F465191

General Info

Members Datasets Scaffolds Average Seq Length
573 236 1146 309

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10097614|Ga0207648_100976142
Length 337
Sequence MQPGQNAVEELDLVATHVGAAVLDPPMTASGAESLVDEILELKRSRKAIILAHHYQVDEIQEIADVIGDSLELARKAQEFDGEVIAFCGVVFMAETAKVLNPTRTVVLPDLGAGCSLVDSCPADQIRAFRARNPEYVIVSYINTSVEVKAESDILCTSRNAVKIVNSIPADKPILFLPDINLGNWVKKQTGRQNMKIWQGACIVHATFAARRLTKTLSDHPNAWIVAHPECPAEVLAKANFIGSTSAIIDHCVASPHQEFIVMTESGVSHSLHKRAPGKTFHFVPNENCNCSECPYMRRNNLENLRDCLATLSPRIELSEVIIRRAALPIERMLAVK

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 1.22
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 0.7
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 13.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10097614 3300026089 Unclassified 2571
2 Ga0070658_10244281 3300005327 Bacteria 1522
3 Ga0070676_10060553 3300005328 Bacteria 2249
4 Ga0070683_100000088 3300005329 Bacteria 61766
5 Ga0070683_100013541 3300005329 Bacteria 7117
6 Ga0070683_100017865 3300005329 Bacteria 6269
7 Ga0070683_100134386 3300005329 Bacteria 2342
8 Ga0070683_100165594 3300005329 Bacteria 2097
9 Ga0070683_100189414 3300005329 Bacteria 1953
10 Ga0070690_100017887 3300005330 Bacteria 4273
11 Ga0070690_100111354 3300005330 Bacteria 1827
12 Ga0070666_10079584 3300005335 Unclassified 2238
13 Ga0070680_100001004 3300005336 Bacteria 20106
14 Ga0068868_100228087 3300005338 Bacteria 1562
15 Ga0070660_100040735 3300005339 Unclassified 3537
16 Ga0070660_100184981 3300005339 Bacteria 1687
17 Ga0070660_100217315 3300005339 Bacteria 1553
18 Ga0070689_100447917 3300005340 Bacteria 1098
19 Ga0070691_10001000 3300005341 Bacteria 11585
20 Ga0070661_100036013 3300005344 Bacteria 3597
21 Ga0070661_100121334 3300005344 Unclassified 1958
22 Ga0070675_100486743 3300005354 Bacteria 1110
23 Ga0070671_100179309 3300005355 Bacteria 1793
24 Ga0070673_100006269 3300005364 Bacteria 7715
25 Ga0070659_100154364 3300005366 Bacteria 1874
26 Ga0070667_100084531 3300005367 Bacteria 2720
27 Ga0070667_100254016 3300005367 Bacteria 1572
28 Ga0070709_10039571 3300005434 Unclassified 2893
29 Ga0070714_100012105 3300005435 Bacteria 6871
30 Ga0070713_100023532 3300005436 Bacteria 4781
31 Ga0070713_100043351 3300005436 Bacteria 3678
32 Ga0070713_100121765 3300005436 Bacteria 2289
33 Ga0070713_100610097 3300005436 Unclassified 1037
34 Ga0070711_100040475 3300005439 Bacteria 3144
35 Ga0070708_100322626 3300005445 Bacteria 1455
36 Ga0070678_100057154 3300005456 Bacteria 2857
37 Ga0070662_100060648 3300005457 Bacteria 2759
38 Ga0070681_10035370 3300005458 Bacteria 5017
39 Ga0070681_10112837 3300005458 Unclassified 2658
40 Ga0070681_10112853 3300005458 Unclassified 2658
41 Ga0070681_10232530 3300005458 Bacteria 1757
42 Ga0070681_10260108 3300005458 Bacteria 1647
43 Ga0070681_10348705 3300005458 Bacteria 1391
44 Ga0070681_10408626 3300005458 Bacteria 1269
45 Ga0068867_100243813 3300005459 Bacteria 1458
46 Ga0070685_10235881 3300005466 Bacteria 1205
47 Ga0070706_100426425 3300005467 Bacteria 1234
48 Ga0070679_100178351 3300005530 Bacteria 2097
49 Ga0070679_100269283 3300005530 Bacteria 1658
50 Ga0070684_100000003 3300005535 Bacteria 248527
51 Ga0070684_100000798 3300005535 Bacteria 21897
52 Ga0070684_100055924 3300005535 Unclassified 3442
53 Ga0070684_100125929 3300005535 Bacteria 2307
54 Ga0070684_100192983 3300005535 Bacteria 1854
55 Ga0068853_100003008 3300005539 Bacteria 12867
56 Ga0068853_100290860 3300005539 Bacteria 1508
57 Ga0068853_100372791 3300005539 Bacteria 1332
58 Ga0070672_100252879 3300005543 Bacteria 1484
59 Ga0070696_100015763 3300005546 Bacteria 5080
60 Ga0070665_100001546 3300005548 Bacteria 26568
61 Ga0070665_100168791 3300005548 Bacteria 2190
62 Ga0070665_100675888 3300005548 Bacteria 1046
63 Ga0068855_100002936 3300005563 Bacteria 20841
64 Ga0068855_100003533 3300005563 Bacteria 19108
65 Ga0068855_100010435 3300005563 Bacteria 11207
66 Ga0068855_100015926 3300005563 Bacteria 9045
67 Ga0068855_100017262 3300005563 Bacteria 8686
68 Ga0068855_100027065 3300005563 Bacteria 6860
69 Ga0068855_100094149 3300005563 Unclassified 3454
70 Ga0068855_100366234 3300005563 Bacteria 1585
71 Ga0070664_100191325 3300005564 Unclassified 1823
72 Ga0070664_100219813 3300005564 Bacteria 1699
73 Ga0068857_100001280 3300005577 Bacteria 19741
74 Ga0068857_100023692 3300005577 Bacteria 5404
75 Ga0068857_100233536 3300005577 Unclassified 1682
76 Ga0068856_100002863 3300005614 Bacteria 17656
77 Ga0068856_100005113 3300005614 Bacteria 12961
78 Ga0068856_100006893 3300005614 Bacteria 11113
79 Ga0068856_100018477 3300005614 Bacteria 6756
80 Ga0068856_100042307 3300005614 Bacteria 4481
81 Ga0068856_100079593 3300005614 Bacteria 3250
82 Ga0068856_100104537 3300005614 Bacteria 2826
83 Ga0068856_100141082 3300005614 Bacteria 2417
84 Ga0068856_100166505 3300005614 Unclassified 2215
85 Ga0068852_100124908 3300005616 Bacteria 2361
86 Ga0068852_100297709 3300005616 Bacteria 1560
87 Ga0068859_100101811 3300005617 Bacteria 2930
88 Ga0068859_100320865 3300005617 Unclassified 1643
89 Ga0068859_100459754 3300005617 Bacteria 1369
90 Ga0068863_100036579 3300005841 Bacteria 4677
91 Ga0068863_100142828 3300005841 Bacteria 2288
92 Ga0068863_100155700 3300005841 Bacteria 2188
93 Ga0068863_100407093 3300005841 Bacteria 1331
94 Ga0068858_100017291 3300005842 Bacteria 6764
95 Ga0068858_100032804 3300005842 Unclassified 4823
96 Ga0068858_100040760 3300005842 Unclassified 4307
97 Ga0068858_100065708 3300005842 Bacteria 3357
