_12521 176
110 3300048918 Ga0496115_0020550 Ga0496115_0020550_4303_4833 176
111 3300048919 Ga0496116_0194776 Ga0496116_0194776_349_903 176
112 3300048920 Ga0496117_0131802 Ga0496117_0131802_646_1203 176
113 3300048921 Ga0496118_0050922 Ga0496118_0050922_2018_2575 176
114 3300048921 Ga0496118_0145993 Ga0496118_0145993_19_573 176
115 3300048923 Ga0496120_0301978 Ga0496120_0301978_83_637 176
116 3300048924 Ga0496121_0046685 Ga0496121_0046685_2691_3248 176
117 3300048925 Ga0496122_0047929 Ga0496122_0047929_1997_2554 176
118 3300048928 Ga0496125_0053082 Ga0496125_0053082_2453_3010 176
119 3300003187 JGI25151J46595_10031075 JGI25151J46595_100310752 177
120 3300003751 Ga0055538_1000252 Ga0055538_100025218 177
121 3300005364 Ga0070673_100602921 Ga0070673_1006029212 177
122 3300005457 Ga0070662_100774620 Ga0070662_1007746202 177
123 3300005459 Ga0068867_101218919 Ga0068867_1012189191 177
124 3300005543 Ga0070672_100022714 Ga0070672_1000227142 177
125 3300005719 Ga0068861_100341394 Ga0068861_1003413943 177
126 3300005841 Ga0068863_100407409 Ga0068863_1004074093 177
127 3300006844 Ga0075428_100007145 Ga0075428_1000071457 177
128 3300009094 Ga0111539_10012350 Ga0111539_100123503 177
129 3300009174 Ga0105241_10053429 Ga0105241_100534294 177
130 3300009176 Ga0105242_10243110 Ga0105242_102431102 177
131 3300013297 Ga0157378_10088327 Ga0157378_100883275 177
132 3300013306 Ga0163162_10029660 Ga0163162_100296607 177
133 3300014326 Ga0157380_10150876 Ga0157380_101508762 177
134 3300017792 Ga0163161_10090260 Ga0163161_100902604 177
135 3300025224 Ga0209784_100121 Ga0209784_10012138 177
136 3300025294 Ga0209025_1001634 Ga0209025_100163414 177
137 3300025923 Ga0207681_10119281 Ga0207681_101192812 177
138 3300025933 Ga0207706_10016553 Ga0207706_100165532 177
139 3300025934 Ga0207686_10233007 Ga0207686_102330072 177
140 3300025940 Ga0207691_10067223 Ga0207691_100672233 177
141 3300025972 Ga0207668_10359085 Ga0207668_103590852 177
142 3300025981 Ga0207640_10482295 Ga0207640_104822952 177
143 3300026088 Ga0207641_10122291 Ga0207641_101222912 177
144 3300026118 Ga0207675_100924449 Ga0207675_1009244491 177
145 3300026118 Ga0207675_101120261 Ga0207675_1011202612 177
146 3300027907 Ga0207428_10015492 Ga0207428_100154927 177
147 3300046463 Ga0495653_0550268 Ga0495653_0550268_152_688 177
148 3300046499 Ga0495594_0156654 Ga0495594_0156654_45_599 177
149 3300048909 Ga0496106_0491580 Ga0496106_0491580_115_669 177
150 3300050511 nmdc:mga08y16_1957_c1 nmdc:mga08y16_1957_c1_2630_3184 177
151 3300005546 Ga0070696_100158644 Ga0070696_1001586442 178
152 3300030745 Ga0316182_1073515 Ga0316182_10735151 178
153 3300031995 Ga0307409_100263650 Ga0307409_1002636503 178
154 3300032126 Ga0307415_100107326 Ga0307415_1001073262 178
155 iso_pu_bacteria 2856287931 2856288215 178
156 iso_pu_bacteria 2857357740 2857360280 178
157 iso_pu_bacteria 2883087390 2883090696 178
158 iso_pu_bacteria 2919186247 2919186802 178
159 iso_pu_bacteria 2939664404 2939665929 178
160 3300005331 Ga0070670_100869891 Ga0070670_1008698911 179
161 3300009174 Ga0105241_10557287 Ga0105241_105572872 179
162 3300009545 Ga0105237_10031570 Ga0105237_100315705 179
163 3300025914 Ga0207671_10205540 Ga0207671_102055402 179
164 3300048920 Ga0496117_0000254 Ga0496117_0000254_7279_7857 179
165 3300048925 Ga0496122_0001780 Ga0496122_0001780_2077_2643 179
166 3300048926 Ga0496123_0013477 Ga0496123_0013477_3379_3945 179
167 iso_pu_bacteria 2501025501 2501073122 179
168 iso_pu_bacteria 2501025502 2501084820 179
169 iso_pu_bacteria 2501025504 2501412894 179
170 iso_pu_bacteria 2510917013 2511088769 179
171 iso_pu_bacteria 2510917014 2511100610 179
172 iso_pu_bacteria 2510917015 2511107682 179
173 iso_pu_bacteria 2513237082 2513557159 179
