F465218

General Info

Members Datasets Scaffolds Average Seq Length
573 440 1146 188

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0178960|Ga0466963_0178960_149_856
Length 235
Sequence VRIPAPESEGLADLSGPPPLTALAPALRFGNRGLLSREKMMSAHESMEQADHAKEAAGENMKIALLIAVIALFLALSETLGKGAQTESISKNVEASNLWAFFQAKSIRRTVVQTAAEQSKLGLGSVGDDAKAALQKQIDDWQKTASRYRSEPETGEGTEQLSERAKHAEEERDLATAKYHHFELASAAFQIAIVLASATIITGMIALAWISGLLTLVGIAFTALGLFSPHLLHLP

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
48 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
49 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
50 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
111 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
112 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
113 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
119 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
229 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
230 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
232 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
239 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
240 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
243 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
244 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
245 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
246 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
247 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
248 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
249 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
250 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
251 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
252 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
253 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
254 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
255 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
256 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
257 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
258 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
259 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
260 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
261 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
262 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
263 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
264 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
265 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
266 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
267 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
268 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
269 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
270 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
271 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
272 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
273 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
274 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
275 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
276 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
277 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
278 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
279 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
280 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
281 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
282 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
283 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
284 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
285 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
286 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
287 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
288 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
289 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
290 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
291 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
292 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
293 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
294 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
295 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
296 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
297 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
298 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
299 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
300 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
301 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
302 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
303 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
304 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
305 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
306 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
307 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
308 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
309 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
310 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
311 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
312 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
313 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
314 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
315 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
316 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
317 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
318 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
319 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
320 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
321 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
322 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
323 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
324 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
325 2904699407
326 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
327 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
328 2906610324
329 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
330 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
331 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
332 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
333 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
334 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
335 2922368715
336 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