98 Ga0068860_100016589 3300005843 Bacteria 7183
99 Ga0068860_100184793 3300005843 Bacteria 2015
100 Ga0081455_10040858 3300005937 Bacteria 4086
101 Ga0070717_10013700 3300006028 Bacteria 6221
102 Ga0070717_10058973 3300006028 Bacteria 3175
103 Ga0070717_10277445 3300006028 Bacteria 1486
104 Ga0070717_10349896 3300006028 Bacteria 1321
105 Ga0070716_100160288 3300006173 Bacteria 1457
106 Ga0070712_100031011 3300006175 Bacteria 3599
107 Ga0070712_100113679 3300006175 Unclassified 2025
108 Ga0097621_100026689 3300006237 Bacteria 4534
109 Ga0097621_100046214 3300006237 Unclassified 3522
110 Ga0097621_100096436 3300006237 Bacteria 2482
111 Ga0097621_100116672 3300006237 Bacteria 2261
112 Ga0097621_100139108 3300006237 Bacteria 2074
113 Ga0097621_100156443 3300006237 Bacteria 1957
114 Ga0068871_100014312 3300006358 Bacteria 5910
115 Ga0068871_100066982 3300006358 Bacteria 2945
116 Ga0068871_100116433 3300006358 Bacteria 2253
117 Ga0068871_100126839 3300006358 Unclassified 2161
118 Ga0068871_100232699 3300006358 Bacteria 1600
119 Ga0068871_100429969 3300006358 Unclassified 1180
120 Ga0075430_100092214 3300006846 Bacteria 2533
121 Ga0075431_100002583 3300006847 Bacteria 17495
122 Ga0075431_100462388 3300006847 Unclassified 1263
123 Ga0075433_10482316 3300006852 Bacteria 1092
124 Ga0068865_100429334 3300006881 Bacteria 1088
125 Ga0075436_100021352 3300006914 Bacteria 4445
126 Ga0097620_100101811 3300006931 Bacteria 2930
127 Ga0097620_100320847 3300006931 Unclassified 1643
128 Ga0097620_100459798 3300006931 Bacteria 1369
129 Ga0105240_10000519 3300009093 Bacteria 70908
130 Ga0105240_10000877 3300009093 Bacteria 54159
131 Ga0105240_10001298 3300009093 Bacteria 43175
132 Ga0105240_10077441 3300009093 Bacteria 4097
133 Ga0105240_10239292 3300009093 Bacteria 2105
134 Ga0105240_10246183 3300009093 Bacteria 2070
135 Ga0105245_10007593 3300009098 Bacteria 9495
136 Ga0105245_10015249 3300009098 Bacteria 6695
137 Ga0105245_10021042 3300009098 Bacteria 5722
138 Ga0105245_10021645 3300009098 Bacteria 5643
139 Ga0105245_10028778 3300009098 Unclassified 4903
140 Ga0105245_10062270 3300009098 Bacteria 3366
141 Ga0105245_10213509 3300009098 Bacteria 1858
142 Ga0105247_10070015 3300009101 Bacteria 2191
143 Ga0105247_10147098 3300009101 Bacteria 1549
144 Ga0114129_10430575 3300009147 Bacteria 1733
145 Ga0105243_10106225 3300009148 Unclassified 2340
146 Ga0105241_10007088 3300009174 Bacteria 8255
147 Ga0105241_10008537 3300009174 Bacteria 7533
148 Ga0105241_10009610 3300009174 Bacteria 7109
149 Ga0105241_10093260 3300009174 Bacteria 2379
150 Ga0105241_10228015 3300009174 Bacteria 1569
151 Ga0105241_10252869 3300009174 Unclassified 1495
152 Ga0105241_10387611 3300009174 Bacteria 1223
153 Ga0105241_10478017 3300009174 Bacteria 1107
154 Ga0105242_10006709 3300009176 Bacteria 8881
155 Ga0105242_10040533 3300009176 Unclassified 3753
156 Ga0105248_10017829 3300009177 Bacteria 7836
157 Ga0105248_10050021 3300009177 Bacteria 4687
158 Ga0105248_10121372 3300009177 Bacteria 2948
159 Ga0105248_10152825 3300009177 Bacteria 2604
160 Ga0105248_10171603 3300009177 Bacteria 2444
161 Ga0105248_10221119 3300009177 Unclassified 2132
162 Ga0105248_10368416 3300009177 Bacteria 1617
163 Ga0105237_10004151 3300009545 Bacteria 16880
164 Ga0105237_10091785 3300009545 Bacteria 3027
165 Ga0105237_10103718 3300009545 Unclassified 2836
166 Ga0105237_10150325 3300009545 Unclassified 2325
167 Ga0105237_10237127 3300009545 Bacteria 1825
168 Ga0105237_10333944 3300009545 Bacteria 1520
169 Ga0105237_10550479 3300009545 Bacteria 1160
170 Ga0105238_10091364 3300009551 Unclassified 3032
171 Ga0105238_10110087 3300009551 Bacteria 2735
172 Ga0105249_10010890 3300009553 Bacteria 7993
173 Ga0105249_10244807 3300009553 Bacteria 1775
174 Ga0105249_10326903 3300009553 Bacteria 1546
175 Ga0105239_10002634 3300010375 Bacteria 22663
176 Ga0105239_10007999 3300010375 Bacteria 12071
177 Ga0105239_10013772 3300010375 Bacteria 8977
178 Ga0105239_10034304 3300010375 Bacteria 5572
179 Ga0105239_10036180 3300010375 Bacteria 5422
180 Ga0105239_10058970 3300010375 Bacteria 4213
181 Ga0105239_10145939 3300010375 Bacteria 2639
182 Ga0105239_10184746 3300010375 Unclassified 2333
183 Ga0105239_10195433 3300010375 Bacteria 2265
184 Ga0105246_10051147 3300011119 Bacteria 2836
185 Ga0105246_10148761 3300011119 Bacteria 1770
186 Ga0157373_10027411 3300013100 Bacteria 4109
187 Ga0157373_10048423 3300013100 Unclassified 3030
188 Ga0157370_10002850 3300013104 Bacteria 20653
189 Ga0157370_10013208 3300013104 Bacteria 8516
190 Ga0157370_10092229 3300013104 Bacteria 2843
191 Ga0157370_10094080 3300013104 Bacteria 2812
192 Ga0157369_10006968 3300013105 Bacteria 13031
193 Ga0157369_10007301 3300013105 Bacteria 12721
194 Ga0157369_10013990 3300013105 Bacteria 9068
195 Ga0157369_10018191 3300013105 Bacteria 7881
196 Ga0157374_10036825 3300013296 Bacteria 4484
197 Ga0157374_10082792 3300013296 Bacteria 3047
198 Ga0157374_10088526 3300013296 Bacteria 2949
199 Ga0157374_10096229 3300013296 Bacteria 2832
200 Ga0157374_10266467 3300013296 Bacteria 1688
201 Ga0157374_10353807 3300013296 Bacteria 1460
202 Ga0157378_10003184 3300013297 Bacteria 14580
203 Ga0157378_10084266 3300013297 Unclassified 2878
204 Ga0163162_10058958 3300013306 Bacteria 3869
205 Ga0163162_10477695 3300013306 Bacteria 1378
206 Ga0163162_10489753 3300013306 Bacteria 1361
207 Ga0157372_10040395 3300013307 Bacteria 5152
208 Ga0157372_10093476 3300013307 Bacteria 3422
