F465191
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 236 | 1146 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10097614|Ga0207648_100976142 |
| Length | 337 |
| Sequence | MQPGQNAVEELDLVATHVGAAVLDPPMTASGAESLVDEILELKRSRKAIILAHHYQVDEIQEIADVIGDSLELARKAQEFDGEVIAFCGVVFMAETAKVLNPTRTVVLPDLGAGCSLVDSCPADQIRAFRARNPEYVIVSYINTSVEVKAESDILCTSRNAVKIVNSIPADKPILFLPDINLGNWVKKQTGRQNMKIWQGACIVHATFAARRLTKTLSDHPNAWIVAHPECPAEVLAKANFIGSTSAIIDHCVASPHQEFIVMTESGVSHSLHKRAPGKTFHFVPNENCNCSECPYMRRNNLENLRDCLATLSPRIELSEVIIRRAALPIERMLAVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 84 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 134 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 135 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 141 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 149 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 156 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 157 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 158 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 159 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 160 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 161 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 234 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.6 |
| Metatranscriptomes | 1.22 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 0.7 |
| Rhizosphere | 94.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207648_10097614 | 3300026089 | Unclassified | 2571 |
| 2 | Ga0070658_10244281 | 3300005327 | Bacteria | 1522 |
| 3 | Ga0070676_10060553 | 3300005328 | Bacteria | 2249 |
| 4 | Ga0070683_100000088 | 3300005329 | Bacteria | 61766 |
| 5 | Ga0070683_100013541 | 3300005329 | Bacteria | 7117 |
| 6 | Ga0070683_100017865 | 3300005329 | Bacteria | 6269 |
| 7 | Ga0070683_100134386 | 3300005329 | Bacteria | 2342 |
| 8 | Ga0070683_100165594 | 3300005329 | Bacteria | 2097 |
| 9 | Ga0070683_100189414 | 3300005329 | Bacteria | 1953 |
| 10 | Ga0070690_100017887 | 3300005330 | Bacteria | 4273 |
| 11 | Ga0070690_100111354 | 3300005330 | Bacteria | 1827 |
| 12 | Ga0070666_10079584 | 3300005335 | Unclassified | 2238 |
| 13 | Ga0070680_100001004 | 3300005336 | Bacteria | 20106 |
| 14 | Ga0068868_100228087 | 3300005338 | Bacteria | 1562 |
| 15 | Ga0070660_100040735 | 3300005339 | Unclassified | 3537 |
| 16 | Ga0070660_100184981 | 3300005339 | Bacteria | 1687 |
| 17 | Ga0070660_100217315 | 3300005339 | Bacteria | 1553 |
| 18 | Ga0070689_100447917 | 3300005340 | Bacteria | 1098 |
| 19 | Ga0070691_10001000 | 3300005341 | Bacteria | 11585 |
| 20 | Ga0070661_100036013 | 3300005344 | Bacteria | 3597 |
| 21 | Ga0070661_100121334 | 3300005344 | Unclassified | 1958 |
| 22 | Ga0070675_100486743 | 3300005354 | Bacteria | 1110 |
| 23 | Ga0070671_100179309 | 3300005355 | Bacteria | 1793 |
| 24 | Ga0070673_100006269 | 3300005364 | Bacteria | 7715 |
| 25 | Ga0070659_100154364 | 3300005366 | Bacteria | 1874 |
| 26 | Ga0070667_100084531 | 3300005367 | Bacteria | 2720 |