174 iso_pu_bacteria 2513237083 2513564806 179
175 iso_pu_bacteria 2515154189 2516021147 179
176 iso_pu_bacteria 8003955200 8003961329 179
177 iso_pu_bacteria 8039098773 8039103821 179
178 iso_pu_bacteria 8057345674 8057349630 179
179 3300005347 Ga0070668_100168507 Ga0070668_1001685072 180
180 3300006186 Ga0075369_10037307 Ga0075369_100373072 180
181 3300006847 Ga0075431_100383496 Ga0075431_1003834962 180
182 3300025972 Ga0207668_10070719 Ga0207668_100707192 180
183 3300046506 Ga0495583_0231009 Ga0495583_0231009_176_730 180
184 3300046512 Ga0495610_0023589 Ga0495610_0023589_1449_2000 180
185 3300046522 Ga0495643_0053921 Ga0495643_0053921_802_1356 180
186 3300047320 Ga0495672_0407332 Ga0495672_0407332_33_605 180
187 3300048919 Ga0496116_0042346 Ga0496116_0042346_1615_2181 180
188 3300048920 Ga0496117_0026296 Ga0496117_0026296_1414_1992 180
189 3300048924 Ga0496121_0037376 Ga0496121_0037376_2319_2873 180
190 3300048925 Ga0496122_0087988 Ga0496122_0087988_474_1052 180
191 3300048926 Ga0496123_0015265 Ga0496123_0015265_5156_5734 180
192 3300048927 Ga0496124_0047927 Ga0496124_0047927_1596_2174 180
193 3300048928 Ga0496125_0082303 Ga0496125_0082303_1631_2209 180
194 3300050510 nmdc:mga06r32_491243_c1 nmdc:mga06r32_491243_c1_507_1058 180
195 3300050516 nmdc:mga0sz30_56125_c1 nmdc:mga0sz30_56125_c1_518_1096 180
196 3300053122 Ga0500608_112223 Ga0500608_112223_408_962 180
197 3300053153 Ga0500616_0000079 Ga0500616_0000079_1988_2560 180
198 iso_pu_bacteria 2508501125 2509130662 180
199 iso_pu_bacteria 2510917030 2511199347 180
200 iso_pu_bacteria 2513237151 2513961780 180
201 iso_pu_bacteria 2526164713 2527078377 180
202 iso_pu_bacteria 2582581298 2585225320 180
203 iso_pu_bacteria 2585427529 2585547876 180
204 iso_pu_bacteria 2599185239 2599734545 180
205 iso_pu_bacteria 2599185240 2599747915 180
206 iso_pu_bacteria 2599185355 2600209934 180
207 iso_pu_bacteria 2675903129 2676741362 180
208 iso_pu_bacteria 2718217991 2719644175 180
209 iso_pu_bacteria 2738541296 2738823537 180
210 iso_pu_bacteria 2738541298 2738835928 180
211 iso_pu_bacteria 2738541306 2738877465 180
212 iso_pu_bacteria 2738543002 2739189171 180
213 iso_pu_bacteria 2738543008 2739224058 180
214 iso_pu_bacteria 2744054900 2746091544 180
215 iso_pu_bacteria 2744054901 2746099301 180
216 iso_pu_bacteria 2751185846 2753571126 180
217 iso_pu_bacteria 2818991450 2819624372 180
218 iso_pu_bacteria 2818991452 2819634349 180
219 iso_pu_bacteria 2842324504 2842330372 180
220 iso_pu_bacteria 2842348783 2842355011 180
221 iso_pu_bacteria 2842454564 2842460429 180
222 iso_pu_bacteria 2863421361 2863426831 180
223 iso_pu_bacteria 2870068957 2870075164 180
224 iso_pu_bacteria 2885270888 2885274855 180
225 iso_pu_bacteria 2900634093 2900641297 180
226 iso_pu_bacteria 2904483920 2904489766 180
227 iso_pu_bacteria 2904564687 2904570517 180
228 iso_pu_bacteria 2904571731 2904577694 180
229 iso_pu_bacteria 2919100787 2919106138 180
230 iso_pu_bacteria 2928108538 2928111690 180
231 iso_pu_bacteria 2928135762 2928138930 180
232 iso_pu_bacteria 2928157003 2928158958 180
233 iso_pu_bacteria 2928163908 2928167779 180
234 iso_pu_bacteria 2928170801 2928177425 180
235 iso_pu_bacteria 2928503688 2928509355 180
236 iso_pu_bacteria 2928536128 2928541894 180
237 iso_pu_bacteria 2945934425 2945939853 180
238 iso_pu_bacteria 2981990288 2981992339 180
239 iso_pu_bacteria 2990703756 2990706974 180
240 iso_pu_bacteria 641736151 642426647 180
241 iso_pu_bacteria 641736154 642420636 180
242 iso_pu_bacteria 642555113 642615962 180
243 iso_pu_bacteria 8018845410 8018846706 180
244 iso_pu_bacteria 8020938398 8020941731 180
245 iso_pu_bacteria 8020945358 8020949083 180
246 iso_pu_bacteria 8020953355 8020958794 180