209 Ga0157372_10094674 3300013307 Bacteria 3401
210 Ga0157372_10136835 3300013307 Bacteria 2822
211 Ga0157372_10215777 3300013307 Bacteria 2224
212 Ga0157372_10515169 3300013307 Bacteria 1394
213 Ga0157372_10693269 3300013307 Bacteria 1185
214 Ga0157375_10110752 3300013308 Bacteria 2843
215 Ga0157375_10255927 3300013308 Bacteria 1912
216 Ga0157375_10322427 3300013308 Bacteria 1709
217 Ga0157375_10462674 3300013308 Bacteria 1434
218 Ga0157375_10906337 3300013308 Bacteria 1025
219 Ga0163163_10006504 3300014325 Bacteria 10225
220 Ga0163163_10028360 3300014325 Bacteria 5374
221 Ga0163163_10052123 3300014325 Bacteria 4036
222 Ga0163163_10071793 3300014325 Unclassified 3450
223 Ga0163163_10151640 3300014325 Bacteria 2361
224 Ga0163163_10182093 3300014325 Bacteria 2148
225 Ga0163163_10250851 3300014325 Bacteria 1820
226 Ga0163163_10367207 3300014325 Bacteria 1496
227 Ga0163163_10416490 3300014325 Bacteria 1402
228 Ga0157379_10016384 3300014968 Bacteria 6519
229 Ga0157379_10142060 3300014968 Bacteria 2164
230 Ga0157379_10610207 3300014968 Bacteria 1019
231 Ga0157376_10054882 3300014969 Bacteria 3323
232 Ga0157376_10181092 3300014969 Bacteria 1926
233 Ga0157376_10199553 3300014969 Unclassified 1839
234 Ga0157376_10312107 3300014969 Bacteria 1492
235 Ga0157376_10421879 3300014969 Bacteria 1295
236 Ga0206350_11593772 3300020080 Bacteria 1020
237 Ga0213872_10000111 3300021361 Bacteria 75008
238 Ga0213876_10042471 3300021384 Bacteria 2402
239 Ga0213876_10085482 3300021384 Unclassified 1669
240 Ga0213876_10096881 3300021384 Bacteria 1563
241 Ga0213876_10135899 3300021384 Unclassified 1308
242 Ga0213875_10004682 3300021388 Bacteria 7452
243 Ga0213875_10070087 3300021388 Bacteria 1636
244 Ga0213875_10077069 3300021388 Bacteria 1556
245 Ga0213875_10164853 3300021388 Bacteria 1040
246 Ga0224712_10062530 3300022467 Bacteria 1487
247 Ga0207710_10049490 3300025900 Bacteria 1883
248 Ga0207680_10102176 3300025903 Bacteria 1844
249 Ga0207680_10223671 3300025903 Bacteria 1291
250 Ga0207699_10014678 3300025906 Unclassified 4047
251 Ga0207699_10085546 3300025906 Bacteria 1967
252 Ga0207684_10367550 3300025910 Bacteria 1238
253 Ga0207654_10013549 3300025911 Bacteria 4195
254 Ga0207654_10015786 3300025911 Bacteria 3925
255 Ga0207654_10038916 3300025911 Bacteria 2672
256 Ga0207654_10096190 3300025911 Unclassified 1815
257 Ga0207654_10172849 3300025911 Bacteria 1404
258 Ga0207707_10011060 3300025912 Bacteria 7849
259 Ga0207707_10012776 3300025912 Bacteria 7304
260 Ga0207707_10087318 3300025912 Unclassified 2725
261 Ga0207695_10000391 3300025913 Bacteria 98481
262 Ga0207695_10002384 3300025913 Bacteria 27871
263 Ga0207695_10010532 3300025913 Bacteria 11307
264 Ga0207695_10011537 3300025913 Bacteria 10692
265 Ga0207695_10067113 3300025913 Bacteria 3681
266 Ga0207695_10072599 3300025913 Bacteria 3510
267 Ga0207695_10495425 3300025913 Unclassified 1104
268 Ga0207671_10034569 3300025914 Bacteria 3754
269 Ga0207671_10082346 3300025914 Unclassified 2415
270 Ga0207671_10132192 3300025914 Bacteria 1916
271 Ga0207671_10138715 3300025914 Unclassified 1872
272 Ga0207671_10204025 3300025914 Unclassified 1544
273 Ga0207671_10290548 3300025914 Bacteria 1290
274 Ga0207693_10041952 3300025915 Bacteria 3601
275 Ga0207693_10187643 3300025915 Unclassified 1627
276 Ga0207663_10096302 3300025916 Unclassified 1976
277 Ga0207660_10014266 3300025917 Bacteria 5221
278 Ga0207660_10230786 3300025917 Unclassified 1455
279 Ga0207657_10052403 3300025919 Unclassified 3541
280 Ga0207657_10183022 3300025919 Bacteria 1693
281 Ga0207657_10232671 3300025919 Bacteria 1473
282 Ga0207649_10023396 3300025920 Bacteria 3578
283 Ga0207649_10107639 3300025920 Unclassified 1857
284 Ga0207649_10308229 3300025920 Unclassified 1160
285 Ga0207652_10161237 3300025921 Bacteria 2010
286 Ga0207681_10349721 3300025923 Bacteria 1183
287 Ga0207694_10005810 3300025924 Bacteria 9454
288 Ga0207694_10054851 3300025924 Bacteria 3093
289 Ga0207694_10074865 3300025924 Bacteria 2650
290 Ga0207687_10005183 3300025927 Bacteria 8645
291 Ga0207687_10011059 3300025927 Bacteria 5900
292 Ga0207687_10013587 3300025927 Bacteria 5315
293 Ga0207687_10023570 3300025927 Unclassified 4105
294 Ga0207687_10166716 3300025927 Bacteria 1695
295 Ga0207700_10045865 3300025928 Bacteria 3229
296 Ga0207700_10143868 3300025928 Bacteria 1963
297 Ga0207700_10217159 3300025928 Unclassified 1619
298 Ga0207690_10109149 3300025932 Bacteria 1990
299 Ga0207706_10152157 3300025933 Bacteria 2035
300 Ga0207706_10155928 3300025933 Bacteria 2008
301 Ga0207686_10004810 3300025934 Bacteria 7252
302 Ga0207686_10009921 3300025934 Bacteria 5175
303 Ga0207686_10016942 3300025934 Bacteria 4095
304 Ga0207686_10052158 3300025934 Bacteria 2551
305 Ga0207709_10033072 3300025935 Unclassified 3033
306 Ga0207704_10205357 3300025938 Bacteria 1445
307 Ga0207665_10190559 3300025939 Bacteria 1489
308 Ga0207711_10013815 3300025941 Bacteria 6703
309 Ga0207711_10304955 3300025941 Unclassified 1469
310 Ga0207689_10049889 3300025942 Bacteria 3453
311 Ga0207689_10058674 3300025942 Unclassified 3165
312 Ga0207689_10446176 3300025942 Bacteria 1081
313 Ga0207661_10000019 3300025944 Bacteria 235900
314 Ga0207661_10024196 3300025944 Bacteria 4599
315 Ga0207661_10026207 3300025944 Unclassified 4439
316 Ga0207661_10070651 3300025944 Unclassified 2851
317 Ga0207661_10100367 3300025944 Bacteria 2429
318 Ga0207661_10124797 3300025944 Unclassified 2197
319 Ga0207661_10446084 3300025944 Bacteria 1178
320 Ga0207679_10098009 3300025945 Unclassified 2285