| 27 | Ga0070667_100254016 | 3300005367 | Bacteria | 1572 |
| 28 | Ga0070709_10039571 | 3300005434 | Unclassified | 2893 |
| 29 | Ga0070714_100012105 | 3300005435 | Bacteria | 6871 |
| 30 | Ga0070713_100023532 | 3300005436 | Bacteria | 4781 |
| 31 | Ga0070713_100043351 | 3300005436 | Bacteria | 3678 |
| 32 | Ga0070713_100121765 | 3300005436 | Bacteria | 2289 |
| 33 | Ga0070713_100610097 | 3300005436 | Unclassified | 1037 |
| 34 | Ga0070711_100040475 | 3300005439 | Bacteria | 3144 |
| 35 | Ga0070708_100322626 | 3300005445 | Bacteria | 1455 |
| 36 | Ga0070678_100057154 | 3300005456 | Bacteria | 2857 |
| 37 | Ga0070662_100060648 | 3300005457 | Bacteria | 2759 |
| 38 | Ga0070681_10035370 | 3300005458 | Bacteria | 5017 |
| 39 | Ga0070681_10112837 | 3300005458 | Unclassified | 2658 |
| 40 | Ga0070681_10112853 | 3300005458 | Unclassified | 2658 |
| 41 | Ga0070681_10232530 | 3300005458 | Bacteria | 1757 |
| 42 | Ga0070681_10260108 | 3300005458 | Bacteria | 1647 |
| 43 | Ga0070681_10348705 | 3300005458 | Bacteria | 1391 |
| 44 | Ga0070681_10408626 | 3300005458 | Bacteria | 1269 |
| 45 | Ga0068867_100243813 | 3300005459 | Bacteria | 1458 |
| 46 | Ga0070685_10235881 | 3300005466 | Bacteria | 1205 |
| 47 | Ga0070706_100426425 | 3300005467 | Bacteria | 1234 |
| 48 | Ga0070679_100178351 | 3300005530 | Bacteria | 2097 |
| 49 | Ga0070679_100269283 | 3300005530 | Bacteria | 1658 |
| 50 | Ga0070684_100000003 | 3300005535 | Bacteria | 248527 |
| 51 | Ga0070684_100000798 | 3300005535 | Bacteria | 21897 |
| 52 | Ga0070684_100055924 | 3300005535 | Unclassified | 3442 |
| 53 | Ga0070684_100125929 | 3300005535 | Bacteria | 2307 |
| 54 | Ga0070684_100192983 | 3300005535 | Bacteria | 1854 |
| 55 | Ga0068853_100003008 | 3300005539 | Bacteria | 12867 |
| 56 | Ga0068853_100290860 | 3300005539 | Bacteria | 1508 |
| 57 | Ga0068853_100372791 | 3300005539 | Bacteria | 1332 |
| 58 | Ga0070672_100252879 | 3300005543 | Bacteria | 1484 |
| 59 | Ga0070696_100015763 | 3300005546 | Bacteria | 5080 |
| 60 | Ga0070665_100001546 | 3300005548 | Bacteria | 26568 |
| 61 | Ga0070665_100168791 | 3300005548 | Bacteria | 2190 |
| 62 | Ga0070665_100675888 | 3300005548 | Bacteria | 1046 |
| 63 | Ga0068855_100002936 | 3300005563 | Bacteria | 20841 |
| 64 | Ga0068855_100003533 | 3300005563 | Bacteria | 19108 |
| 65 | Ga0068855_100010435 | 3300005563 | Bacteria | 11207 |
| 66 | Ga0068855_100015926 | 3300005563 | Bacteria | 9045 |
| 67 | Ga0068855_100017262 | 3300005563 | Bacteria | 8686 |
| 68 | Ga0068855_100027065 | 3300005563 | Bacteria | 6860 |
| 69 | Ga0068855_100094149 | 3300005563 | Unclassified | 3454 |
| 70 | Ga0068855_100366234 | 3300005563 | Bacteria | 1585 |
| 71 | Ga0070664_100191325 | 3300005564 | Unclassified | 1823 |
| 72 | Ga0070664_100219813 | 3300005564 | Bacteria | 1699 |
| 73 | Ga0068857_100001280 | 3300005577 | Bacteria | 19741 |
| 74 | Ga0068857_100023692 | 3300005577 | Bacteria | 5404 |
| 75 | Ga0068857_100233536 | 3300005577 | Unclassified | 1682 |