247 iso_pu_bacteria 8021120328 8021121580 180
248 iso_pu_bacteria 8055266321 8055270414 180
249 iso_pu_bacteria 8055301274 8055306455 180
250 3300004800 Ga0058861_11200430 Ga0058861_112004302 181
251 3300004803 Ga0058862_12827803 Ga0058862_128278033 181
252 3300005336 Ga0070680_100081489 Ga0070680_1000814893 181
253 3300005458 Ga0070681_10101400 Ga0070681_101014002 181
254 3300006177 Ga0075362_10017922 Ga0075362_100179222 181
255 3300009036 Ga0105244_10000269 Ga0105244_1000026913 181
256 3300009147 Ga0114129_10152815 Ga0114129_101528152 181
257 3300009176 Ga0105242_11339692 Ga0105242_113396921 181
258 3300020069 Ga0197907_11185765 Ga0197907_111857652 181
259 3300020070 Ga0206356_11130835 Ga0206356_111308351 181
260 3300020077 Ga0206351_10791431 Ga0206351_107914311 181
261 3300025728 Ga0207655_1001542 Ga0207655_10015426 181
262 3300025912 Ga0207707_10103667 Ga0207707_101036672 181
263 3300025912 Ga0207707_10140846 Ga0207707_101408462 181
264 3300025921 Ga0207652_10021727 Ga0207652_100217274 181
265 3300030744 Ga0316181_1244883 Ga0316181_12448831 181
266 3300031247 Ga0265340_10077825 Ga0265340_100778252 181
267 3300031344 Ga0265316_10184774 Ga0265316_101847742 181
268 3300031711 Ga0265314_10217150 Ga0265314_102171502 181
269 3300035111 Ga0373923_0141176 Ga0373923_0141176_447_1025 181
270 3300035116 Ga0373945_0121277 Ga0373945_0121277_444_1022 181
271 3300035172 Ga0373955_0233798 Ga0373955_0233798_95_673 181
272 3300035724 Ga0373933_0502841 Ga0373933_0502841_89_667 181
273 3300037853 Ga0436364_1544520 Ga0436364_1544520_154_732 181
274 3300046472 Ga0495580_0511378 Ga0495580_0511378_148_726 181
275 3300049576 Ga0501040_0268398 Ga0501040_0268398_522_1097 181
276 3300049580 Ga0501046_0444872 Ga0501046_0444872_147_734 181
277 3300049586 Ga0501070_0243506 Ga0501070_0243506_787_1359 181
278 3300049741 Ga0501079_0094039 Ga0501079_0094039_1293_1874 181
279 3300049743 Ga0501081_0192203 Ga0501081_0192203_854_1441 181
280 3300050507 nmdc:mga05p37_886388_c1 nmdc:mga05p37_886388_c1_162_734 181
281 3300054114 Ga0501084_0133599 Ga0501084_0133599_537_1124 181
282 3300060353 Ga0501082_0393700 Ga0501082_0393700_24_611 181
283 3300003856 Ga0058692_1000139 Ga0058692_100013941 182
284 3300005436 Ga0070713_100972148 Ga0070713_1009721481 182
285 3300005445 Ga0070708_100671185 Ga0070708_1006711851 182
286 3300005985 Ga0081539_10020762 Ga0081539_100207623 182
287 3300025941 Ga0207711_10136814 Ga0207711_101368142 182
288 3300027312 Ga0209371_1000421 Ga0209371_100042113 182
289 3300030500 Ga0268256_1000360 Ga0268256_100036040 182
290 3300031824 Ga0307413_10159869 Ga0307413_101598692 182
291 3300031852 Ga0307410_10118072 Ga0307410_101180724 182
292 3300031852 Ga0307410_10457216 Ga0307410_104572161 182
293 3300031901 Ga0307406_10330059 Ga0307406_103300593 182
294 3300031995 Ga0307409_100256483 Ga0307409_1002564833 182
295 3300032002 Ga0307416_100347452 Ga0307416_1003474522 182
296 3300032004 Ga0307414_10093666 Ga0307414_100936662 182
297 3300032004 Ga0307414_10148292 Ga0307414_101482922 182
298 3300032005 Ga0307411_10354943 Ga0307411_103549432 182
299 3300039447 Ga0436361_0941473 Ga0436361_0941473_125_679 182
300 3300048927 Ga0496124_0000275 Ga0496124_0000275_45065_45613 182
301 3300003322 rootL2_10373663 rootL2_103736632 183
302 3300005338 Ga0068868_100422123 Ga0068868_1004221231 183
303 3300005365 Ga0070688_100902541 Ga0070688_1009025411 183
304 3300005471 Ga0070698_100637095 Ga0070698_1006370952 183
305 3300005617 Ga0068859_101904371 Ga0068859_1019043711 183
306 3300005618 Ga0068864_100732940 Ga0068864_1007329401 183
307 3300005842 Ga0068858_100434861 Ga0068858_1004348612 183
308 3300006931 Ga0097620_101904392 Ga0097620_1019043921 183
309 3300009094 Ga0111539_11453764 Ga0111539_114537641 183