321 Ga0207667_10003404 3300025949 Bacteria 19635
322 Ga0207667_10019198 3300025949 Bacteria 7644
323 Ga0207667_10032642 3300025949 Bacteria 5607
324 Ga0207667_10041967 3300025949 Bacteria 4865
325 Ga0207667_10065567 3300025949 Bacteria 3787
326 Ga0207667_10322446 3300025949 Bacteria 1578
327 Ga0207667_10330324 3300025949 Bacteria 1557
328 Ga0207651_10035302 3300025960 Bacteria 3249
329 Ga0207651_10198586 3300025960 Bacteria 1606
330 Ga0207651_10308577 3300025960 Bacteria 1318
331 Ga0207712_10005651 3300025961 Bacteria 7888
332 Ga0207712_10424186 3300025961 Unclassified 1123
333 Ga0207640_10323685 3300025981 Bacteria 1228
334 Ga0207658_10018393 3300025986 Bacteria 4826
335 Ga0207658_10053961 3300025986 Bacteria 2972
336 Ga0207677_10146413 3300026023 Bacteria 1816
337 Ga0207677_10537366 3300026023 Unclassified 1017
338 Ga0207703_10005186 3300026035 Bacteria 10529
339 Ga0207703_10038621 3300026035 Bacteria 3811
340 Ga0207703_10038809 3300026035 Bacteria 3803
341 Ga0207703_10136128 3300026035 Bacteria 2127
342 Ga0207703_10199554 3300026035 Bacteria 1777
343 Ga0207639_10014319 3300026041 Bacteria 5574
344 Ga0207639_10359157 3300026041 Bacteria 1303
345 Ga0207702_10002595 3300026078 Bacteria 16977
346 Ga0207702_10010108 3300026078 Bacteria 7907
347 Ga0207702_10014908 3300026078 Bacteria 6446
348 Ga0207702_10035891 3300026078 Bacteria 4146
349 Ga0207702_10161464 3300026078 Bacteria 2047
350 Ga0207702_10299571 3300026078 Bacteria 1525
351 Ga0207641_10052665 3300026088 Bacteria 3448
352 Ga0207641_10147173 3300026088 Bacteria 2131
353 Ga0207641_10264221 3300026088 Bacteria 1613
354 Ga0207648_10019833 3300026089 Bacteria 6067
355 Ga0207648_10104829 3300026089 Bacteria 2480
356 Ga0207648_10293523 3300026089 Unclassified 1456
357 Ga0207674_10001618 3300026116 Bacteria 28986
358 Ga0207674_10002324 3300026116 Bacteria 24081
359 Ga0207683_10009506 3300026121 Bacteria 8287
360 Ga0207683_10111483 3300026121 Bacteria 2450
361 Ga0207698_10059471 3300026142 Bacteria 2968
362 Ga0268266_10003350 3300028379 Bacteria 16039
363 Ga0268266_10197063 3300028379 Bacteria 1842
364 Ga0268266_10204213 3300028379 Bacteria 1810
365 Ga0268266_10470307 3300028379 Bacteria 1197
366 Ga0268264_10012605 3300028381 Bacteria 6964
367 Ga0268264_10125179 3300028381 Bacteria 2270
368 Ga0265323_10000494 3300028653 Bacteria 22202
369 Ga0265338_10147195 3300028800 Bacteria 1836
370 Ga0265324_10024448 3300029957 Bacteria 2145
371 Ga0265328_10004602 3300031239 Bacteria 5976
372 Ga0265320_10002096 3300031240 Bacteria 14041
373 Ga0265325_10028825 3300031241 Bacteria 2989
374 Ga0265340_10013937 3300031247 Bacteria 4213
375 Ga0265331_10003637 3300031250 Bacteria 9844
376 Ga0265331_10016779 3300031250 Bacteria 3836
377 Ga0265316_10004383 3300031344 Bacteria 14067
378 Ga0265316_10034721 3300031344 Bacteria 4094
379 Ga0265316_10048762 3300031344 Bacteria 3341
380 Ga0265316_10051525 3300031344 Bacteria 3233
381 Ga0265316_10148786 3300031344 Bacteria 1755
382 Ga0265313_10003403 3300031595 Bacteria 12897
383 Ga0265314_10007071 3300031711 Bacteria 9794
384 Ga0265314_10029624 3300031711 Bacteria 4064
385 Ga0265314_10062338 3300031711 Bacteria 2534
386 Ga0265342_10029625 3300031712 Bacteria 3397
387 Ga0373926_0065275 3300035083 Bacteria 1331
388 Ga0373934_0004488 3300035086 Bacteria 5155
389 Ga0373923_0006278 3300035111 Bacteria 4097
390 Ga0373923_0056041 3300035111 Bacteria 1663
391 Ga0373953_0100207 3300035117 Bacteria 1219
392 Ga0373954_0004934 3300035118 Bacteria 5761
393 Ga0373943_0065179 3300035170 Bacteria 1831
394 Ga0373943_0122629 3300035170 Bacteria 1383
395 Ga0373955_0018248 3300035172 Bacteria 3486
396 Ga0373955_0088309 3300035172 Bacteria 1763
397 Ga0373955_0269999 3300035172 Unclassified 1022
398 Ga0373935_0023558 3300035692 Bacteria 3784
399 Ga0373927_0000811 3300035695 Bacteria 23915
400 Ga0373927_0001052 3300035695 Bacteria 21044
401 Ga0373927_0001406 3300035695 Bacteria 18142
402 Ga0373927_0036360 3300035695 Bacteria 3203
403 Ga0373927_0047091 3300035695 Bacteria 2789
404 Ga0373927_0086915 3300035695 Bacteria 2030
405 Ga0373933_0007086 3300035724 Bacteria 6108
406 Ga0373933_0035941 3300035724 Bacteria 2897
407 Ga0373933_0089740 3300035724 Bacteria 1895
408 Ga0373933_0159286 3300035724 Bacteria 1433
409 Ga0373947_0062259 3300035725 Bacteria 2270
410 Ga0373947_0064560 3300035725 Bacteria 2232
411 Ga0373947_0091199 3300035725 Unclassified 1901
412 Ga0373947_0101524 3300035725 Bacteria 1809
413 Ga0373947_0124228 3300035725 Bacteria 1642
414 Ga0373937_0004135 3300036401 Bacteria 12311
415 Ga0373937_0022825 3300036401 Bacteria 5629
416 Ga0373937_0030704 3300036401 Bacteria 4866
417 Ga0373937_0039054 3300036401 Bacteria 4326
418 Ga0373937_0096547 3300036401 Bacteria 2741
419 Ga0373937_0117988 3300036401 Unclassified 2472
420 Ga0373925_0000480 3300037068 Bacteria 39960
421 Ga0373925_0027022 3300037068 Bacteria 4202
422 Ga0373925_0028602 3300037068 Bacteria 4084
423 Ga0373925_0030600 3300037068 Bacteria 3951
424 Ga0373925_0251116 3300037068 Bacteria 1418
425 Ga0395900_0041293 3300037418 Bacteria 4756
426 Ga0395900_0208570 3300037418 Bacteria 1974
427 Ga0395900_0350549 3300037418 Bacteria 1450
428 Ga0395905_0297946 3300037471 Unclassified 1500
429 Ga0436364_0020602 3300037853 Bacteria 30148
430 Ga0436364_0087697 3300037853 Bacteria 10011
431 Ga0436364_0145635 3300037853 Bacteria 1248
432 Ga0436364_0269053 3300037853 Bacteria 3339
433 Ga0436364_0287040 3300037853 Unclassified 1256