| 76 | Ga0068856_100002863 | 3300005614 | Bacteria | 17656 |
| 77 | Ga0068856_100005113 | 3300005614 | Bacteria | 12961 |
| 78 | Ga0068856_100006893 | 3300005614 | Bacteria | 11113 |
| 79 | Ga0068856_100018477 | 3300005614 | Bacteria | 6756 |
| 80 | Ga0068856_100042307 | 3300005614 | Bacteria | 4481 |
| 81 | Ga0068856_100079593 | 3300005614 | Bacteria | 3250 |
| 82 | Ga0068856_100104537 | 3300005614 | Bacteria | 2826 |
| 83 | Ga0068856_100141082 | 3300005614 | Bacteria | 2417 |
| 84 | Ga0068856_100166505 | 3300005614 | Unclassified | 2215 |
| 85 | Ga0068852_100124908 | 3300005616 | Bacteria | 2361 |
| 86 | Ga0068852_100297709 | 3300005616 | Bacteria | 1560 |
| 87 | Ga0068859_100101811 | 3300005617 | Bacteria | 2930 |
| 88 | Ga0068859_100320865 | 3300005617 | Unclassified | 1643 |
| 89 | Ga0068859_100459754 | 3300005617 | Bacteria | 1369 |
| 90 | Ga0068863_100036579 | 3300005841 | Bacteria | 4677 |
| 91 | Ga0068863_100142828 | 3300005841 | Bacteria | 2288 |
| 92 | Ga0068863_100155700 | 3300005841 | Bacteria | 2188 |
| 93 | Ga0068863_100407093 | 3300005841 | Bacteria | 1331 |
| 94 | Ga0068858_100017291 | 3300005842 | Bacteria | 6764 |
| 95 | Ga0068858_100032804 | 3300005842 | Unclassified | 4823 |
| 96 | Ga0068858_100040760 | 3300005842 | Unclassified | 4307 |
| 97 | Ga0068858_100065708 | 3300005842 | Bacteria | 3357 |
| 98 | Ga0068860_100016589 | 3300005843 | Bacteria | 7183 |
| 99 | Ga0068860_100184793 | 3300005843 | Bacteria | 2015 |
| 100 | Ga0081455_10040858 | 3300005937 | Bacteria | 4086 |
| 101 | Ga0070717_10013700 | 3300006028 | Bacteria | 6221 |
| 102 | Ga0070717_10058973 | 3300006028 | Bacteria | 3175 |
| 103 | Ga0070717_10277445 | 3300006028 | Bacteria | 1486 |
| 104 | Ga0070717_10349896 | 3300006028 | Bacteria | 1321 |
| 105 | Ga0070716_100160288 | 3300006173 | Bacteria | 1457 |
| 106 | Ga0070712_100031011 | 3300006175 | Bacteria | 3599 |
| 107 | Ga0070712_100113679 | 3300006175 | Unclassified | 2025 |
| 108 | Ga0097621_100026689 | 3300006237 | Bacteria | 4534 |
| 109 | Ga0097621_100046214 | 3300006237 | Unclassified | 3522 |
| 110 | Ga0097621_100096436 | 3300006237 | Bacteria | 2482 |
| 111 | Ga0097621_100116672 | 3300006237 | Bacteria | 2261 |
| 112 | Ga0097621_100139108 | 3300006237 | Bacteria | 2074 |
| 113 | Ga0097621_100156443 | 3300006237 | Bacteria | 1957 |
| 114 | Ga0068871_100014312 | 3300006358 | Bacteria | 5910 |
| 115 | Ga0068871_100066982 | 3300006358 | Bacteria | 2945 |
| 116 | Ga0068871_100116433 | 3300006358 | Bacteria | 2253 |
| 117 | Ga0068871_100126839 | 3300006358 | Unclassified | 2161 |
| 118 | Ga0068871_100232699 | 3300006358 | Bacteria | 1600 |
| 119 | Ga0068871_100429969 | 3300006358 | Unclassified | 1180 |
| 120 | Ga0075430_100092214 | 3300006846 | Bacteria | 2533 |
| 121 | Ga0075431_100002583 | 3300006847 | Bacteria | 17495 |
| 122 | Ga0075431_100462388 | 3300006847 | Unclassified | 1263 |
| 123 | Ga0075433_10482316 | 3300006852 | Bacteria | 1092 |