310 3300011119 Ga0105246_10294864 Ga0105246_102948641 183
311 3300013308 Ga0157375_10204524 Ga0157375_102045243 183
312 3300013308 Ga0157375_11650080 Ga0157375_116500801 183
313 3300025936 Ga0207670_10306178 Ga0207670_103061781 183
314 3300025942 Ga0207689_10351290 Ga0207689_103512902 183
315 3300026023 Ga0207677_10340599 Ga0207677_103405991 183
316 3300026095 Ga0207676_10479600 Ga0207676_104796002 183
317 3300026121 Ga0207683_10349941 Ga0207683_103499412 183
318 3300028380 Ga0268265_11218629 Ga0268265_112186292 183
319 3300035695 Ga0373927_0653413 Ga0373927_0653413_19_630 183
320 3300001979 JGI24740J21852_10006615 JGI24740J21852_100066152 184
321 3300001989 JGI24739J22299_10007134 JGI24739J22299_100071346 184
322 3300001989 JGI24739J22299_10007865 JGI24739J22299_100078652 184
323 3300002067 JGI24735J21928_10009051 JGI24735J21928_100090512 184
324 3300002067 JGI24735J21928_10116847 JGI24735J21928_101168472 184
325 3300002067 JGI24735J21928_10133722 JGI24735J21928_101337221 184
326 3300002075 JGI24738J21930_10000325 JGI24738J21930_1000032510 184
327 3300002705 JGI25156J39149_1000268 JGI25156J39149_10002684 184
328 3300002705 JGI25156J39149_1000806 JGI25156J39149_100080614 184
329 3300002705 JGI25156J39149_1007208 JGI25156J39149_10072083 184
330 3300003214 JGI25165J46597_1000701 JGI25165J46597_10007011 184
331 3300003756 Ga0055533_1000091 Ga0055533_100009173 184
332 3300003756 Ga0055533_1007581 Ga0055533_10075812 184
333 3300003758 Ga0055532_1000045 Ga0055532_100004574 184
334 3300003760 Ga0055527_1000027 Ga0055527_100002774 184
335 3300003761 Ga0055535_1000033 Ga0055535_100003374 184
336 3300003762 Ga0055542_1000050 Ga0055542_100005074 184
337 3300003763 Ga0055529_1000061 Ga0055529_100006174 184
338 3300005367 Ga0070667_100215128 Ga0070667_1002151282 184
339 3300005455 Ga0070663_100505050 Ga0070663_1005050502 184
340 3300006195 Ga0075366_10411904 Ga0075366_104119042 184
341 3300006852 Ga0075433_10327920 Ga0075433_103279202 184
342 3300009011 Ga0105251_10000683 Ga0105251_1000068322 184
343 3300009551 Ga0105238_10252350 Ga0105238_102523502 184
344 3300013105 Ga0157369_10052820 Ga0157369_100528202 184
345 3300014497 Ga0182008_10017502 Ga0182008_100175025 184
346 3300015262 Ga0182007_10001199 Ga0182007_1000119910 184
347 3300025226 Ga0209674_100074 Ga0209674_10007474 184
348 3300025226 Ga0209674_100102 Ga0209674_10010269 184
349 3300025228 Ga0209672_100053 Ga0209672_10005374 184
350 3300025229 Ga0209147_100070 Ga0209147_10007074 184
351 3300025230 Ga0209563_100691 Ga0209563_1006918 184
352 3300025231 Ga0207427_103762 Ga0207427_1037624 184
353 3300025242 Ga0209258_100094 Ga0209258_10009474 184
354 3300025254 Ga0209148_1000100 Ga0209148_100010074 184
355 3300025256 Ga0209759_1000009 Ga0209759_100000974 184
356 3300025256 Ga0209759_1000036 Ga0209759_100003649 184
357 3300025256 Ga0209759_1000143 Ga0209759_100014384 184
358 3300025261 Ga0209233_1000144 Ga0209233_100014473 184
359 3300025272 Ga0209455_1000090 Ga0209455_100009074 184
360 3300025735 Ga0207713_1003522 Ga0207713_10035226 184
361 3300025904 Ga0207647_10016712 Ga0207647_100167125 184
362 3300025904 Ga0207647_10017989 Ga0207647_100179893 184
363 3300025904 Ga0207647_10165267 Ga0207647_101652671 184
364 3300025913 Ga0207695_10934132 Ga0207695_109341321 184
365 3300025924 Ga0207694_10368710 Ga0207694_103687102 184
366 3300026067 Ga0207678_10241666 Ga0207678_102416662 184
367 3300026142 Ga0207698_11015512 Ga0207698_110155122 184
368 3300028800 Ga0265338_10000058 Ga0265338_10000058157 184
369 3300031247 Ga0265340_10148371 Ga0265340_101483711 184
370 3300031911 Ga0307412_10000041 Ga0307412_1000004195 184
371 3300031911 Ga0307412_10316209 Ga0307412_103162092 184
372 3300046454 Ga0495592_0029413 Ga0495592_0029413_422_976 184