434 Ga0436364_0936420 3300037853 Bacteria 3941
435 Ga0436364_1051074 3300037853 Bacteria 18524
436 Ga0436364_1434597 3300037853 Bacteria 3998
437 Ga0436364_1471158 3300037853 Bacteria 8148
438 Ga0436365_0252921 3300039437 Bacteria 2596
439 Ga0436365_0441733 3300039437 Unclassified 1986
440 Ga0436365_0719625 3300039437 Bacteria 2683
441 Ga0436365_0787679 3300039437 Unclassified 1685
442 Ga0436365_0934403 3300039437 Bacteria 1969
443 Ga0436365_1067551 3300039437 Bacteria 4909
444 Ga0436365_1243497 3300039437 Bacteria 1179
445 Ga0436365_1462955 3300039437 Bacteria 6634
446 Ga0436360_0920496 3300039438 Bacteria 2235
447 Ga0436360_1173770 3300039438 Bacteria 1706
448 Ga0436361_0017849 3300039447 Bacteria 2312
449 Ga0436361_0824041 3300039447 Bacteria 75383
450 Ga0436363_0752428 3300039450 Bacteria 1301
451 Ga0436363_1368445 3300039450 Unclassified 3171
452 Ga0436362_0793147 3300039453 Unclassified 2332
453 Ga0436362_1129435 3300039453 Bacteria 6647
454 Ga0453683_0235465 3300044673 Bacteria 1166
455 Ga0453684_0099265 3300044712 Archaea 3567
456 Ga0466959_0285029 3300045049 Bacteria 1133
457 Ga0451576_0027465 3300045051 Bacteria 6112
458 Ga0451576_0264768 3300045051 Bacteria 1797
459 Ga0451576_0368069 3300045051 Bacteria 1506
460 Ga0451576_0389940 3300045051 Bacteria 1460
461 Ga0451576_0481780 3300045051 Bacteria 1303
462 Ga0451576_0586957 3300045051 Bacteria 1171
463 Ga0466958_0049999 3300045836 Bacteria 2531
464 Ga0466967_0044380 3300045976 Bacteria 3856
465 Ga0495592_0004706 3300046454 Bacteria 10011
466 Ga0495651_0013846 3300046462 Bacteria 6238
467 Ga0495651_0035383 3300046462 Bacteria 3888
468 Ga0495653_0047626 3300046463 Bacteria 3315
469 Ga0495653_0116758 3300046463 Bacteria 1908
470 Ga0495580_0001811 3300046472 Bacteria 18805
471 Ga0495580_0005973 3300046472 Bacteria 9975
472 Ga0495580_0022406 3300046472 Bacteria 4648
473 Ga0495580_0023546 3300046472 Bacteria 4520
474 Ga0495580_0046062 3300046472 Bacteria 3096
475 Ga0495580_0053127 3300046472 Bacteria 2860
476 Ga0495580_0194441 3300046472 Bacteria 1399
477 Ga0495580_0304982 3300046472 Unclassified 1084
478 Ga0495582_0037720 3300046473 Bacteria 2658
479 Ga0495662_0045764 3300046476 Bacteria 2112
480 Ga0495664_0002499 3300046477 Bacteria 9875
481 Ga0495628_0017443 3300046516 Bacteria 5977
482 Ga0495652_0031436 3300046529 Bacteria 4650
483 Ga0495665_0038421 3300046531 Bacteria 2552
484 Ga0495665_0082455 3300046531 Bacteria 1691
485 Ga0495640_0011227 3300046533 Bacteria 6896
486 Ga0495587_0007340 3300046536 Bacteria 7145
487 Ga0495587_0029160 3300046536 Unclassified 3352
488 Ga0495645_0009582 3300046543 Bacteria 6775
489 Ga0495667_0005114 3300046559 Bacteria 8862
490 Ga0495667_0045212 3300046559 Bacteria 2916
491 Ga0495634_0023461 3300046642 Bacteria 4337
492 Ga0495634_0133849 3300046642 Bacteria 1578
493 Ga0495635_0063723 3300046663 Bacteria 2531
494 Ga0495599_0015749 3300046678 Bacteria 4693
495 Ga0495599_0120609 3300046678 Bacteria 1630
496 Ga0495623_0027157 3300046679 Bacteria 3681
497 Ga0495646_0051446 3300046680 Bacteria 2493
498 Ga0495658_0152528 3300046683 Bacteria 1420
499 Ga0495613_0025094 3300046689 Bacteria 4442
500 Ga0495613_0289480 3300046689 Bacteria 1136
501 Ga0495624_0214447 3300046690 Bacteria 1167
502 Ga0495604_0089762 3300047317 Bacteria 2284
503 Ga0495636_0043740 3300047318 Bacteria 1864
504 Ga0495674_0061045 3300047319 Bacteria 3287
505 Ga0495674_0074703 3300047319 Bacteria 2918
506 Ga0495674_0150425 3300047319 Bacteria 1952
507 Ga0495680_0123761 3300047322 Bacteria 1907
508 Ga0495675_0088355 3300047444 Bacteria 1947
509 Ga0495675_0095498 3300047444 Unclassified 1864
510 Ga0495675_0102603 3300047444 Bacteria 1789
511 Ga0495684_0014023 3300047471 Bacteria 6165
512 Ga0495684_0021489 3300047471 Bacteria 4968
513 Ga0495684_0028462 3300047471 Bacteria 4290
514 Ga0495684_0153526 3300047471 Unclassified 1720
515 Ga0495684_0345044 3300047471 Unclassified 1059
516 Ga0495602_0133251 3300048088 Bacteria 1978
517 Ga0496112_0055136 3300048915 Bacteria 3907
518 Ga0496112_0439793 3300048915 Bacteria 1242
519 Ga0496115_0004558 3300048918 Bacteria 10028
520 Ga0496115_0049452 3300048918 Bacteria 3366
521 Ga0501308_004311 3300049128 Bacteria 1366
522 Ga0501309_008057 3300049129 Bacteria 1319
523 Ga0501305_007769 3300049161 Bacteria 1370
524 Ga0501312_007361 3300049528 Bacteria 1401
525 Ga0501324_003433 3300049540 Bacteria 1216
526 Ga0501031_0004453 3300049568 Bacteria 9090
527 Ga0501032_0002278 3300049569 Bacteria 15077
528 Ga0501033_0005380 3300049570 Bacteria 10144
529 Ga0501034_0010051 3300049571 Bacteria 9881
530 Ga0501034_0039290 3300049571 Bacteria 4793
531 Ga0501036_0000498 3300049572 Bacteria 28138
532 Ga0501037_0004945 3300049573 Bacteria 9694
533 Ga0501038_0013541 3300049574 Bacteria 7434
534 Ga0501038_0060691 3300049574 Bacteria 3236
535 Ga0501039_0036541 3300049575 Bacteria 3791
536 Ga0501043_0006639 3300049579 Bacteria 9259
537 Ga0501043_0124312 3300049579 Bacteria 2023
538 Ga0501046_0002887 3300049580 Bacteria 15937
539 Ga0501047_0008173 3300049581 Bacteria 9881
540 Ga0501047_0396364 3300049581 Bacteria 1214
541 Ga0501048_0006561 3300049582 Bacteria 8845
542 Ga0501067_0001266 3300049583 Bacteria 13736
543 Ga0501068_0000768 3300049584 Bacteria 16530
544 Ga0501068_0312964 3300049584 Bacteria 1006
545 Ga0501069_0003086 3300049585 Bacteria 8532
546 Ga0501070_0006405 3300049586 Bacteria 10015
547 Ga0501071_0268271 3300049587 Unclassified 1290
548 Ga0501072_0000320 3300049588 Bacteria 34200