| 124 | Ga0068865_100429334 | 3300006881 | Bacteria | 1088 |
| 125 | Ga0075436_100021352 | 3300006914 | Bacteria | 4445 |
| 126 | Ga0097620_100101811 | 3300006931 | Bacteria | 2930 |
| 127 | Ga0097620_100320847 | 3300006931 | Unclassified | 1643 |
| 128 | Ga0097620_100459798 | 3300006931 | Bacteria | 1369 |
| 129 | Ga0105240_10000519 | 3300009093 | Bacteria | 70908 |
| 130 | Ga0105240_10000877 | 3300009093 | Bacteria | 54159 |
| 131 | Ga0105240_10001298 | 3300009093 | Bacteria | 43175 |
| 132 | Ga0105240_10077441 | 3300009093 | Bacteria | 4097 |
| 133 | Ga0105240_10239292 | 3300009093 | Bacteria | 2105 |
| 134 | Ga0105240_10246183 | 3300009093 | Bacteria | 2070 |
| 135 | Ga0105245_10007593 | 3300009098 | Bacteria | 9495 |
| 136 | Ga0105245_10015249 | 3300009098 | Bacteria | 6695 |
| 137 | Ga0105245_10021042 | 3300009098 | Bacteria | 5722 |
| 138 | Ga0105245_10021645 | 3300009098 | Bacteria | 5643 |
| 139 | Ga0105245_10028778 | 3300009098 | Unclassified | 4903 |
| 140 | Ga0105245_10062270 | 3300009098 | Bacteria | 3366 |
| 141 | Ga0105245_10213509 | 3300009098 | Bacteria | 1858 |
| 142 | Ga0105247_10070015 | 3300009101 | Bacteria | 2191 |
| 143 | Ga0105247_10147098 | 3300009101 | Bacteria | 1549 |
| 144 | Ga0114129_10430575 | 3300009147 | Bacteria | 1733 |
| 145 | Ga0105243_10106225 | 3300009148 | Unclassified | 2340 |
| 146 | Ga0105241_10007088 | 3300009174 | Bacteria | 8255 |
| 147 | Ga0105241_10008537 | 3300009174 | Bacteria | 7533 |
| 148 | Ga0105241_10009610 | 3300009174 | Bacteria | 7109 |
| 149 | Ga0105241_10093260 | 3300009174 | Bacteria | 2379 |
| 150 | Ga0105241_10228015 | 3300009174 | Bacteria | 1569 |
| 151 | Ga0105241_10252869 | 3300009174 | Unclassified | 1495 |
| 152 | Ga0105241_10387611 | 3300009174 | Bacteria | 1223 |
| 153 | Ga0105241_10478017 | 3300009174 | Bacteria | 1107 |
| 154 | Ga0105242_10006709 | 3300009176 | Bacteria | 8881 |
| 155 | Ga0105242_10040533 | 3300009176 | Unclassified | 3753 |
| 156 | Ga0105248_10017829 | 3300009177 | Bacteria | 7836 |
| 157 | Ga0105248_10050021 | 3300009177 | Bacteria | 4687 |
| 158 | Ga0105248_10121372 | 3300009177 | Bacteria | 2948 |
| 159 | Ga0105248_10152825 | 3300009177 | Bacteria | 2604 |
| 160 | Ga0105248_10171603 | 3300009177 | Bacteria | 2444 |
| 161 | Ga0105248_10221119 | 3300009177 | Unclassified | 2132 |
| 162 | Ga0105248_10368416 | 3300009177 | Bacteria | 1617 |
| 163 | Ga0105237_10004151 | 3300009545 | Bacteria | 16880 |
| 164 | Ga0105237_10091785 | 3300009545 | Bacteria | 3027 |
| 165 | Ga0105237_10103718 | 3300009545 | Unclassified | 2836 |
| 166 | Ga0105237_10150325 | 3300009545 | Unclassified | 2325 |
| 167 | Ga0105237_10237127 | 3300009545 | Bacteria | 1825 |
| 168 | Ga0105237_10333944 | 3300009545 | Bacteria | 1520 |
| 169 | Ga0105237_10550479 | 3300009545 | Bacteria | 1160 |
| 170 | Ga0105238_10091364 | 3300009551 | Unclassified | 3032 |
| 171 | Ga0105238_10110087 | 3300009551 | Bacteria | 2735 |
| 172 | Ga0105249_10010890 | 3300009553 | Bacteria | 7993 |