373 3300046454 Ga0495592_0074085 Ga0495592_0074085_397_951 184
374 3300046454 Ga0495592_0134578 Ga0495592_0134578_466_1020 184
375 3300046454 Ga0495592_0197333 Ga0495592_0197333_145_699 184
376 3300046455 Ga0495603_0010952 Ga0495603_0010952_1765_2319 184
377 3300046455 Ga0495603_0072607 Ga0495603_0072607_1291_1845 184
378 3300046455 Ga0495603_0123992 Ga0495603_0123992_143_697 184
379 3300046455 Ga0495603_0227178 Ga0495603_0227178_430_984 184
380 3300046457 Ga0495590_0015044 Ga0495590_0015044_2133_2687 184
381 3300046457 Ga0495590_0016739 Ga0495590_0016739_1055_1609 184
382 3300046458 Ga0495591_001885 Ga0495591_001885_8455_9009 184
383 3300046459 Ga0495629_0000090 Ga0495629_0000090_19558_20112 184
384 3300046459 Ga0495629_0002691 Ga0495629_0002691_6421_6975 184
385 3300046459 Ga0495629_0005335 Ga0495629_0005335_404_958 184
386 3300046459 Ga0495629_0015491 Ga0495629_0015491_676_1230 184
387 3300046460 Ga0495638_0011722 Ga0495638_0011722_576_1130 184
388 3300046461 Ga0495641_0109046 Ga0495641_0109046_535_1089 184
389 3300046462 Ga0495651_0032029 Ga0495651_0032029_1050_1613 184
390 3300046462 Ga0495651_0127898 Ga0495651_0127898_969_1523 184
391 3300046462 Ga0495651_0285777 Ga0495651_0285777_312_866 184
392 3300046463 Ga0495653_0000137 Ga0495653_0000137_29170_29724 184
393 3300046463 Ga0495653_0042603 Ga0495653_0042603_2430_2984 184
394 3300046463 Ga0495653_0049030 Ga0495653_0049030_2017_2571 184
395 3300046463 Ga0495653_0055825 Ga0495653_0055825_613_1167 184
396 3300046463 Ga0495653_0074242 Ga0495653_0074242_227_781 184
397 3300046471 Ga0495650_0005494 Ga0495650_0005494_5338_5892 184
398 3300046471 Ga0495650_0011621 Ga0495650_0011621_3523_4077 184
399 3300046471 Ga0495650_0016353 Ga0495650_0016353_1838_2392 184
400 3300046471 Ga0495650_0104794 Ga0495650_0104794_194_748 184
401 3300046472 Ga0495580_0000399 Ga0495580_0000399_11641_12195 184
402 3300046472 Ga0495580_0001516 Ga0495580_0001516_17239_17793 184
403 3300046472 Ga0495580_0003829 Ga0495580_0003829_20_574 184
404 3300046472 Ga0495580_0007048 Ga0495580_0007048_2121_2675 184
405 3300046472 Ga0495580_0064197 Ga0495580_0064197_1339_1893 184
406 3300046472 Ga0495580_0283719 Ga0495580_0283719_131_685 184
407 3300046472 Ga0495580_0557249 Ga0495580_0557249_108_662 184
408 3300046473 Ga0495582_0001828 Ga0495582_0001828_1765_2319 184
409 3300046473 Ga0495582_0007890 Ga0495582_0007890_1992_2546 184
410 3300046473 Ga0495582_0008579 Ga0495582_0008579_968_1522 184
411 3300046473 Ga0495582_0028456 Ga0495582_0028456_543_1097 184
412 3300046474 Ga0495605_0006065 Ga0495605_0006065_1269_1823 184
413 3300046474 Ga0495605_0028262 Ga0495605_0028262_112_666 184
414 3300046476 Ga0495662_0008733 Ga0495662_0008733_4215_4769 184
415 3300046476 Ga0495662_0024590 Ga0495662_0024590_1311_1865 184
416 3300046476 Ga0495662_0042229 Ga0495662_0042229_1215_1769 184
417 3300046477 Ga0495664_0010194 Ga0495664_0010194_4577_5131 184
418 3300046477 Ga0495664_0017290 Ga0495664_0017290_2690_3244 184
419 3300046477 Ga0495664_0033627 Ga0495664_0033627_99_653 184
420 3300046477 Ga0495664_0111922 Ga0495664_0111922_48_602 184
421 3300046500 Ga0495596_0002259 Ga0495596_0002259_8133_8687 184
422 3300046500 Ga0495596_0013187 Ga0495596_0013187_2928_3482 184
423 3300046500 Ga0495596_0068846 Ga0495596_0068846_758_1312 184
424 3300046507 Ga0495606_0176817 Ga0495606_0176817_88_642 184
425 3300046511 Ga0495608_0054093 Ga0495608_0054093_1550_2104 184
426 3300046511 Ga0495608_0116511 Ga0495608_0116511_339_893 184
427 3300046514 Ga0495618_0001699 Ga0495618_0001699_13817_14371 184
428 3300046515 Ga0495620_0057900 Ga0495620_0057900_919_1473 184
429 3300046516 Ga0495628_0002713 Ga0495628_0002713_12663_13217 184
430 3300046516 Ga0495628_0044710 Ga0495628_0044710_832_1386 184