337 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
338 2922425934
339 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
340 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
341 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
342 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
343 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
344 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
345 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
346 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
347 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
348 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
349 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
350 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
351 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
352 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
353 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
354 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
355 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
356 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
357 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
358 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
359 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
360 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
361 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
362 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
363 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
364 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
365 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
366 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
367 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
368 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
369 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
370 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
371 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
372 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
373 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
374 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
375 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
376 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
377 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
378 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
379 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
380 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
381 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
382 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
383 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
384 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
385 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
386 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
387 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
388 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
389 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
390 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
391 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
392 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
393 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
394 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
395 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
396 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
397 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
398 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
399 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
400 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
401 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
402 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
403 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
404 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
405 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
406 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
407 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
408 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
409 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
410 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
411 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
412 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
413 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
414 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
415 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
416 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
417 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
418 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
419 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
420 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
421 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
422 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
423 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
424 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
425 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
426 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
427 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
428 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
429 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
430 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
431 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
432 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
433 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
434 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
435 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
436 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
437 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
438 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
439 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
440 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.31
Metatranscriptomes 0
Isolates 32.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.65
Nodule 28.62
Rhizoplane 8.2
Rhizosphere 40.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0178960 3300044694 Bacteria 1480
2 JGI25153J46596_10005387 3300003215 Bacteria 6720
3 rootH2_10097850 3300003320 Bacteria 1440
4 JGI25160J50197_1002041 3300003354 Bacteria 9623
5 JGI25160J50197_1004384 3300003354 Bacteria 6116
6 JGI25160J50197_1005378 3300003354 Bacteria 5340
7 JGI25404J52841_10000873 3300003659 Bacteria 4879