549 Ga0501073_0000432 3300049589 Bacteria 28777
550 Ga0501074_0025861 3300049590 Bacteria 4258
551 Ga0501077_0000457 3300049593 Bacteria 24786
552 Ga0501079_0001554 3300049741 Bacteria 16270
553 Ga0501080_0000559 3300049742 Bacteria 29429
554 Ga0501083_0009706 3300049744 Bacteria 6796
555 Ga0501035_0018483 3300049822 Bacteria 6421
556 Ga0501035_0020551 3300049822 Bacteria 6064
557 Ga0501035_0097186 3300049822 Bacteria 2587
558 Ga0501044_0000253 3300049823 Bacteria 67988
559 Ga0501044_0014229 3300049823 Bacteria 8592
560 Ga0501044_0050019 3300049823 Bacteria 4314
561 Ga0501044_0144647 3300049823 Bacteria 2364
562 Ga0501044_0191539 3300049823 Bacteria 2007
563 Ga0501045_0061274 3300049824 Bacteria 2760
564 nmdc:mga0qj67_21192_c1 3300050509 Bacteria 4984
565 nmdc:mga06r32_42990_c1 3300050510 Bacteria 4298
566 nmdc:mga06r32_67845_c1 3300050510 Bacteria 3444
567 Ga0495619_0315063 3300053085 Bacteria 1083
568 Ga0500568_0000656 3300053139 Bacteria 24982
569 Ga0501084_0002969 3300054114 Bacteria 13736
570 Ga0501082_0000628 3300060353 Bacteria 31112
571 Ga0501082_0008060 3300060353 Bacteria 9088
572 Ga0501082_0128114 3300060353 Bacteria 2202
573 2792745462 2791355123 Bacteria 8049106
574 Ga0207648_10097614
575 Ga0070658_10244281
576 Ga0070676_10060553
577 Ga0070683_100000088
578 Ga0070683_100013541
579 Ga0070683_100017865
580 Ga0070683_100134386
581 Ga0070683_100165594
582 Ga0070683_100189414
583 Ga0070690_100017887
584 Ga0070690_100111354
585 Ga0070666_10079584
586 Ga0070680_100001004
587 Ga0068868_100228087
588 Ga0070660_100040735
589 Ga0070660_100184981
590 Ga0070660_100217315
591 Ga0070689_100447917
592 Ga0070691_10001000
593 Ga0070661_100036013
594 Ga0070661_100121334
595 Ga0070675_100486743
596 Ga0070671_100179309
597 Ga0070673_100006269
598 Ga0070659_100154364
599 Ga0070667_100084531
600 Ga0070667_100254016
601 Ga0070709_10039571
602 Ga0070714_100012105
603 Ga0070713_100023532
604 Ga0070713_100043351
605 Ga0070713_100121765
606 Ga0070713_100610097
607 Ga0070711_100040475
608 Ga0070708_100322626
609 Ga0070678_100057154
610 Ga0070662_100060648
611 Ga0070681_10035370
612 Ga0070681_10112837
613 Ga0070681_10112853
614 Ga0070681_10232530
615 Ga0070681_10260108
616 Ga0070681_10348705
617 Ga0070681_10408626
618 Ga0068867_100243813
619 Ga0070685_10235881
620 Ga0070706_100426425
621 Ga0070679_100178351
622 Ga0070679_100269283
623 Ga0070684_100000003
624 Ga0070684_100000798
625 Ga0070684_100055924
626 Ga0070684_100125929
627 Ga0070684_100192983
628 Ga0068853_100003008
629 Ga0068853_100290860
630 Ga0068853_100372791
631 Ga0070672_100252879
632 Ga0070696_100015763
633 Ga0070665_100001546
634 Ga0070665_100168791
635 Ga0070665_100675888
636 Ga0068855_100002936
637 Ga0068855_100003533
638 Ga0068855_100010435
639 Ga0068855_100015926
640 Ga0068855_100017262
641 Ga0068855_100027065
642 Ga0068855_100094149
643 Ga0068855_100366234
644 Ga0070664_100191325
645 Ga0070664_100219813
646 Ga0068857_100001280
647 Ga0068857_100023692
648 Ga0068857_100233536
649 Ga0068856_100002863
650 Ga0068856_100005113
651 Ga0068856_100006893
652 Ga0068856_100018477
653 Ga0068856_100042307
654 Ga0068856_100079593
655 Ga0068856_100104537
656 Ga0068856_100141082
657 Ga0068856_100166505
658 Ga0068852_100124908
659 Ga0068852_100297709
660 Ga0068859_100101811
661 Ga0068859_100320865
662 Ga0068859_100459754
663 Ga0068863_100036579
664 Ga0068863_100142828
665 Ga0068863_100155700
666 Ga0068863_100407093
667 Ga0068858_100017291
668 Ga0068858_100032804
669 Ga0068858_100040760
670 Ga0068858_100065708
671 Ga0068860_100016589
672 Ga0068860_100184793
673 Ga0081455_10040858
674 Ga0070717_10013700
675 Ga0070717_10058973
676 Ga0070717_10277445
677 Ga0070717_10349896
678 Ga0070716_100160288
679 Ga0070712_100031011
680 Ga0070712_100113679
681 Ga0097621_100026689
682 Ga0097621_100046214
683 Ga0097621_100096436
684 Ga0097621_100116672
685 Ga0097621_100139108
686 Ga0097621_100156443
687 Ga0068871_100014312
688 Ga0068871_100066982
689 Ga0068871_100116433
690 Ga0068871_100126839
691 Ga0068871_100232699
692 Ga0068871_100429969
693 Ga0075430_100092214
694 Ga0075431_100002583
695 Ga0075431_100462388
696 Ga0075433_10482316
697 Ga0068865_100429334
698 Ga0075436_100021352
699 Ga0097620_100101811
700 Ga0097620_100320847
701 Ga0097620_100459798
702 Ga0105240_10000519
703 Ga0105240_10000877
704 Ga0105240_10001298
705 Ga0105240_10077441
706 Ga0105240_10239292
707 Ga0105240_10246183
708 Ga0105245_10007593
709 Ga0105245_10015249
710 Ga0105245_10021042
711 Ga0105245_10021645
712 Ga0105245_10028778
713 Ga0105245_10062270
714 Ga0105245_10213509
715 Ga0105247_10070015
716 Ga0105247_10147098
717 Ga0114129_10430575
718 Ga0105243_10106225
719 Ga0105241_10007088
720 Ga0105241_10008537
721 Ga0105241_10009610
722 Ga0105241_10093260
723 Ga0105241_10228015
724 Ga0105241_10252869
725 Ga0105241_10387611
726 Ga0105241_10478017
727 Ga0105242_10006709
728 Ga0105242_10040533
729 Ga0105248_10017829
730 Ga0105248_10050021
731 Ga0105248_10121372
732 Ga0105248_10152825
733 Ga0105248_10171603
734 Ga0105248_10221119
735 Ga0105248_10368416
736 Ga0105237_10004151
737 Ga0105237_10091785
738 Ga0105237_10103718
739 Ga0105237_10150325
740 Ga0105237_10237127
741 Ga0105237_10333944
742 Ga0105237_10550479
743 Ga0105238_10091364
744 Ga0105238_10110087
745 Ga0105249_10010890
746 Ga0105249_10244807
747 Ga0105249_10326903
748 Ga0105239_10002634
749 Ga0105239_10007999
750 Ga0105239_10013772
751 Ga0105239_10034304
752 Ga0105239_10036180
753 Ga0105239_10058970