431 3300046516 Ga0495628_0081186 Ga0495628_0081186_20_574 184
432 3300046516 Ga0495628_0090932 Ga0495628_0090932_967_1569 184
433 3300046516 Ga0495628_0445036 Ga0495628_0445036_85_639 184
434 3300046517 Ga0495630_0008234 Ga0495630_0008234_5819_6373 184
435 3300046517 Ga0495630_0060344 Ga0495630_0060344_419_973 184
436 3300046517 Ga0495630_0067558 Ga0495630_0067558_1569_2123 184
437 3300046517 Ga0495630_0069753 Ga0495630_0069753_1091_1645 184
438 3300046517 Ga0495630_0097572 Ga0495630_0097572_90_644 184
439 3300046522 Ga0495643_0192414 Ga0495643_0192414_292_846 184
440 3300046524 Ga0495648_0002524 Ga0495648_0002524_12443_12997 184
441 3300046524 Ga0495648_0011234 Ga0495648_0011234_3768_4322 184
442 3300046526 Ga0495666_0002715 Ga0495666_0002715_5448_6002 184
443 3300046526 Ga0495666_0007405 Ga0495666_0007405_2875_3429 184
444 3300046526 Ga0495666_0008867 Ga0495666_0008867_3397_3951 184
445 3300046526 Ga0495666_0054399 Ga0495666_0054399_1113_1667 184
446 3300046526 Ga0495666_0097418 Ga0495666_0097418_220_774 184
447 3300046528 Ga0495642_0102255 Ga0495642_0102255_81_635 184
448 3300046529 Ga0495652_0355337 Ga0495652_0355337_430_984 184
449 3300046529 Ga0495652_0360632 Ga0495652_0360632_150_704 184
450 3300046529 Ga0495652_0437933 Ga0495652_0437933_165_719 184
451 3300046531 Ga0495665_0004509 Ga0495665_0004509_4087_4641 184
452 3300046531 Ga0495665_0007971 Ga0495665_0007971_2960_3514 184
453 3300046531 Ga0495665_0013619 Ga0495665_0013619_216_770 184
454 3300046533 Ga0495640_0012947 Ga0495640_0012947_5683_6237 184
455 3300046533 Ga0495640_0070824 Ga0495640_0070824_980_1534 184
456 3300046533 Ga0495640_0080366 Ga0495640_0080366_725_1279 184
457 3300046535 Ga0495586_0015452 Ga0495586_0015452_1563_2117 184
458 3300046535 Ga0495586_0139775 Ga0495586_0139775_705_1259 184
459 3300046536 Ga0495587_0007500 Ga0495587_0007500_2829_3383 184
460 3300046536 Ga0495587_0008174 Ga0495587_0008174_5788_6342 184
461 3300046538 Ga0495609_0016409 Ga0495609_0016409_90_644 184
462 3300046543 Ga0495645_0009186 Ga0495645_0009186_6204_6758 184
463 3300046557 Ga0495622_0003296 Ga0495622_0003296_2701_3255 184
464 3300046559 Ga0495667_0031383 Ga0495667_0031383_1978_2532 184
465 3300046642 Ga0495634_0012286 Ga0495634_0012286_455_1009 184
466 3300046642 Ga0495634_0015132 Ga0495634_0015132_809_1363 184
467 3300046642 Ga0495634_0015698 Ga0495634_0015698_807_1361 184
468 3300046648 Ga0495611_0027740 Ga0495611_0027740_1572_2126 184
469 3300046648 Ga0495611_0298198 Ga0495611_0298198_152_706 184
470 3300046660 Ga0495625_0050666 Ga0495625_0050666_115_669 184
471 3300046660 Ga0495625_0225209 Ga0495625_0225209_201_755 184
472 3300046663 Ga0495635_0007375 Ga0495635_0007375_4112_4666 184
473 3300046663 Ga0495635_0029430 Ga0495635_0029430_1633_2187 184
474 3300046665 Ga0495661_0012011 Ga0495661_0012011_2374_2928 184
475 3300046665 Ga0495661_0154210 Ga0495661_0154210_203_757 184
476 3300046674 Ga0495588_0072219 Ga0495588_0072219_167_721 184
477 3300046675 Ga0495657_0137947 Ga0495657_0137947_559_1113 184
478 3300046678 Ga0495599_0023487 Ga0495599_0023487_419_973 184
479 3300046678 Ga0495599_0049478 Ga0495599_0049478_229_783 184
480 3300046679 Ga0495623_0003385 Ga0495623_0003385_1289_1852 184
481 3300046679 Ga0495623_0006011 Ga0495623_0006011_5548_6102 184
482 3300046679 Ga0495623_0017147 Ga0495623_0017147_3176_3730 184
483 3300046679 Ga0495623_0096302 Ga0495623_0096302_195_749 184
484 3300046679 Ga0495623_0124068 Ga0495623_0124068_53_607 184
485 3300046680 Ga0495646_0002486 Ga0495646_0002486_8817_9371 184
486 3300046680 Ga0495646_0007426 Ga0495646_0007426_3568_4122 184
487 3300046680 Ga0495646_0041094 Ga0495646_0041094_1171_1725 184
488 3300046680 Ga0495646_0051918 Ga0495646_0051918_420_974 184