8 Ga0065165_1003775 3300005262 Bacteria 10150
9 Ga0070683_100006653 3300005329 Bacteria 9707
10 Ga0070666_10203302 3300005335 Bacteria 1394
11 Ga0070680_100277401 3300005336 Bacteria 1420
12 Ga0070682_100920713 3300005337 Bacteria 720
13 Ga0070682_101037889 3300005337 Bacteria 683
14 Ga0068868_100162758 3300005338 Bacteria 1844
15 Ga0070660_100256322 3300005339 Bacteria 1427
16 Ga0070689_100600695 3300005340 Bacteria 953
17 Ga0070668_100091590 3300005347 Bacteria 2397
18 Ga0070671_100558298 3300005355 Bacteria 988
19 Ga0070674_101067641 3300005356 Bacteria 712
20 Ga0070709_10000164 3300005434 Bacteria 42124
21 Ga0070709_10045120 3300005434 Bacteria 2734
22 Ga0070709_10165868 3300005434 Bacteria 1539
23 Ga0070714_100047913 3300005435 Bacteria 3633
24 Ga0070714_100116517 3300005435 Bacteria 2372
25 Ga0070714_100331209 3300005435 Bacteria 1426
26 Ga0070713_100004014 3300005436 Bacteria 9799
27 Ga0070713_100094561 3300005436 Bacteria 2577
28 Ga0070713_100223232 3300005436 Bacteria 1710
29 Ga0070710_10000283 3300005437 Bacteria 24031
30 Ga0070710_10136772 3300005437 Bacteria 1499
31 Ga0070711_100005189 3300005439 Bacteria 7768
32 Ga0070711_100015539 3300005439 Bacteria 4818
33 Ga0070711_100119132 3300005439 Bacteria 1949
34 Ga0070678_100075747 3300005456 Bacteria 2532
35 Ga0070681_10099168 3300005458 Bacteria 2859
36 Ga0068867_100489228 3300005459 Bacteria 1055
37 Ga0070679_100276366 3300005530 Bacteria 1633
38 Ga0070684_100237377 3300005535 Bacteria 1665
39 Ga0068853_100234249 3300005539 Bacteria 1681
40 Ga0070665_100138662 3300005548 Bacteria 2435
41 Ga0068854_100740671 3300005578 Bacteria 852
42 Ga0068856_100480794 3300005614 Bacteria 1263
43 Ga0068852_100056770 3300005616 Bacteria 3385
44 Ga0068852_100167042 3300005616 Bacteria 2059
45 Ga0068864_100089273 3300005618 Bacteria 2715
46 Ga0068866_10191690 3300005718 Bacteria 1215
47 Ga0068851_10139230 3300005834 Bacteria 1319
48 Ga0068858_100058976 3300005842 Bacteria 3547
49 Ga0068862_100388081 3300005844 Bacteria 1304
50 Ga0081455_10016293 3300005937 Bacteria 7181
51 Ga0081540_1002717 3300005983 Bacteria 14394
52 Ga0081540_1004583 3300005983 Bacteria 10468
53 Ga0081540_1018204 3300005983 Bacteria 4319
54 Ga0081540_1057661 3300005983 Bacteria 1877
55 Ga0081540_1116141 3300005983 Bacteria 1120
56 Ga0081540_1118322 3300005983 Bacteria 1105
57 Ga0070717_10020018 3300006028 Bacteria 5257
58 Ga0070717_10490423 3300006028 Bacteria 1110
59 Ga0075365_10096010 3300006038 Bacteria 2025
60 Ga0075365_10461809 3300006038 Bacteria 897
61 Ga0075368_10014493 3300006042 Bacteria 2913
62 Ga0070716_100117043 3300006173 Bacteria 1662
63 Ga0070716_100708476 3300006173 Bacteria 770
64 Ga0070712_100014272 3300006175 Bacteria 5101
65 Ga0070712_100026701 3300006175 Bacteria 3850
66 Ga0070712_100057309 3300006175 Bacteria 2736
67 Ga0075369_10018025 3300006186 Bacteria 2870
68 Ga0068871_100935514 3300006358 Bacteria 805
69 Ga0068865_100295935 3300006881 Bacteria 1293
70 Ga0099825_1034360 3300006941 Bacteria 1892
71 Ga0099824_1007180 3300006942 Bacteria 14887
72 Ga0099824_1015237 3300006942 Bacteria 7359
73 Ga0099822_1002271 3300006943 Bacteria 23789
74 Ga0099822_1035053 3300006943 Bacteria 3285
75 Ga0099823_1054766 3300006944 Bacteria 2288
76 Ga0105240_10020094 3300009093 Bacteria 8915
77 Ga0105240_10178027 3300009093 Bacteria 2512
78 Ga0105240_10226073 3300009093 Bacteria 2177
79 Ga0105240_10686841 3300009093 Bacteria 1119
80 Ga0105247_10065056 3300009101 Bacteria 2267
81 Ga0105247_10357062 3300009101 Bacteria 1029
82 Ga0105247_10632666 3300009101 Bacteria 797
83 Ga0105243_10612895 3300009148 Bacteria 1049
84 Ga0105242_10215683 3300009176 Bacteria 1712
85 Ga0105248_10220918 3300009177 Bacteria 2133
86 Ga0105248_11170674 3300009177 Bacteria 869
87 Ga0105237_10103084 3300009545 Bacteria 2845
88 Ga0105237_10217065 3300009545 Bacteria 1912
89 Ga0105237_10228065 3300009545 Bacteria 1863
90 Ga0105237_10489764 3300009545 Bacteria 1236
91 Ga0105238_10063955 3300009551 Bacteria 3680
92 Ga0105238_10149775 3300009551 Bacteria 2308
93 Ga0105238_10194243 3300009551 Bacteria 2005
94 Ga0105249_10432199 3300009553 Bacteria 1352
95 Ga0105239_10049028 3300010375 Bacteria 4630
96 Ga0105239_10456755 3300010375 Bacteria 1450
97 Ga0105246_10460358 3300011119 Bacteria 1071
98 Ga0157370_10074997 3300013104 Bacteria 3190
99 Ga0157370_10222534 3300013104 Bacteria 1748
100 Ga0157369_10030438 3300013105 Bacteria 5952
101 Ga0157372_10406519 3300013307 Bacteria 1586
102 Ga0157375_10064037 3300013308 Bacteria 3660
103 Ga0157376_10267044 3300014969 Bacteria 1605
104 Ga0213876_10049695 3300021384 Bacteria 2216
105 Ga0213876_10282693 3300021384 Bacteria 882
106 Ga0213876_10335999 3300021384 Bacteria 803
107 Ga0213871_10058021 3300021441 Bacteria 1073
108 Ga0209563_105793 3300025230 Bacteria 2196
109 Ga0209677_105710 3300025253 Bacteria 3168
110 Ga0209148_1000295 3300025254 Bacteria 73660
111 Ga0209233_1003058 3300025261 Bacteria 5951
112 Ga0209233_1015657 3300025261 Bacteria 2107
113 Ga0207666_1007885 3300025271 Bacteria 1412
114 Ga0209564_1007238 3300025295 Bacteria 5772
115 Ga0209758_1001816 3300025297 Bacteria 23562
116 Ga0209758_1006696 3300025297 Bacteria 8127
117 Ga0209758_1040405 3300025297 Bacteria 1760
118 Ga0209758_1041471 3300025297 Bacteria 1720
119 Ga0207426_1001802 3300025302 Bacteria 15949
120 Ga0207426_1004864 3300025302 Bacteria 6361
121 Ga0207426_1019865 3300025302 Bacteria 2342
122 Ga0207692_10000528 3300025898 Bacteria 13562
123 Ga0207642_10577206 3300025899 Bacteria 697
124 Ga0207710_10038355 3300025900 Bacteria 2118
125 Ga0207710_10214296 3300025900 Bacteria 954
126 Ga0207688_10666219 3300025901 Bacteria 657
127 Ga0207680_10242696 3300025903 Bacteria 1242
128 Ga0207647_10085645 3300025904 Bacteria 1884
129 Ga0207647_10232368 3300025904 Bacteria 1061
130 Ga0207699_10000514 3300025906 Bacteria 19239
131 Ga0207699_10017607 3300025906 Bacteria 3767
132 Ga0207705_10914944 3300025909 Bacteria 679
133 Ga0207654_10038547 3300025911 Bacteria 2682
134 Ga0207707_10032670 3300025912 Bacteria 4555
135 Ga0207695_10000148 3300025913 Bacteria 208344
136 Ga0207671_10011888 3300025914 Bacteria 7041
137 Ga0207671_10645609 3300025914 Bacteria 843
138 Ga0207693_10008295 3300025915 Bacteria 8507
139 Ga0207693_10011107 3300025915 Bacteria 7295
140 Ga0207693_11066727 3300025915 Bacteria 615
141 Ga0207663_10008467 3300025916 Bacteria 5379
142 Ga0207663_10213574 3300025916 Bacteria 1400
143 Ga0207657_10238781 3300025919 Bacteria 1451
144 Ga0207652_10093847 3300025921 Bacteria 2641
145 Ga0207694_10139523 3300025924 Bacteria 1949