754 Ga0105239_10145939
755 Ga0105239_10184746
756 Ga0105239_10195433
757 Ga0105246_10051147
758 Ga0105246_10148761
759 Ga0157373_10027411
760 Ga0157373_10048423
761 Ga0157370_10002850
762 Ga0157370_10013208
763 Ga0157370_10092229
764 Ga0157370_10094080
765 Ga0157369_10006968
766 Ga0157369_10007301
767 Ga0157369_10013990
768 Ga0157369_10018191
769 Ga0157374_10036825
770 Ga0157374_10082792
771 Ga0157374_10088526
772 Ga0157374_10096229
773 Ga0157374_10266467
774 Ga0157374_10353807
775 Ga0157378_10003184
776 Ga0157378_10084266
777 Ga0163162_10058958
778 Ga0163162_10477695
779 Ga0163162_10489753
780 Ga0157372_10040395
781 Ga0157372_10093476
782 Ga0157372_10094674
783 Ga0157372_10136835
784 Ga0157372_10215777
785 Ga0157372_10515169
786 Ga0157372_10693269
787 Ga0157375_10110752
788 Ga0157375_10255927
789 Ga0157375_10322427
790 Ga0157375_10462674
791 Ga0157375_10906337
792 Ga0163163_10006504
793 Ga0163163_10028360
794 Ga0163163_10052123
795 Ga0163163_10071793
796 Ga0163163_10151640
797 Ga0163163_10182093
798 Ga0163163_10250851
799 Ga0163163_10367207
800 Ga0163163_10416490
801 Ga0157379_10016384
802 Ga0157379_10142060
803 Ga0157379_10610207
804 Ga0157376_10054882
805 Ga0157376_10181092
806 Ga0157376_10199553
807 Ga0157376_10312107
808 Ga0157376_10421879
809 Ga0206350_11593772
810 Ga0213872_10000111
811 Ga0213876_10042471
812 Ga0213876_10085482
813 Ga0213876_10096881
814 Ga0213876_10135899
815 Ga0213875_10004682
816 Ga0213875_10070087
817 Ga0213875_10077069
818 Ga0213875_10164853
819 Ga0224712_10062530
820 Ga0207710_10049490
821 Ga0207680_10102176
822 Ga0207680_10223671
823 Ga0207699_10014678
824 Ga0207699_10085546
825 Ga0207684_10367550
826 Ga0207654_10013549
827 Ga0207654_10015786
828 Ga0207654_10038916
829 Ga0207654_10096190
830 Ga0207654_10172849
831 Ga0207707_10011060
832 Ga0207707_10012776
833 Ga0207707_10087318
834 Ga0207695_10000391
835 Ga0207695_10002384
836 Ga0207695_10010532
837 Ga0207695_10011537
838 Ga0207695_10067113
839 Ga0207695_10072599
840 Ga0207695_10495425
841 Ga0207671_10034569
842 Ga0207671_10082346
843 Ga0207671_10132192
844 Ga0207671_10138715
845 Ga0207671_10204025
846 Ga0207671_10290548
847 Ga0207693_10041952
848 Ga0207693_10187643
849 Ga0207663_10096302
850 Ga0207660_10014266
851 Ga0207660_10230786
852 Ga0207657_10052403
853 Ga0207657_10183022
854 Ga0207657_10232671
855 Ga0207649_10023396
856 Ga0207649_10107639
857 Ga0207649_10308229
858 Ga0207652_10161237
859 Ga0207681_10349721
860 Ga0207694_10005810
861 Ga0207694_10054851
862 Ga0207694_10074865
863 Ga0207687_10005183
864 Ga0207687_10011059
865 Ga0207687_10013587
866 Ga0207687_10023570
867 Ga0207687_10166716
868 Ga0207700_10045865
869 Ga0207700_10143868
870 Ga0207700_10217159
871 Ga0207690_10109149
872 Ga0207706_10152157
873 Ga0207706_10155928
874 Ga0207686_10004810
875 Ga0207686_10009921
876 Ga0207686_10016942
877 Ga0207686_10052158
878 Ga0207709_10033072
879 Ga0207704_10205357
880 Ga0207665_10190559
881 Ga0207711_10013815
882 Ga0207711_10304955
883 Ga0207689_10049889
884 Ga0207689_10058674
885 Ga0207689_10446176
886 Ga0207661_10000019
887 Ga0207661_10024196
888 Ga0207661_10026207
889 Ga0207661_10070651
890 Ga0207661_10100367
891 Ga0207661_10124797
892 Ga0207661_10446084
893 Ga0207679_10098009
894 Ga0207667_10003404
895 Ga0207667_10019198
896 Ga0207667_10032642
897 Ga0207667_10041967
898 Ga0207667_10065567
899 Ga0207667_10322446
900 Ga0207667_10330324
901 Ga0207651_10035302
902 Ga0207651_10198586
903 Ga0207651_10308577
904 Ga0207712_10005651
905 Ga0207712_10424186
906 Ga0207640_10323685
907 Ga0207658_10018393
908 Ga0207658_10053961
909 Ga0207677_10146413
910 Ga0207677_10537366
911 Ga0207703_10005186
912 Ga0207703_10038621
913 Ga0207703_10038809
914 Ga0207703_10136128
915 Ga0207703_10199554
916 Ga0207639_10014319
917 Ga0207639_10359157
918 Ga0207702_10002595
919 Ga0207702_10010108
920 Ga0207702_10014908
921 Ga0207702_10035891
922 Ga0207702_10161464
923 Ga0207702_10299571
924 Ga0207641_10052665
925 Ga0207641_10147173
926 Ga0207641_10264221
927 Ga0207648_10019833
928 Ga0207648_10104829
929 Ga0207648_10293523
930 Ga0207674_10001618
931 Ga0207674_10002324
932 Ga0207683_10009506
933 Ga0207683_10111483
934 Ga0207698_10059471
935 Ga0268266_10003350
936 Ga0268266_10197063
937 Ga0268266_10204213
938 Ga0268266_10470307
939 Ga0268264_10012605
940 Ga0268264_10125179
941 Ga0265323_10000494
942 Ga0265338_10147195
943 Ga0265324_10024448
944 Ga0265328_10004602
945 Ga0265320_10002096
946 Ga0265325_10028825
947 Ga0265340_10013937
948 Ga0265331_10003637
949 Ga0265331_10016779
950 Ga0265316_10004383
951 Ga0265316_10034721
952 Ga0265316_10048762
953 Ga0265316_10051525
954 Ga0265316_10148786
955 Ga0265313_10003403
956 Ga0265314_10007071
957 Ga0265314_10029624
958 Ga0265314_10062338
959 Ga0265342_10029625
960 Ga0373926_0065275
961 Ga0373934_0004488
962 Ga0373923_0006278
963 Ga0373923_0056041
964 Ga0373953_0100207
965 Ga0373954_0004934
966 Ga0373943_0065179
967 Ga0373943_0122629
968 Ga0373955_0018248
969 Ga0373955_0088309
970 Ga0373955_0269999
971 Ga0373935_0023558
972 Ga0373927_0000811
973 Ga0373927_0001052
974 Ga0373927_0001406
975 Ga0373927_0036360
976 Ga0373927_0047091
977 Ga0373927_0086915
978 Ga0373933_0007086
979 Ga0373933_0035941
980 Ga0373933_0089740
981 Ga0373933_0159286
982 Ga0373947_0062259
983 Ga0373947_0064560
984 Ga0373947_0091199
985 Ga0373947_0101524
986 Ga0373947_0124228
987 Ga0373937_0004135
988 Ga0373937_0022825
989 Ga0373937_0030704
990 Ga0373937_0039054
991 Ga0373937_0096547
992 Ga0373937_0117988