489 3300046680 Ga0495646_0260082 Ga0495646_0260082_39_593 184
490 3300046684 Ga0495669_0366841 Ga0495669_0366841_82_636 184
491 3300046689 Ga0495613_0015113 Ga0495613_0015113_3117_3671 184
492 3300046689 Ga0495613_0270885 Ga0495613_0270885_199_753 184
493 3300046690 Ga0495624_0001954 Ga0495624_0001954_3690_4244 184
494 3300046690 Ga0495624_0002906 Ga0495624_0002906_6233_6787 184
495 3300046690 Ga0495624_0036200 Ga0495624_0036200_1702_2256 184
496 3300046690 Ga0495624_0064311 Ga0495624_0064311_125_679 184
497 3300046692 Ga0495671_0112082 Ga0495671_0112082_163_717 184
498 3300046692 Ga0495671_0219859 Ga0495671_0219859_55_609 184
499 3300046694 Ga0495649_0015997 Ga0495649_0015997_1345_1899 184
500 3300046694 Ga0495649_0025996 Ga0495649_0025996_946_1500 184
501 3300046794 Ga0495589_0061757 Ga0495589_0061757_57_611 184
502 3300046794 Ga0495589_0065606 Ga0495589_0065606_848_1402 184
503 3300046809 Ga0495600_0027105 Ga0495600_0027105_2397_2951 184
504 3300046809 Ga0495600_0058450 Ga0495600_0058450_1229_1783 184
505 3300047315 Ga0495581_0006415 Ga0495581_0006415_410_964 184
506 3300047315 Ga0495581_0008365 Ga0495581_0008365_1393_1947 184
507 3300047315 Ga0495581_0125202 Ga0495581_0125202_700_1254 184
508 3300047317 Ga0495604_0006883 Ga0495604_0006883_3407_3961 184
509 3300047317 Ga0495604_0011173 Ga0495604_0011173_4866_5429 184
510 3300047317 Ga0495604_0047585 Ga0495604_0047585_1577_2131 184
511 3300047317 Ga0495604_0147055 Ga0495604_0147055_39_593 184
512 3300047317 Ga0495604_0401122 Ga0495604_0401122_90_644 184
513 3300047317 Ga0495604_0404563 Ga0495604_0404563_112_666 184
514 3300047319 Ga0495674_0005420 Ga0495674_0005420_2516_3070 184
515 3300047319 Ga0495674_0304743 Ga0495674_0304743_20_574 184
516 3300047320 Ga0495672_0052833 Ga0495672_0052833_235_789 184
517 3300047321 Ga0495676_0010656 Ga0495676_0010656_3478_4032 184
518 3300047321 Ga0495676_0028717 Ga0495676_0028717_308_862 184
519 3300047321 Ga0495676_0059310 Ga0495676_0059310_1209_1763 184
520 3300047321 Ga0495676_0153261 Ga0495676_0153261_303_857 184
521 3300047322 Ga0495680_0182359 Ga0495680_0182359_39_593 184
522 3300047322 Ga0495680_0210916 Ga0495680_0210916_682_1236 184
523 3300047322 Ga0495680_0497986 Ga0495680_0497986_77_640 184
524 3300047322 Ga0495680_0756867 Ga0495680_0756867_55_609 184
525 3300047323 Ga0495683_0007609 Ga0495683_0007609_2547_3101 184
526 3300047323 Ga0495683_0011002 Ga0495683_0011002_1228_1782 184
527 3300047323 Ga0495683_0015440 Ga0495683_0015440_784_1338 184
528 3300047443 Ga0495687_013687 Ga0495687_013687_1086_1640 184
529 3300047444 Ga0495675_0006688 Ga0495675_0006688_1879_2433 184
530 3300047444 Ga0495675_0012339 Ga0495675_0012339_3962_4525 184
531 3300047444 Ga0495675_0050322 Ga0495675_0050322_1039_1641 184
532 3300047444 Ga0495675_0184382 Ga0495675_0184382_420_974 184
533 3300047446 Ga0495679_000026 Ga0495679_000026_104615_105169 184
534 3300047446 Ga0495679_000708 Ga0495679_000708_2805_3359 184
535 3300047446 Ga0495679_002155 Ga0495679_002155_5497_6051 184
536 3300047446 Ga0495679_016721 Ga0495679_016721_1298_1852 184
537 3300047469 Ga0495673_0003485 Ga0495673_0003485_5377_5931 184
538 3300047471 Ga0495684_0030195 Ga0495684_0030195_2588_3142 184
539 3300047471 Ga0495684_0208803 Ga0495684_0208803_401_955 184
540 3300047472 Ga0495686_0312085 Ga0495686_0312085_229_783 184
541 3300047673 Ga0495593_0001493 Ga0495593_0001493_11087_11641 184
542 3300047673 Ga0495593_0003020 Ga0495593_0003020_6331_6885 184
543 3300047673 Ga0495593_0015460 Ga0495593_0015460_3192_3746 184
544 3300047673 Ga0495593_0176960 Ga0495593_0176960_272_826 184
545 3300048088 Ga0495602_0001347 Ga0495602_0001347_13904_14458 184
546 3300048088 Ga0495602_0125765 Ga0495602_0125765_489_1043 184