146 Ga0207694_10410697 3300025924 Bacteria 1127
147 Ga0207700_10004601 3300025928 Bacteria 8166
148 Ga0207700_10046786 3300025928 Bacteria 3202
149 Ga0207700_10199819 3300025928 Bacteria 1684
150 Ga0207700_10240085 3300025928 Bacteria 1544
151 Ga0207664_10040008 3300025929 Bacteria 3642
152 Ga0207664_10198528 3300025929 Bacteria 1730
153 Ga0207644_10503651 3300025931 Bacteria 999
154 Ga0207670_10814168 3300025936 Bacteria 779
155 Ga0207665_10023947 3300025939 Bacteria 4023
156 Ga0207665_10233865 3300025939 Bacteria 1352
157 Ga0207711_10253566 3300025941 Bacteria 1616
158 Ga0207679_10633380 3300025945 Bacteria 966
159 Ga0207679_10682242 3300025945 Bacteria 931
160 Ga0207668_10409906 3300025972 Bacteria 1148
161 Ga0207668_10521273 3300025972 Bacteria 1025
162 Ga0207658_10539597 3300025986 Bacteria 1043
163 Ga0207703_11336042 3300026035 Bacteria 689
164 Ga0207639_10217951 3300026041 Bacteria 1647
165 Ga0207639_10680473 3300026041 Bacteria 953
166 Ga0207678_10110740 3300026067 Bacteria 2342
167 Ga0207702_10826032 3300026078 Bacteria 917
168 Ga0207702_10842948 3300026078 Bacteria 907
169 Ga0207648_10556432 3300026089 Bacteria 1054
170 Ga0207676_10521881 3300026095 Bacteria 1131
171 Ga0207683_10036053 3300026121 Bacteria 4304
172 Ga0207683_11455986 3300026121 Bacteria 633
173 Ga0207698_10031723 3300026142 Bacteria 3818
174 Ga0209389_1000102 3300027296 Bacteria 78475
175 Ga0209389_1000142 3300027296 Bacteria 62072
176 Ga0209589_1000035 3300027357 Bacteria 134091
177 Ga0209589_1000331 3300027357 Bacteria 62072
178 Ga0209489_100079 3300027361 Bacteria 134091
179 Ga0209489_100404 3300027361 Bacteria 78473
180 Ga0209489_100818 3300027361 Bacteria 62070
181 Ga0209700_100077 3300027363 Bacteria 134091
182 Ga0209700_100408 3300027363 Bacteria 78496
183 Ga0265340_10001849 3300031247 Bacteria 12084
184 Ga0265331_10178936 3300031250 Bacteria 958
185 Ga0265316_10096416 3300031344 Bacteria 2252
186 Ga0307508_10000045 3300031616 Bacteria 142824
187 Ga0307508_10074036 3300031616 Bacteria 2982
188 Ga0307508_10230876 3300031616 Bacteria 1449
189 Ga0315911_1000008 3300033442 Bacteria 381285
190 Ga0373929_0012637 3300035085 Bacteria 1607
191 Ga0373949_0025395 3300035090 Bacteria 1382
192 Ga0373951_0072467 3300035091 Bacteria 880
193 Ga0373952_0005949 3300035092 Bacteria 2244
194 Ga0373932_0035873 3300035112 Bacteria 1405
195 Ga0373932_0166772 3300035112 Bacteria 765
196 Ga0373943_0111820 3300035170 Bacteria 1442
197 Ga0373931_0213042 3300035691 Bacteria 1159
198 Ga0373935_0295801 3300035692 Bacteria 1143
199 Ga0373927_0011298 3300035695 Bacteria 5943
200 Ga0373927_0018485 3300035695 Bacteria 4580
201 Ga0373925_0054700 3300037068 Bacteria 2986
202 Ga0395900_0084739 3300037418 Bacteria 3257
203 Ga0395900_0404790 3300037418 Bacteria 1328
204 Ga0395900_0519377 3300037418 Bacteria 1139
205 Ga0395898_0058696 3300037466 Bacteria 3745
206 Ga0395905_0143901 3300037471 Bacteria 2243
207 Ga0395905_0297353 3300037471 Bacteria 1501
208 Ga0436364_1117557 3300037853 Bacteria 1638
209 Ga0395901_0933928 3300038443 Bacteria 847
210 Ga0436365_0073154 3300039437 Bacteria 1584
211 Ga0436360_1105421 3300039438 Bacteria 1926
212 Ga0436363_0665510 3300039450 Bacteria 946
213 Ga0436362_0502235 3300039453 Bacteria 681
214 Ga0451793_0226756 3300041452 Bacteria 771
215 Ga0451798_0502518 3300041458 Bacteria 898
216 Ga0451807_1271182 3300041486 Bacteria 805
217 Ga0451833_0279353 3300041491 Bacteria 971
218 Ga0451841_0583394 3300041498 Bacteria 1263
219 Ga0451845_0176529 3300041501 Bacteria 740
220 Ga0466969_0011225 3300044656 Bacteria 4742
221 Ga0466972_0000941 3300044658 Bacteria 14002
222 Ga0466965_0090170 3300044683 Bacteria 1559
223 Ga0466966_0000628 3300044684 Bacteria 22447
224 Ga0466966_0314526 3300044684 Bacteria 941
225 Ga0466961_0002516 3300044693 Bacteria 11373
226 Ga0466964_0256771 3300044706 Bacteria 864
227 Ga0466971_0197367 3300044719 Bacteria 949
228 Ga0466968_0209786 3300044735 Bacteria 915
229 Ga0466957_0106616 3300044842 Bacteria 1772
230 Ga0466960_0317419 3300044901 Bacteria 882
231 Ga0466959_0012945 3300045049 Bacteria 6039
232 Ga0466959_0033457 3300045049 Bacteria 3801
233 Ga0466959_0202845 3300045049 Bacteria 1380
234 Ga0466958_0090935 3300045836 Bacteria 1889
235 Ga0466958_0766954 3300045836 Bacteria 629
236 Ga0466967_0109357 3300045976 Bacteria 2538
237 Ga0466967_0177414 3300045976 Bacteria 2007
238 Ga0495617_035848 3300046452 Bacteria 1665
239 Ga0495592_0381480 3300046454 Bacteria 897
240 Ga0495629_0003103 3300046459 Bacteria 12597
241 Ga0495650_0023619 3300046471 Bacteria 2924
242 Ga0495664_0012780 3300046477 Bacteria 4756
243 Ga0495664_0040124 3300046477 Bacteria 2767
244 Ga0495664_0063086 3300046477 Bacteria 2208
245 Ga0495664_0068890 3300046477 Bacteria 2112
246 Ga0495596_0035053 3300046500 Bacteria 1991
247 Ga0495630_0867985 3300046517 Bacteria 688
248 Ga0495652_0486975 3300046529 Bacteria 857
249 Ga0495645_0042168 3300046543 Bacteria 3327
250 Ga0495645_0046951 3300046543 Bacteria 3147
251 Ga0495622_0031861 3300046557 Bacteria 2462
252 Ga0495667_0137243 3300046559 Bacteria 1576
253 Ga0495667_0193260 3300046559 Bacteria 1304
254 Ga0495625_0461193 3300046660 Bacteria 783
255 Ga0495635_0669158 3300046663 Bacteria 675
256 Ga0495588_0008571 3300046674 Bacteria 4696
257 Ga0495657_0005477 3300046675 Bacteria 10046
258 Ga0495657_0030643 3300046675 Bacteria 3765
259 Ga0495657_0217081 3300046675 Bacteria 1161
260 Ga0495623_0102865 3300046679 Bacteria 1739
261 Ga0495671_0227661 3300046692 Bacteria 902
262 Ga0495600_0051863 3300046809 Bacteria 2678
263 Ga0495581_0022999 3300047315 Bacteria 3611
264 Ga0495604_0294217 3300047317 Bacteria 1092
265 Ga0495674_0293391 3300047319 Bacteria 1329
266 Ga0495674_1096323 3300047319 Bacteria 606
267 Ga0495676_0047874 3300047321 Bacteria 3452
268 Ga0495676_0059577 3300047321 Bacteria 2997
269 Ga0495673_0108945 3300047469 Bacteria 1110
270 Ga0495614_0250437 3300048089 Bacteria 810
271 Ga0496100_0066555 3300048903 Bacteria 2390
272 Ga0496100_0646216 3300048903 Bacteria 823
273 Ga0496101_0146193 3300048904 Bacteria 1805
274 Ga0496101_0366714 3300048904 Bacteria 1132
275 Ga0496101_0388102 3300048904 Bacteria 1099
276 Ga0496102_0072323 3300048905 Bacteria 3168
277 Ga0496102_0311943 3300048905 Bacteria 1482
278 Ga0496102_0562283 3300048905 Bacteria 1063
279 Ga0496103_0052049 3300048906 Bacteria 2536
280 Ga0496104_0017475 3300048907 Bacteria 6532
281 Ga0496104_0023224 3300048907 Bacteria 5702
282 Ga0496104_0028552 3300048907 Bacteria 5170
283 Ga0496104_0265545 3300048907 Bacteria 1629