993 Ga0373925_0000480
994 Ga0373925_0027022
995 Ga0373925_0028602
996 Ga0373925_0030600
997 Ga0373925_0251116
998 Ga0395900_0041293
999 Ga0395900_0208570
1000 Ga0395900_0350549
1001 Ga0395905_0297946
1002 Ga0436364_0020602
1003 Ga0436364_0087697
1004 Ga0436364_0145635
1005 Ga0436364_0269053
1006 Ga0436364_0287040
1007 Ga0436364_0936420
1008 Ga0436364_1051074
1009 Ga0436364_1434597
1010 Ga0436364_1471158
1011 Ga0436365_0252921
1012 Ga0436365_0441733
1013 Ga0436365_0719625
1014 Ga0436365_0787679
1015 Ga0436365_0934403
1016 Ga0436365_1067551
1017 Ga0436365_1243497
1018 Ga0436365_1462955
1019 Ga0436360_0920496
1020 Ga0436360_1173770
1021 Ga0436361_0017849
1022 Ga0436361_0824041
1023 Ga0436363_0752428
1024 Ga0436363_1368445
1025 Ga0436362_0793147
1026 Ga0436362_1129435
1027 Ga0453683_0235465
1028 Ga0453684_0099265
1029 Ga0466959_0285029
1030 Ga0451576_0027465
1031 Ga0451576_0264768
1032 Ga0451576_0368069
1033 Ga0451576_0389940
1034 Ga0451576_0481780
1035 Ga0451576_0586957
1036 Ga0466958_0049999
1037 Ga0466967_0044380
1038 Ga0495592_0004706
1039 Ga0495651_0013846
1040 Ga0495651_0035383
1041 Ga0495653_0047626
1042 Ga0495653_0116758
1043 Ga0495580_0001811
1044 Ga0495580_0005973
1045 Ga0495580_0022406
1046 Ga0495580_0023546
1047 Ga0495580_0046062
1048 Ga0495580_0053127
1049 Ga0495580_0194441
1050 Ga0495580_0304982
1051 Ga0495582_0037720
1052 Ga0495662_0045764
1053 Ga0495664_0002499
1054 Ga0495628_0017443
1055 Ga0495652_0031436
1056 Ga0495665_0038421
1057 Ga0495665_0082455
1058 Ga0495640_0011227
1059 Ga0495587_0007340
1060 Ga0495587_0029160
1061 Ga0495645_0009582
1062 Ga0495667_0005114
1063 Ga0495667_0045212
1064 Ga0495634_0023461
1065 Ga0495634_0133849
1066 Ga0495635_0063723
1067 Ga0495599_0015749
1068 Ga0495599_0120609
1069 Ga0495623_0027157
1070 Ga0495646_0051446
1071 Ga0495658_0152528
1072 Ga0495613_0025094
1073 Ga0495613_0289480
1074 Ga0495624_0214447
1075 Ga0495604_0089762
1076 Ga0495636_0043740
1077 Ga0495674_0061045
1078 Ga0495674_0074703
1079 Ga0495674_0150425
1080 Ga0495680_0123761
1081 Ga0495675_0088355
1082 Ga0495675_0095498
1083 Ga0495675_0102603
1084 Ga0495684_0014023
1085 Ga0495684_0021489
1086 Ga0495684_0028462
1087 Ga0495684_0153526
1088 Ga0495684_0345044
1089 Ga0495602_0133251
1090 Ga0496112_0055136
1091 Ga0496112_0439793
1092 Ga0496115_0004558
1093 Ga0496115_0049452
1094 Ga0501308_004311
1095 Ga0501309_008057
1096 Ga0501305_007769
1097 Ga0501312_007361
1098 Ga0501324_003433
1099 Ga0501031_0004453
1100 Ga0501032_0002278
1101 Ga0501033_0005380
1102 Ga0501034_0010051
1103 Ga0501034_0039290
1104 Ga0501036_0000498
1105 Ga0501037_0004945
1106 Ga0501038_0013541
1107 Ga0501038_0060691
1108 Ga0501039_0036541
1109 Ga0501043_0006639
1110 Ga0501043_0124312
1111 Ga0501046_0002887
1112 Ga0501047_0008173
1113 Ga0501047_0396364
1114 Ga0501048_0006561
1115 Ga0501067_0001266
1116 Ga0501068_0000768
1117 Ga0501068_0312964
1118 Ga0501069_0003086
1119 Ga0501070_0006405
1120 Ga0501071_0268271
1121 Ga0501072_0000320
1122 Ga0501073_0000432
1123 Ga0501074_0025861
1124 Ga0501077_0000457
1125 Ga0501079_0001554
1126 Ga0501080_0000559
1127 Ga0501083_0009706
1128 Ga0501035_0018483
1129 Ga0501035_0020551
1130 Ga0501035_0097186
1131 Ga0501044_0000253
1132 Ga0501044_0014229
1133 Ga0501044_0050019
1134 Ga0501044_0144647
1135 Ga0501044_0191539
1136 Ga0501045_0061274
1137 nmdc:mga0qj67_21192_c1
1138 nmdc:mga06r32_42990_c1
1139 nmdc:mga06r32_67845_c1
1140 Ga0495619_0315063
1141 Ga0500568_0000656
1142 Ga0501084_0002969
1143 Ga0501082_0000628
1144 Ga0501082_0008060
1145 Ga0501082_0128114
1146 2792745462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02445

NadA

Quinolinate synthetase A protein

37

335

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4p-assembly1.cif.gz_A structure of the quinolinate synthase a84l variant complexed with citrate 0.9614 7 308
5lqm-assembly1.cif.gz_A structure of quinolinate synthase y21f mutant in complex with citrate 0.961 7 308
6ora-assembly2.cif.gz_B an unexpected intermediate in the reaction catalyzed by quinolinate synthase 0.9545 6 309
6f4l-assembly1.cif.gz_A structure of quinolinate synthase with inhibitor-derived quinolinate 0.9525 7 309
7p4q-assembly1.cif.gz_A structure of the quinolinate synthase s124a variant complexed with citrate 0.952 7 308
ID Description Score Start End Superfamily
af_Q57850_5_79_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9896 8 81 3.40.50.10800
af_P11458_25_111_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9781 8 83 3.40.50.10800
af_P9WJK1_121_190_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9711 94 163 3.40.50.10800
af_Q57850_5_79_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9638 8 81 3.40.50.10800
af_P9WJK1_121_190_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9577 94 163 3.40.50.10800
ID Description Score Start End GO Terms
AF-A0A350UMH4-F1-model_v4 Quinolinate synthase (EC 2.5.1.72) 0.9958 1 309 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A496RG29-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 0.9939 7 87 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A7C3LKM5-F1-model_v4 Quinolinate synthase (EC 2.5.1.72) 0.9916 1 259 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A356FV10-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 0.9911 64 174 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A6P0LQ32-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 0.9895 6 136 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539

Map