547 3300048088 Ga0495602_0282669 Ga0495602_0282669_639_1193 184
548 3300048088 Ga0495602_0306362 Ga0495602_0306362_79_642 184
549 3300048088 Ga0495602_0349435 Ga0495602_0349435_211_765 184
550 3300048089 Ga0495614_0001197 Ga0495614_0001197_2643_3197 184
551 3300048089 Ga0495614_0063661 Ga0495614_0063661_780_1334 184
552 3300048089 Ga0495614_0209585 Ga0495614_0209585_166_720 184
553 3300048091 Ga0495626_0040058 Ga0495626_0040058_1478_2032 184
554 3300048905 Ga0496102_0021246 Ga0496102_0021246_1562_2116 184
555 3300048906 Ga0496103_0004217 Ga0496103_0004217_2065_2619 184
556 3300048906 Ga0496103_0471881 Ga0496103_0471881_240_794 184
557 3300048916 Ga0496113_1175747 Ga0496113_1175747_17_571 184
558 3300048919 Ga0496116_0086167 Ga0496116_0086167_76_630 184
559 3300048919 Ga0496116_0163263 Ga0496116_0163263_16_570 184
560 3300048920 Ga0496117_0009122 Ga0496117_0009122_581_1135 184
561 3300048920 Ga0496117_0011464 Ga0496117_0011464_4726_5280 184
562 3300048920 Ga0496117_0099255 Ga0496117_0099255_373_927 184
563 3300048921 Ga0496118_0000820 Ga0496118_0000820_29099_29653 184
564 3300048921 Ga0496118_0001936 Ga0496118_0001936_10353_10907 184
565 3300048921 Ga0496118_0009709 Ga0496118_0009709_3013_3567 184
566 3300048921 Ga0496118_0012350 Ga0496118_0012350_7405_7959 184
567 3300048924 Ga0496121_0029862 Ga0496121_0029862_2228_2782 184
568 3300048929 Ga0496126_0000698 Ga0496126_0000698_15634_16188 184
569 3300048929 Ga0496126_0008500 Ga0496126_0008500_9696_10250 184
570 3300049459 Ga0495678_051660 Ga0495678_051660_898_1452 184
571 3300049460 Ga0495682_0029750 Ga0495682_0029750_915_1469 184
572 3300049460 Ga0495682_0032056 Ga0495682_0032056_807_1361 184
573 3300053083 Ga0495655_0054634 Ga0495655_0054634_437_991 184
574 iso_pu_bacteria 2919527303 2919532832 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06475

Glycolipid_bind

Putative glycolipid-binding

28

211

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1t-assembly1.cif.gz_B crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution 0.9164 15 180
6s5l-assembly1.cif.gz_D anabaena apo-c-terminal domain homolog of the orange carotenoid protein in native conditions 0.7539 17 62
6s5l-assembly1.cif.gz_I anabaena apo-c-terminal domain homolog of the orange carotenoid protein in native conditions 0.6633 17 66
5kpe-assembly1.cif.gz_A solution nmr structure of denovo beta sheet design protein, northeast structural genomics consortium (nesg) target or664 0.637 4 51
5wlw-assembly1.cif.gz_H crystal structure of the human mitochondrial cysteine desulfurase with active cysteine loop within iscu1 active site, coordinating zn ion. complexed with human isd11 and e. coli acp1 at 3.3a. 0.6353 31 65
ID Description Score Start End Superfamily
3ke7A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8491 17 50 3.10.450.50
af_P9WM93_4_131_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6976 10 51 3.10.450.50
af_Q1JUZ1_228_427_3.90.380.10 Alpha Beta;Alpha-Beta Complex;Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1;Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 0.6689 11 70 3.90.380.10
1srqA01 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.6632 1 50 3.30.1120.160
af_I1M0K3_150_241_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6615 6 52 3.10.450.10
ID Description Score Start End GO Terms
AF-A0A0Q5PIU4-F1-model_v4 Transcriptional regulator 0.9932 1 181
AF-A0A2A4EMG7-F1-model_v4 Transcriptional regulator 0.9929 1 184
AF-A0A7X3J452-F1-model_v4 deleted 0.9908 1 184
AF-C4APT3-F1-model_v4 deleted 0.9885 1 180
AF-A0A0E1VV87-F1-model_v4 Transcriptional regulator 0.9882 1 180

Feature Viewer

pLDDT pTM Quality
95.61 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map