284 Ga0496104_0394334 3300048907 Bacteria 1296
285 Ga0496104_0621180 3300048907 Bacteria 990
286 Ga0496105_0002119 3300048908 Bacteria 14370
287 Ga0496105_0004271 3300048908 Bacteria 10750
288 Ga0496105_0438108 3300048908 Bacteria 1033
289 Ga0496105_0442716 3300048908 Bacteria 1026
290 Ga0496106_0012607 3300048909 Bacteria 6243
291 Ga0496106_0333875 3300048909 Bacteria 1217
292 Ga0496107_0021428 3300048910 Bacteria 4567
293 Ga0496107_0229535 3300048910 Bacteria 1381
294 Ga0496108_0025207 3300048911 Bacteria 4900
295 Ga0496108_0115239 3300048911 Bacteria 2301
296 Ga0496108_0311917 3300048911 Bacteria 1371
297 Ga0496108_0551350 3300048911 Bacteria 1006
298 Ga0496109_0123066 3300048912 Bacteria 2417
299 Ga0496109_0162309 3300048912 Bacteria 2094
300 Ga0496110_0077939 3300048913 Bacteria 2949
301 Ga0496110_0529225 3300048913 Bacteria 1072
302 Ga0496110_0792274 3300048913 Bacteria 852
303 Ga0496111_0015785 3300048914 Bacteria 5194
304 Ga0496111_0131513 3300048914 Bacteria 1852
305 Ga0496112_0004136 3300048915 Bacteria 12210
306 Ga0496112_0267669 3300048915 Bacteria 1657
307 Ga0496112_0904839 3300048915 Bacteria 804
308 Ga0496113_0224466 3300048916 Bacteria 1497
309 Ga0496113_0313347 3300048916 Bacteria 1257
310 Ga0496114_0024618 3300048917 Bacteria 4913
311 Ga0496114_0030563 3300048917 Bacteria 4432
312 Ga0496115_0014614 3300048918 Bacteria 5945
313 Ga0496117_0222946 3300048920 Bacteria 1048
314 Ga0496117_0290362 3300048920 Bacteria 871
315 Ga0496117_0416320 3300048920 Bacteria 673
316 Ga0496118_0093596 3300048921 Bacteria 2058
317 Ga0496119_0108881 3300048922 Bacteria 1541
318 Ga0496119_0169480 3300048922 Bacteria 1154
319 Ga0496120_0063164 3300048923 Bacteria 2061
320 Ga0496121_0059677 3300048924 Bacteria 3143
321 Ga0496121_0111167 3300048924 Bacteria 2090
322 Ga0496122_0017924 3300048925 Bacteria 6575
323 Ga0496123_0175714 3300048926 Bacteria 1124
324 Ga0496124_0129950 3300048927 Bacteria 2002
325 Ga0496125_0012916 3300048928 Bacteria 8246
326 Ga0496125_0090137 3300048928 Bacteria 2303
327 Ga0496126_0016831 3300048929 Bacteria 7298
328 Ga0496126_0075363 3300048929 Bacteria 2994
329 Ga0496126_0082134 3300048929 Bacteria 2848
330 Ga0496126_0170534 3300048929 Bacteria 1854
331 Ga0496126_0247904 3300048929 Bacteria 1485
332 Ga0501034_0263250 3300049571 Bacteria 1667
333 Ga0501046_0140700 3300049580 Bacteria 1826
334 Ga0501047_0011808 3300049581 Bacteria 8261
335 Ga0501067_0327456 3300049583 Bacteria 853
336 Ga0501069_0361410 3300049585 Bacteria 857
337 Ga0501070_0339471 3300049586 Bacteria 1220
338 Ga0501074_0025585 3300049590 Bacteria 4284
339 Ga0501080_0001422 3300049742 Bacteria 20085
340 Ga0501044_0029831 3300049823 Bacteria 5750
341 nmdc:mga0yw44_79094_c1 3300050492 Bacteria 2057
342 Ga0495601_0017379 3300053077 Bacteria 4365
343 Ga0495612_0012596 3300053078 Bacteria 3409
344 Ga0500610_0182061 3300053079 Bacteria 1028
345 Ga0495595_0004906 3300053084 Bacteria 5397
346 Ga0495619_0025742 3300053085 Bacteria 3781
347 Ga0500578_0451661 3300053086 Bacteria 731
348 Ga0500643_000112 3300053087 Bacteria 84793
349 Ga0500647_0087402 3300053091 Bacteria 1494
350 Ga0500566_0002244 3300053094 Bacteria 11418
351 Ga0500640_031812 3300053095 Bacteria 2314
352 Ga0500640_060339 3300053095 Bacteria 1645
353 Ga0500556_0004778 3300053104 Bacteria 3843
354 Ga0500557_000021 3300053105 Bacteria 89662
355 Ga0500572_002796 3300053111 Bacteria 4119
356 Ga0500572_028808 3300053111 Bacteria 1531
357 Ga0500597_024941 3300053120 Bacteria 2405
358 Ga0500608_101174 3300053122 Bacteria 1335
359 Ga0500614_006975 3300053123 Bacteria 2375
360 Ga0500618_020826 3300053125 Bacteria 1604
361 Ga0500642_0000362 3300053130 Bacteria 15284
362 Ga0500642_0045012 3300053130 Bacteria 1924
363 Ga0500559_0053277 3300053136 Bacteria 1790
364 Ga0500559_0093419 3300053136 Bacteria 1379
365 Ga0500564_150803 3300053138 Bacteria 991
366 Ga0500568_0040211 3300053139 Bacteria 1884
367 Ga0500585_068097 3300053144 Bacteria 1284
368 Ga0500590_093814 3300053148 Bacteria 1453
369 Ga0500603_002052 3300053150 Bacteria 4448
370 Ga0500616_0064241 3300053153 Bacteria 1891
371 Ga0500630_026657 3300053159 Bacteria 2848
372 Ga0500638_019140 3300053162 Bacteria 3206
373 Ga0500638_289112 3300053162 Bacteria 638
374 Ga0500639_004505 3300053163 Bacteria 7083
375 Ga0500636_0114438 3300053177 Bacteria 1520
376 Ga0500637_0035155 3300053178 Bacteria 2807
377 Ga0500625_036773 3300053729 Bacteria 2316
378 Ga0500609_004448 3300053731 Bacteria 1938
379 Ga0500596_001699 3300053735 Bacteria 4457
380 Ga0500601_000419 3300053737 Bacteria 7101
381 Ga0500601_002899 3300053737 Bacteria 1851
382 Ga0500661_010749 3300055283 Bacteria 1664
383 Ga0500661_050031 3300055283 Bacteria 746
384 2507505457 2507262055 Bacteria 8048963
385 2508539342 2508501009 Bacteria 7784016
386 2508695671 2508501042 Bacteria 8719808
387 2511395683 2511231028 Bacteria 8046582
388 2513642199 2513237094 Bacteria 8789602
389 2513651327 2513237095 Bacteria 8976980
390 2513659516 2513237096 Bacteria 8722461
391 2513676322 2513237098 Bacteria 9902361
392 2513859377 2513237137 Bacteria 9558895
393 2513873340 2513237139 Bacteria 8737671
394 2513888573 2513237141 Bacteria 8496279
395 2513921551 2513237145 Bacteria 8979722
396 2514014670 2513237161 Bacteria 8871253
397 2515627652 2515154112 Bacteria 8294334
398 2517106273 2517093001 Bacteria 9002274
399 2517889057 2517572143 Bacteria 9484767
400 2524537492 2524023228 Bacteria 10118060
401 2528853311 2528768022 Bacteria 10457665
402 2603858609 2602042107 Bacteria 6226103
403 2617352053 2617270735 Bacteria 9163226
404 2617373522 2617270741 Bacteria 8201522
405 2671124046 2667528175 Bacteria 7532676
406 2728748425 2728368998 Bacteria 8720350
407 2793062244 2791355196 Bacteria 7323613
408 2793072704 2791355197 Bacteria 8420563
409 2805920688 2802429603 Bacteria 8777136
410 2818237863 2816332527 Bacteria 8933356
411 2824671756 2824671348 Bacteria 8369588
412 2824684807 2824679649 Bacteria 8248951
413 2824695785 2824687955 Bacteria 8360029
414 2824701666 2824696289 Bacteria 8335049
415 2824710874 2824704595 Bacteria 9667483
416 2824740224 2824732956 Bacteria 7810675
417 2824751147 2824746037 Bacteria 7911610
418 2824760657 2824753945 Bacteria 9787441
419 2824768461 2824763712 Bacteria 9792355
420 2824779990 2824773399 Bacteria 8360218
421 2838124706 2838122688 Bacteria 8803140
422 2841945397 2841941048 Bacteria 8688029
423 2841952183 2841949485 Bacteria 8680857
424 2841965339 2841957949 Bacteria 8652217
425 2841970430 2841966195 Bacteria 8673214
426 2841981678 2841974524 Bacteria 8931498