| 173 | Ga0105249_10244807 | 3300009553 | Bacteria | 1775 |
| 174 | Ga0105249_10326903 | 3300009553 | Bacteria | 1546 |
| 175 | Ga0105239_10002634 | 3300010375 | Bacteria | 22663 |
| 176 | Ga0105239_10007999 | 3300010375 | Bacteria | 12071 |
| 177 | Ga0105239_10013772 | 3300010375 | Bacteria | 8977 |
| 178 | Ga0105239_10034304 | 3300010375 | Bacteria | 5572 |
| 179 | Ga0105239_10036180 | 3300010375 | Bacteria | 5422 |
| 180 | Ga0105239_10058970 | 3300010375 | Bacteria | 4213 |
| 181 | Ga0105239_10145939 | 3300010375 | Bacteria | 2639 |
| 182 | Ga0105239_10184746 | 3300010375 | Unclassified | 2333 |
| 183 | Ga0105239_10195433 | 3300010375 | Bacteria | 2265 |
| 184 | Ga0105246_10051147 | 3300011119 | Bacteria | 2836 |
| 185 | Ga0105246_10148761 | 3300011119 | Bacteria | 1770 |
| 186 | Ga0157373_10027411 | 3300013100 | Bacteria | 4109 |
| 187 | Ga0157373_10048423 | 3300013100 | Unclassified | 3030 |
| 188 | Ga0157370_10002850 | 3300013104 | Bacteria | 20653 |
| 189 | Ga0157370_10013208 | 3300013104 | Bacteria | 8516 |
| 190 | Ga0157370_10092229 | 3300013104 | Bacteria | 2843 |
| 191 | Ga0157370_10094080 | 3300013104 | Bacteria | 2812 |
| 192 | Ga0157369_10006968 | 3300013105 | Bacteria | 13031 |
| 193 | Ga0157369_10007301 | 3300013105 | Bacteria | 12721 |
| 194 | Ga0157369_10013990 | 3300013105 | Bacteria | 9068 |
| 195 | Ga0157369_10018191 | 3300013105 | Bacteria | 7881 |
| 196 | Ga0157374_10036825 | 3300013296 | Bacteria | 4484 |
| 197 | Ga0157374_10082792 | 3300013296 | Bacteria | 3047 |
| 198 | Ga0157374_10088526 | 3300013296 | Bacteria | 2949 |
| 199 | Ga0157374_10096229 | 3300013296 | Bacteria | 2832 |
| 200 | Ga0157374_10266467 | 3300013296 | Bacteria | 1688 |
| 201 | Ga0157374_10353807 | 3300013296 | Bacteria | 1460 |
| 202 | Ga0157378_10003184 | 3300013297 | Bacteria | 14580 |
| 203 | Ga0157378_10084266 | 3300013297 | Unclassified | 2878 |
| 204 | Ga0163162_10058958 | 3300013306 | Bacteria | 3869 |
| 205 | Ga0163162_10477695 | 3300013306 | Bacteria | 1378 |
| 206 | Ga0163162_10489753 | 3300013306 | Bacteria | 1361 |
| 207 | Ga0157372_10040395 | 3300013307 | Bacteria | 5152 |
| 208 | Ga0157372_10093476 | 3300013307 | Bacteria | 3422 |
| 209 | Ga0157372_10094674 | 3300013307 | Bacteria | 3401 |
| 210 | Ga0157372_10136835 | 3300013307 | Bacteria | 2822 |
| 211 | Ga0157372_10215777 | 3300013307 | Bacteria | 2224 |
| 212 | Ga0157372_10515169 | 3300013307 | Bacteria | 1394 |
| 213 | Ga0157372_10693269 | 3300013307 | Bacteria | 1185 |
| 214 | Ga0157375_10110752 | 3300013308 | Bacteria | 2843 |
| 215 | Ga0157375_10255927 | 3300013308 | Bacteria | 1912 |
| 216 | Ga0157375_10322427 | 3300013308 | Bacteria | 1709 |
| 217 | Ga0157375_10462674 | 3300013308 | Bacteria | 1434 |
| 218 | Ga0157375_10906337 | 3300013308 | Bacteria | 1025 |
| 219 | Ga0163163_10006504 | 3300014325 | Bacteria | 10225 |
| 220 | Ga0163163_10028360 | 3300014325 | Bacteria | 5374 |
| 221 | Ga0163163_10052123 | 3300014325 | Bacteria | 4036 |
| 222 | Ga0163163_10071793 | 3300014325 | Unclassified | 3450 |
| 223 | Ga0163163_10151640 | 3300014325 | Bacteria | 2361 |
| 224 | Ga0163163_10182093 | 3300014325 | Bacteria | 2148 |
| 225 | Ga0163163_10250851 | 3300014325 | Bacteria | 1820 |
| 226 | Ga0163163_10367207 | 3300014325 | Bacteria | 1496 |
| 227 | Ga0163163_10416490 | 3300014325 | Bacteria | 1402 |
| 228 | Ga0157379_10016384 | 3300014968 | Bacteria | 6519 |
| 229 | Ga0157379_10142060 | 3300014968 | Bacteria | 2164 |
| 230 | Ga0157379_10610207 | 3300014968 | Bacteria | 1019 |
| 231 | Ga0157376_10054882 | 3300014969 | Bacteria | 3323 |
| 232 | Ga0157376_10181092 | 3300014969 | Bacteria | 1926 |
| 233 | Ga0157376_10199553 | 3300014969 | Unclassified | 1839 |
| 234 | Ga0157376_10312107 | 3300014969 | Bacteria | 1492 |
| 235 | Ga0157376_10421879 | 3300014969 | Bacteria | 1295 |
| 236 | Ga0206350_11593772 | 3300020080 | Bacteria | 1020 |
| 237 | Ga0213872_10000111 | 3300021361 | Bacteria | 75008 |
| 238 | Ga0213876_10042471 | 3300021384 | Bacteria | 2402 |
| 239 | Ga0213876_10085482 | 3300021384 | Unclassified | 1669 |
| 240 | Ga0213876_10096881 | 3300021384 | Bacteria | 1563 |
| 241 | Ga0213876_10135899 | 3300021384 | Unclassified | 1308 |
| 242 | Ga0213875_10004682 | 3300021388 | Bacteria | 7452 |
| 243 | Ga0213875_10070087 | 3300021388 | Bacteria | 1636 |
| 244 | Ga0213875_10077069 | 3300021388 | Bacteria | 1556 |
| 245 | Ga0213875_10164853 | 3300021388 | Bacteria | 1040 |
| 246 | Ga0224712_10062530 | 3300022467 | Bacteria | 1487 |
| 247 | Ga0207710_10049490 | 3300025900 | Bacteria | 1883 |
| 248 | Ga0207680_10102176 | 3300025903 | Bacteria | 1844 |
| 249 | Ga0207680_10223671 | 3300025903 | Bacteria | 1291 |
| 250 | Ga0207699_10014678 | 3300025906 | Unclassified | 4047 |
| 251 | Ga0207699_10085546 | 3300025906 | Bacteria | 1967 |
| 252 | Ga0207684_10367550 | 3300025910 | Bacteria | 1238 |
| 253 | Ga0207654_10013549 | 3300025911 | Bacteria | 4195 |
| 254 | Ga0207654_10015786 | 3300025911 | Bacteria | 3925 |
| 255 | Ga0207654_10038916 | 3300025911 | Bacteria | 2672 |
| 256 | Ga0207654_10096190 | 3300025911 | Unclassified | 1815 |
| 257 | Ga0207654_10172849 | 3300025911 | Bacteria | 1404 |
| 258 | Ga0207707_10011060 | 3300025912 | Bacteria | 7849 |
| 259 | Ga0207707_10012776 | 3300025912 | Bacteria | 7304 |
| 260 | Ga0207707_10087318 | 3300025912 | Unclassified | 2725 |
| 261 | Ga0207695_10000391 | 3300025913 | Bacteria | 98481 |
| 262 | Ga0207695_10002384 | 3300025913 | Bacteria | 27871 |
| 263 | Ga0207695_10010532 | 3300025913 | Bacteria | 11307 |
| 264 | Ga0207695_10011537 | 3300025913 | Bacteria | 10692 |
| 265 | Ga0207695_10067113 | 3300025913 | Bacteria | 3681 |
| 266 | Ga0207695_10072599 | 3300025913 | Bacteria | 3510 |
| 267 | Ga0207695_10495425 | 3300025913 | Unclassified | 1104 |
| 268 | Ga0207671_10034569 | 3300025914 | Bacteria | 3754 |
| 269 | Ga0207671_10082346 | 3300025914 | Unclassified | 2415 |
| 270 | Ga0207671_10132192 | 3300025914 | Bacteria | 1916 |