427 2841984958 2841983080 Bacteria 8395090
428 2842043313 2842038055 Bacteria 8002051
429 2842052697 2842045827 Bacteria 8006841
430 2844315552 2844315083 Bacteria 8138177
431 2847931255 2847930680 Bacteria 9342022
432 2847942348 2847939898 Bacteria 8606328
433 2857526266 2857524615 Bacteria 6615449
434 2874592542 2874590934 Bacteria 8299676
435 2874621196 2874620515 Bacteria 8290088
436 2874647161 2874645413 Bacteria 8214782
437 2876769648 2876761206 Bacteria 10111113
438 2876772545 2876771140 Bacteria 8287509
439 2876819806 2876818435 Bacteria 8274608
440 2879076312 2879074833 Bacteria 8279565
441 2879083777 2879083081 Bacteria 8587928
442 2879101985 2879099564 Bacteria 10442239
443 2879128796 2879127579 Bacteria 8294491
444 2879143617 2879142872 Bacteria 8267021
445 2881673216 2881665667 Bacteria 8175609
446 2885369328 2885366525 Bacteria 8326213
447 2885377561 2885374607 Bacteria 8927485
448 2885386727 2885383462 Bacteria 9473874
449 2885417997 2885409591 Bacteria 9235467
450 2888379394 2888378607 Bacteria 9652610
451 2888390494 2888388044 Bacteria 7304136
452 2903733539 2903727486 Bacteria 8281579
453 2903758790 2903748898 Bacteria 9972761
454 2903777918 2903768456 Bacteria 9749579
455 2904667741 2904666416 Bacteria 8226587
456 2904690998 2904690495 Bacteria 9412302
457 2904708395
458 2904716323 2904711408 Bacteria 9771557
459 2906608893 2906602504 Bacteria 8295279
460 2906613567
461 2906636577 2906635258 Bacteria 8601019
462 2906668101 2906660503 Bacteria 8595048
463 2908747660 2908739725 Bacteria 8628932
464 2908757056 2908756301 Bacteria 8864324
465 2908775993 2908775508 Bacteria 8092255
466 2919073881 2919073203 Bacteria 6531949
467 2922369381
468 2922388481 2922386360 Bacteria 7017218
469 2922396577 2922393267 Bacteria 8285685
470 2922434004
471 2929618790 2929615660 Bacteria 9193770
472 2929628525 2929624759 Bacteria 9339455
473 2932790972 2932784394 Bacteria 9704911
474 2932794135 2932794094 Bacteria 7915132
475 2932809210 2932801729 Bacteria 7987968
476 2932816250 2932809354 Bacteria 9135765
477 2932827657 2932818245 Bacteria 9955613
478 2932833688 2932828146 Bacteria 9745859
479 2933580500 2933577622 Bacteria 9116884
480 2935615513 2935608549 Bacteria 8203142
481 2935623214 2935616580 Bacteria 9032984
482 2935636031 2935630451 Bacteria 8169952
483 2935644289 2935638405 Bacteria 10015038
484 2935654442 2935648319 Bacteria 8801166
485 2935663322 2935656913 Bacteria 8965014
486 2935672129 2935665750 Bacteria 9571747
487 2935679351 2935675223 Bacteria 9928132
488 2935686593 2935684952 Bacteria 9590419
489 2935700374 2935694250 Bacteria 9291695
490 2935710322 2935703347 Bacteria 10242284
491 2935716281 2935713505 Bacteria 9608509
492 2935723595 2935722832 Bacteria 9608746
493 2935735150 2935732158 Bacteria 9706831
494 2935744059 2935741537 Bacteria 9707219
495 2935752559 2935750917 Bacteria 9590372
496 2935763308 2935760218 Bacteria 9817913
497 2935774281 2935769743 Bacteria 7878163
498 2935783353 2935777560 Bacteria 8077691
499 2935789004 2935785616 Bacteria 7962367
500 2935796754 2935793552 Bacteria 8012592
501 2935808313 2935801545 Bacteria 9301974
502 2935816073 2935810662 Bacteria 9401221
503 2935825686 2935819856 Bacteria 8261050
504 2935833467 2935827899 Bacteria 10038562
505 2935845975 2935837841 Bacteria 9454360
506 2935853450 2935847175 Bacteria 8228321
507 2935861462 2935855204 Bacteria 9035059
508 2935869581 2935864058 Bacteria 9784707
509 2935879910 2935873716 Bacteria 9632195
510 2935889162 2935883170 Bacteria 7964738
511 2935915052 2935908558 Bacteria 8568796
512 2935918900 2935916978 Bacteria 9113783
513 2935931383 2935926038 Bacteria 8601059
514 2935939980 2935934488 Bacteria 8602579
515 2935947673 2935942939 Bacteria 8599779
516 2935956444 2935951376 Bacteria 8602333
517 2935973238 2935967501 Bacteria 8603075
518 2935980519 2935975950 Bacteria 8347125
519 2935990131 2935984226 Bacteria 8302647
520 2935997867 2935992306 Bacteria 9802711
521 2936008868 2936002035 Bacteria 9362176
522 2936017519 2936011229 Bacteria 8801034
523 2936025980 2936019824 Bacteria 8804134
524 2936034822 2936028420 Bacteria 8965941
525 2936041078 2936037263 Bacteria 9446081
526 2936052920 2936046547 Bacteria 8903709
527 2936060221 2936055302 Bacteria 8785755
528 2940558472 2940556831 Bacteria 9590747
529 2941512665 2941507105 Bacteria 8166816
530 2941520497 2941515067 Bacteria 8166720
531 2941528511 2941523033 Bacteria 8169134
532 2941547144 2941538514 Bacteria 9402094
533 3005475281 3005474847 Bacteria 9259049
534 3005486667 3005483717 Bacteria 7877331
535 3005594144 3005587118 Bacteria 7794411
536 3005595242 3005594810 Bacteria 8716512
537 3005718480 3005718088 Bacteria 8283608
538 8006935996 8006933436 Bacteria 10410654
539 8006967643 8006964411 Bacteria 8966052
540 8006975880 8006973647 Bacteria 10679141
541 8016517984 8016511872 Bacteria 9921665
542 8016526335 8016522445 Bacteria 8156687
543 8016544611 8016539877 Bacteria 8155419
544 8016557463 8016548790 Bacteria 8155074
545 8016565821 8016557553 Bacteria 8154380
546 8016582274 8016575299 Bacteria 8154085
547 8016603421 8016595262 Bacteria 8149947
548 8016606356 8016603502 Bacteria 8731218
549 8016618263 8016613128 Bacteria 8794220
550 8016622912 8016622563 Bacteria 7999408
551 8016634563 8016630954 Bacteria 9217207
552 8016635418 8016630954 Bacteria 9217207
553 8017058656 8017057580 Bacteria 10023680
554 8019540320 8019538911 Bacteria 7872763
555 8019549911 8019547302 Bacteria 7996444
556 8019562661 8019555841 Bacteria 9642137
557 8019572738 8019565922 Bacteria 9639779
558 8019577001 8019576017 Bacteria 10049540
559 8019595067 8019586578 Bacteria 10212056
560 8019606676 8019597564 Bacteria 10041141
561 8019611835 8019608314 Bacteria 10042931
562 8019623170 8019619141 Bacteria 9218857
563 8019629928 8019629233 Bacteria 8687553
564 8019640678 8019638758 Bacteria 9062356
565 8019652275 8019648815 Bacteria 10014479
566 8019666764 8019659431 Bacteria 8577854
567 8019676525 8019668869 Bacteria 8791617
568 8019679464 8019678201 Bacteria 8863603
569 8019696040 8019687851 Bacteria 8712826
570 8055742639 8055742211 Bacteria 9226248
571 8056682947 8056681323 Bacteria 8472857
572 8056693788 8056689827 Bacteria 6712655
573 8056971500 8056967851 Bacteria 9038162
574 Ga0466963_0178960
575 JGI25153J46596_10005387
576 rootH2_10097850
577 JGI25160J50197_1002041
578 JGI25160J50197_1004384
579 JGI25160J50197_1005378
580 JGI25404J52841_10000873
581 Ga0065165_1003775
582 Ga0070683_100006653
583 Ga0070666_10203302
584 Ga0070680_100277401