| 271 | Ga0207671_10138715 | 3300025914 | Unclassified | 1872 |
| 272 | Ga0207671_10204025 | 3300025914 | Unclassified | 1544 |
| 273 | Ga0207671_10290548 | 3300025914 | Bacteria | 1290 |
| 274 | Ga0207693_10041952 | 3300025915 | Bacteria | 3601 |
| 275 | Ga0207693_10187643 | 3300025915 | Unclassified | 1627 |
| 276 | Ga0207663_10096302 | 3300025916 | Unclassified | 1976 |
| 277 | Ga0207660_10014266 | 3300025917 | Bacteria | 5221 |
| 278 | Ga0207660_10230786 | 3300025917 | Unclassified | 1455 |
| 279 | Ga0207657_10052403 | 3300025919 | Unclassified | 3541 |
| 280 | Ga0207657_10183022 | 3300025919 | Bacteria | 1693 |
| 281 | Ga0207657_10232671 | 3300025919 | Bacteria | 1473 |
| 282 | Ga0207649_10023396 | 3300025920 | Bacteria | 3578 |
| 283 | Ga0207649_10107639 | 3300025920 | Unclassified | 1857 |
| 284 | Ga0207649_10308229 | 3300025920 | Unclassified | 1160 |
| 285 | Ga0207652_10161237 | 3300025921 | Bacteria | 2010 |
| 286 | Ga0207681_10349721 | 3300025923 | Bacteria | 1183 |
| 287 | Ga0207694_10005810 | 3300025924 | Bacteria | 9454 |
| 288 | Ga0207694_10054851 | 3300025924 | Bacteria | 3093 |
| 289 | Ga0207694_10074865 | 3300025924 | Bacteria | 2650 |
| 290 | Ga0207687_10005183 | 3300025927 | Bacteria | 8645 |
| 291 | Ga0207687_10011059 | 3300025927 | Bacteria | 5900 |
| 292 | Ga0207687_10013587 | 3300025927 | Bacteria | 5315 |
| 293 | Ga0207687_10023570 | 3300025927 | Unclassified | 4105 |
| 294 | Ga0207687_10166716 | 3300025927 | Bacteria | 1695 |
| 295 | Ga0207700_10045865 | 3300025928 | Bacteria | 3229 |
| 296 | Ga0207700_10143868 | 3300025928 | Bacteria | 1963 |
| 297 | Ga0207700_10217159 | 3300025928 | Unclassified | 1619 |
| 298 | Ga0207690_10109149 | 3300025932 | Bacteria | 1990 |
| 299 | Ga0207706_10152157 | 3300025933 | Bacteria | 2035 |
| 300 | Ga0207706_10155928 | 3300025933 | Bacteria | 2008 |
| 301 | Ga0207686_10004810 | 3300025934 | Bacteria | 7252 |
| 302 | Ga0207686_10009921 | 3300025934 | Bacteria | 5175 |
| 303 | Ga0207686_10016942 | 3300025934 | Bacteria | 4095 |
| 304 | Ga0207686_10052158 | 3300025934 | Bacteria | 2551 |
| 305 | Ga0207709_10033072 | 3300025935 | Unclassified | 3033 |
| 306 | Ga0207704_10205357 | 3300025938 | Bacteria | 1445 |
| 307 | Ga0207665_10190559 | 3300025939 | Bacteria | 1489 |
| 308 | Ga0207711_10013815 | 3300025941 | Bacteria | 6703 |
| 309 | Ga0207711_10304955 | 3300025941 | Unclassified | 1469 |
| 310 | Ga0207689_10049889 | 3300025942 | Bacteria | 3453 |
| 311 | Ga0207689_10058674 | 3300025942 | Unclassified | 3165 |
| 312 | Ga0207689_10446176 | 3300025942 | Bacteria | 1081 |
| 313 | Ga0207661_10000019 | 3300025944 | Bacteria | 235900 |
| 314 | Ga0207661_10024196 | 3300025944 | Bacteria | 4599 |
| 315 | Ga0207661_10026207 | 3300025944 | Unclassified | 4439 |
| 316 | Ga0207661_10070651 | 3300025944 | Unclassified | 2851 |
| 317 | Ga0207661_10100367 | 3300025944 | Bacteria | 2429 |
| 318 | Ga0207661_10124797 | 3300025944 | Unclassified | 2197 |