585 Ga0070682_100920713
586 Ga0070682_101037889
587 Ga0068868_100162758
588 Ga0070660_100256322
589 Ga0070689_100600695
590 Ga0070668_100091590
591 Ga0070671_100558298
592 Ga0070674_101067641
593 Ga0070709_10000164
594 Ga0070709_10045120
595 Ga0070709_10165868
596 Ga0070714_100047913
597 Ga0070714_100116517
598 Ga0070714_100331209
599 Ga0070713_100004014
600 Ga0070713_100094561
601 Ga0070713_100223232
602 Ga0070710_10000283
603 Ga0070710_10136772
604 Ga0070711_100005189
605 Ga0070711_100015539
606 Ga0070711_100119132
607 Ga0070678_100075747
608 Ga0070681_10099168
609 Ga0068867_100489228
610 Ga0070679_100276366
611 Ga0070684_100237377
612 Ga0068853_100234249
613 Ga0070665_100138662
614 Ga0068854_100740671
615 Ga0068856_100480794
616 Ga0068852_100056770
617 Ga0068852_100167042
618 Ga0068864_100089273
619 Ga0068866_10191690
620 Ga0068851_10139230
621 Ga0068858_100058976
622 Ga0068862_100388081
623 Ga0081455_10016293
624 Ga0081540_1002717
625 Ga0081540_1004583
626 Ga0081540_1018204
627 Ga0081540_1057661
628 Ga0081540_1116141
629 Ga0081540_1118322
630 Ga0070717_10020018
631 Ga0070717_10490423
632 Ga0075365_10096010
633 Ga0075365_10461809
634 Ga0075368_10014493
635 Ga0070716_100117043
636 Ga0070716_100708476
637 Ga0070712_100014272
638 Ga0070712_100026701
639 Ga0070712_100057309
640 Ga0075369_10018025
641 Ga0068871_100935514
642 Ga0068865_100295935
643 Ga0099825_1034360
644 Ga0099824_1007180
645 Ga0099824_1015237
646 Ga0099822_1002271
647 Ga0099822_1035053
648 Ga0099823_1054766
649 Ga0105240_10020094
650 Ga0105240_10178027
651 Ga0105240_10226073
652 Ga0105240_10686841
653 Ga0105247_10065056
654 Ga0105247_10357062
655 Ga0105247_10632666
656 Ga0105243_10612895
657 Ga0105242_10215683
658 Ga0105248_10220918
659 Ga0105248_11170674
660 Ga0105237_10103084
661 Ga0105237_10217065
662 Ga0105237_10228065
663 Ga0105237_10489764
664 Ga0105238_10063955
665 Ga0105238_10149775
666 Ga0105238_10194243
667 Ga0105249_10432199
668 Ga0105239_10049028
669 Ga0105239_10456755
670 Ga0105246_10460358
671 Ga0157370_10074997
672 Ga0157370_10222534
673 Ga0157369_10030438
674 Ga0157372_10406519
675 Ga0157375_10064037
676 Ga0157376_10267044
677 Ga0213876_10049695
678 Ga0213876_10282693
679 Ga0213876_10335999
680 Ga0213871_10058021
681 Ga0209563_105793
682 Ga0209677_105710
683 Ga0209148_1000295
684 Ga0209233_1003058
685 Ga0209233_1015657
686 Ga0207666_1007885
687 Ga0209564_1007238
688 Ga0209758_1001816
689 Ga0209758_1006696
690 Ga0209758_1040405
691 Ga0209758_1041471
692 Ga0207426_1001802
693 Ga0207426_1004864
694 Ga0207426_1019865
695 Ga0207692_10000528
696 Ga0207642_10577206
697 Ga0207710_10038355
698 Ga0207710_10214296
699 Ga0207688_10666219
700 Ga0207680_10242696
701 Ga0207647_10085645
702 Ga0207647_10232368
703 Ga0207699_10000514
704 Ga0207699_10017607
705 Ga0207705_10914944
706 Ga0207654_10038547
707 Ga0207707_10032670
708 Ga0207695_10000148
709 Ga0207671_10011888
710 Ga0207671_10645609
711 Ga0207693_10008295
712 Ga0207693_10011107
713 Ga0207693_11066727
714 Ga0207663_10008467
715 Ga0207663_10213574
716 Ga0207657_10238781
717 Ga0207652_10093847
718 Ga0207694_10139523
719 Ga0207694_10410697
720 Ga0207700_10004601
721 Ga0207700_10046786
722 Ga0207700_10199819
723 Ga0207700_10240085
724 Ga0207664_10040008
725 Ga0207664_10198528
726 Ga0207644_10503651
727 Ga0207670_10814168
728 Ga0207665_10023947
729 Ga0207665_10233865
730 Ga0207711_10253566
731 Ga0207679_10633380
732 Ga0207679_10682242
733 Ga0207668_10409906
734 Ga0207668_10521273
735 Ga0207658_10539597
736 Ga0207703_11336042
737 Ga0207639_10217951
738 Ga0207639_10680473
739 Ga0207678_10110740
740 Ga0207702_10826032
741 Ga0207702_10842948
742 Ga0207648_10556432
743 Ga0207676_10521881
744 Ga0207683_10036053
745 Ga0207683_11455986
746 Ga0207698_10031723
747 Ga0209389_1000102
748 Ga0209389_1000142
749 Ga0209589_1000035
750 Ga0209589_1000331
751 Ga0209489_100079
752 Ga0209489_100404
753 Ga0209489_100818
754 Ga0209700_100077
755 Ga0209700_100408
756 Ga0265340_10001849
757 Ga0265331_10178936
758 Ga0265316_10096416
759 Ga0307508_10000045
760 Ga0307508_10074036
761 Ga0307508_10230876
762 Ga0315911_1000008
763 Ga0373929_0012637
764 Ga0373949_0025395
765 Ga0373951_0072467
766 Ga0373952_0005949
767 Ga0373932_0035873
768 Ga0373932_0166772
769 Ga0373943_0111820
770 Ga0373931_0213042
771 Ga0373935_0295801
772 Ga0373927_0011298
773 Ga0373927_0018485
774 Ga0373925_0054700
775 Ga0395900_0084739
776 Ga0395900_0404790
777 Ga0395900_0519377
778 Ga0395898_0058696
779 Ga0395905_0143901
780 Ga0395905_0297353
781 Ga0436364_1117557
782 Ga0395901_0933928
783 Ga0436365_0073154
784 Ga0436360_1105421
785 Ga0436363_0665510
786 Ga0436362_0502235
787 Ga0451793_0226756
788 Ga0451798_0502518
789 Ga0451807_1271182
790 Ga0451833_0279353
791 Ga0451841_0583394
792 Ga0451845_0176529
793 Ga0466969_0011225
794 Ga0466972_0000941
795 Ga0466965_0090170
796 Ga0466966_0000628
797 Ga0466966_0314526
798 Ga0466961_0002516
799 Ga0466964_0256771
800 Ga0466971_0197367
801 Ga0466968_0209786
802 Ga0466957_0106616
803 Ga0466960_0317419
804 Ga0466959_0012945
805 Ga0466959_0033457
806 Ga0466959_0202845
807 Ga0466958_0090935
808 Ga0466958_0766954
809 Ga0466967_0109357
810 Ga0466967_0177414
811 Ga0495617_035848
812 Ga0495592_0381480
813 Ga0495629_0003103
814 Ga0495650_0023619
815 Ga0495664_0012780
816 Ga0495664_0040124
817 Ga0495664_0063086
818 Ga0495664_0068890
819 Ga0495596_0035053
820 Ga0495630_0867985
821 Ga0495652_0486975
822 Ga0495645_0042168
823 Ga0495645_0046951
824 Ga0495622_0031861
825 Ga0495667_0137243
826 Ga0495667_0193260
827 Ga0495625_0461193
828 Ga0495635_0669158
829 Ga0495588_0008571
830 Ga0495657_0005477
831 Ga0495657_0030643
832 Ga0495657_0217081
833 Ga0495623_0102865
834 Ga0495671_0227661
835 Ga0495600_0051863
836 Ga0495581_0022999
837 Ga0495604_0294217
838 Ga0495674_0293391
839 Ga0495674_1096323
840 Ga0495676_0047874
841 Ga0495676_0059577
842 Ga0495673_0108945
843 Ga0495614_0250437
844 Ga0496100_0066555
845 Ga0496100_0646216
846 Ga0496101_0146193
847 Ga0496101_0366714
848 Ga0496101_0388102
849 Ga0496102_0072323
850 Ga0496102_0311943
851 Ga0496102_0562283
852 Ga0496103_0052049
853 Ga0496104_0017475
854 Ga0496104_0023224
855 Ga0496104_0028552
856 Ga0496104_0265545
857 Ga0496104_0394334
858 Ga0496104_0621180
859 Ga0496105_0002119
860 Ga0496105_0004271
861 Ga0496105_0438108
862 Ga0496105_0442716
863 Ga0496106_0012607
864 Ga0496106_0333875
865 Ga0496107_0021428
866 Ga0496107_0229535
867 Ga0496108_0025207
868 Ga0496108_0115239
869 Ga0496108_0311917
870 Ga0496108_0551350
871 Ga0496109_0123066
872 Ga0496109_0162309
873 Ga0496110_0077939
874 Ga0496110_0529225
875 Ga0496110_0792274
876 Ga0496111_0015785
877 Ga0496111_0131513
878 Ga0496112_0004136
879 Ga0496112_0267669
880 Ga0496112_0904839
881 Ga0496113_0224466
882 Ga0496113_0313347
883 Ga0496114_0024618
884 Ga0496114_0030563
885 Ga0496115_0014614
886 Ga0496117_0222946
887 Ga0496117_0290362
888 Ga0496117_0416320
889 Ga0496118_0093596
890 Ga0496119_0108881
891 Ga0496119_0169480
892 Ga0496120_0063164
893 Ga0496121_0059677
894 Ga0496121_0111167
895 Ga0496122_0017924
896 Ga0496123_0175714
897 Ga0496124_0129950
898 Ga0496125_0012916
899 Ga0496125_0090137
900 Ga0496126_0016831
901 Ga0496126_0075363
902 Ga0496126_0082134
903 Ga0496126_0170534
904 Ga0496126_0247904
905 Ga0501034_0263250
906 Ga0501046_0140700
907 Ga0501047_0011808
908 Ga0501067_0327456
909 Ga0501069_0361410
910 Ga0501070_0339471
911 Ga0501074_0025585
912 Ga0501080_0001422
913 Ga0501044_0029831
914 nmdc:mga0yw44_79094_c1
915 Ga0495601_0017379
916 Ga0495612_0012596
917 Ga0500610_0182061
918 Ga0495595_0004906
919 Ga0495619_0025742
920 Ga0500578_0451661
921 Ga0500643_000112
922 Ga0500647_0087402
923 Ga0500566_0002244
924 Ga0500640_031812
925 Ga0500640_060339
926 Ga0500556_0004778
927 Ga0500557_000021
928 Ga0500572_002796
929 Ga0500572_028808
930 Ga0500597_024941
931 Ga0500608_101174
932 Ga0500614_006975
933 Ga0500618_020826
934 Ga0500642_0000362
935 Ga0500642_0045012
936 Ga0500559_0053277
937 Ga0500559_0093419
938 Ga0500564_150803
939 Ga0500568_0040211
940 Ga0500585_068097
941 Ga0500590_093814
942 Ga0500603_002052
943 Ga0500616_0064241
944 Ga0500630_026657
945 Ga0500638_019140
946 Ga0500638_289112
947 Ga0500639_004505
948 Ga0500636_0114438
949 Ga0500637_0035155
950 Ga0500625_036773
951 Ga0500609_004448
952 Ga0500596_001699
953 Ga0500601_000419
954 Ga0500601_002899
955 Ga0500661_010749
956 Ga0500661_050031
957 2507505457
958 2508539342
959 2508695671
960 2511395683
961 2513642199
962 2513651327
963 2513659516
964 2513676322
965 2513859377
966 2513873340
967 2513888573
968 2513921551
969 2514014670
970 2515627652
971 2517106273
972 2517889057
973 2524537492
974 2528853311
975 2603858609
976 2617352053
977 2617373522
978 2671124046
979 2728748425
980 2793062244
981 2793072704
982 2805920688
983 2818237863
984 2824671756
985 2824684807
986 2824695785
987 2824701666
988 2824710874
989 2824740224
990 2824751147
991 2824760657
992 2824768461
993 2824779990
994 2838124706
995 2841945397
996 2841952183
997 2841965339
998 2841970430
999 2841981678
1000 2841984958
1001 2842043313
1002 2842052697
1003 2844315552
1004 2847931255
1005 2847942348
1006 2857526266
1007 2874592542
1008 2874621196
1009 2874647161
1010 2876769648
1011 2876772545
1012 2876819806
1013 2879076312
1014 2879083777
1015 2879101985
1016 2879128796
1017 2879143617
1018 2881673216
1019 2885369328
1020 2885377561
1021 2885386727
1022 2885417997
1023 2888379394
1024 2888390494
1025 2903733539
1026 2903758790
1027 2903777918
1028 2904667741
1029 2904690998
1030 2904708395
1031 2904716323
1032 2906608893
1033 2906613567
1034 2906636577
1035 2906668101
1036 2908747660
1037 2908757056
1038 2908775993
1039 2919073881
1040 2922369381
1041 2922388481
1042 2922396577
1043 2922434004
1044 2929618790
1045 2929628525
1046 2932790972
1047 2932794135
1048 2932809210
1049 2932816250
1050 2932827657
1051 2932833688
1052 2933580500
1053 2935615513
1054 2935623214
1055 2935636031
1056 2935644289
1057 2935654442
1058 2935663322
1059 2935672129
1060 2935679351
1061 2935686593
1062 2935700374
1063 2935710322
1064 2935716281
1065 2935723595
1066 2935735150
1067 2935744059
1068 2935752559
1069 2935763308
1070 2935774281
1071 2935783353
1072 2935789004
1073 2935796754
1074 2935808313
1075 2935816073
1076 2935825686
1077 2935833467
1078 2935845975
1079 2935853450
1080 2935861462
1081 2935869581
1082 2935879910
1083 2935889162
1084 2935915052
1085 2935918900
1086 2935931383
1087 2935939980
1088 2935947673
1089 2935956444
1090 2935973238
1091 2935980519
1092 2935990131
1093 2935997867
1094 2936008868
1095 2936017519
1096 2936025980
1097 2936034822
1098 2936041078
1099 2936052920
1100 2936060221
1101 2940558472
1102 2941512665
1103 2941520497
1104 2941528511
1105 2941547144
1106 3005475281
1107 3005486667
1108 3005594144
1109 3005595242
1110 3005718480
1111 8006935996
1112 8006967643
1113 8006975880
1114 8016517984
1115 8016526335
1116 8016544611
1117 8016557463
1118 8016565821
1119 8016582274
1120 8016603421
1121 8016606356
1122 8016618263
1123 8016622912
1124 8016634563
1125 8016635418
1126 8017058656
1127 8019540320
1128 8019549911
1129 8019562661
1130 8019572738
1131 8019577001
1132 8019595067
1133 8019606676
1134 8019611835
1135 8019623170
1136 8019629928
1137 8019640678
1138 8019652275
1139 8019666764
1140 8019676525
1141 8019679464
1142 8019696040
1143 8055742639
1144 8056682947
1145 8056693788
1146 8056971500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14235

DUF4337

Domain of unknown function (DUF4337)

60

226

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a8p-assembly3.cif.gz_C crystal structure of the tiam2 phccex domain 0.9103 42 97
4afl-assembly2.cif.gz_F the crystal structure of the ing4 dimerization domain reveals the functional organization of the ing family of chromatin binding proteins. 0.8748 39 116
7o3x-assembly1.cif.gz_B structural basis for vipp1 oligomerization and maintenance of thylakoid membrane integrity 0.7811 2 148
8ilv-assembly1.cif.gz_B cryo-em structure of pi3kalpha in complex with compound 18 0.7588 14 138
7o3w-assembly1.cif.gz_A structural basis for vipp1 oligomerization and maintenance of thylakoid membrane integrity 0.7582 2 148
ID Description Score Start End Superfamily
af_A0A286Y9S9_612_725_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.9526 42 97 6.10.140.680
5vu9A04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.951 52 96 1.10.287.690
4flyA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.9473 56 96 1.10.287.690
af_D3ZWV8_556_669_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.9451 42 97 6.10.140.680
1qhtA04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.9388 56 96 1.10.287.690
ID Description Score Start End GO Terms
AF-A0A849TNL5-F1-model_v4 DUF4337 domain-containing protein 0.9558 6 137 GO:0016020
AF-A0A147FFI2-F1-model_v4 deleted 0.9287 24 183
AF-A0A363TGZ1-F1-model_v4 DUF4337 domain-containing protein 0.9249 4 183 GO:0016020
AF-F7QGK3-F1-model_v4 DUF4337 domain-containing protein 0.9226 3 183 GO:0016020
AF-A0A1H5Z6R0-F1-model_v4 DUF4337 domain-containing protein 0.9201 8 180 GO:0016020

Map