| 319 | Ga0207661_10446084 | 3300025944 | Bacteria | 1178 |
| 320 | Ga0207679_10098009 | 3300025945 | Unclassified | 2285 |
| 321 | Ga0207667_10003404 | 3300025949 | Bacteria | 19635 |
| 322 | Ga0207667_10019198 | 3300025949 | Bacteria | 7644 |
| 323 | Ga0207667_10032642 | 3300025949 | Bacteria | 5607 |
| 324 | Ga0207667_10041967 | 3300025949 | Bacteria | 4865 |
| 325 | Ga0207667_10065567 | 3300025949 | Bacteria | 3787 |
| 326 | Ga0207667_10322446 | 3300025949 | Bacteria | 1578 |
| 327 | Ga0207667_10330324 | 3300025949 | Bacteria | 1557 |
| 328 | Ga0207651_10035302 | 3300025960 | Bacteria | 3249 |
| 329 | Ga0207651_10198586 | 3300025960 | Bacteria | 1606 |
| 330 | Ga0207651_10308577 | 3300025960 | Bacteria | 1318 |
| 331 | Ga0207712_10005651 | 3300025961 | Bacteria | 7888 |
| 332 | Ga0207712_10424186 | 3300025961 | Unclassified | 1123 |
| 333 | Ga0207640_10323685 | 3300025981 | Bacteria | 1228 |
| 334 | Ga0207658_10018393 | 3300025986 | Bacteria | 4826 |
| 335 | Ga0207658_10053961 | 3300025986 | Bacteria | 2972 |
| 336 | Ga0207677_10146413 | 3300026023 | Bacteria | 1816 |
| 337 | Ga0207677_10537366 | 3300026023 | Unclassified | 1017 |
| 338 | Ga0207703_10005186 | 3300026035 | Bacteria | 10529 |
| 339 | Ga0207703_10038621 | 3300026035 | Bacteria | 3811 |
| 340 | Ga0207703_10038809 | 3300026035 | Bacteria | 3803 |
| 341 | Ga0207703_10136128 | 3300026035 | Bacteria | 2127 |
| 342 | Ga0207703_10199554 | 3300026035 | Bacteria | 1777 |
| 343 | Ga0207639_10014319 | 3300026041 | Bacteria | 5574 |
| 344 | Ga0207639_10359157 | 3300026041 | Bacteria | 1303 |
| 345 | Ga0207702_10002595 | 3300026078 | Bacteria | 16977 |
| 346 | Ga0207702_10010108 | 3300026078 | Bacteria | 7907 |
| 347 | Ga0207702_10014908 | 3300026078 | Bacteria | 6446 |
| 348 | Ga0207702_10035891 | 3300026078 | Bacteria | 4146 |
| 349 | Ga0207702_10161464 | 3300026078 | Bacteria | 2047 |
| 350 | Ga0207702_10299571 | 3300026078 | Bacteria | 1525 |
| 351 | Ga0207641_10052665 | 3300026088 | Bacteria | 3448 |
| 352 | Ga0207641_10147173 | 3300026088 | Bacteria | 2131 |
| 353 | Ga0207641_10264221 | 3300026088 | Bacteria | 1613 |
| 354 | Ga0207648_10019833 | 3300026089 | Bacteria | 6067 |
| 355 | Ga0207648_10104829 | 3300026089 | Bacteria | 2480 |
| 356 | Ga0207648_10293523 | 3300026089 | Unclassified | 1456 |
| 357 | Ga0207674_10001618 | 3300026116 | Bacteria | 28986 |
| 358 | Ga0207674_10002324 | 3300026116 | Bacteria | 24081 |
| 359 | Ga0207683_10009506 | 3300026121 | Bacteria | 8287 |
| 360 | Ga0207683_10111483 | 3300026121 | Bacteria | 2450 |
| 361 | Ga0207698_10059471 | 3300026142 | Bacteria | 2968 |
| 362 | Ga0268266_10003350 | 3300028379 | Bacteria | 16039 |
| 363 | Ga0268266_10197063 | 3300028379 | Bacteria | 1842 |
| 364 | Ga0268266_10204213 | 3300028379 | Bacteria | 1810 |
| 365 | Ga0268266_10470307 | 3300028379 | Bacteria | 1197 |
| 366 | Ga0268264_10012605 | 3300028381 | Bacteria | 6964 |
| 367 | Ga0268264_10125179 | 3300028381 | Bacteria | 2270 |
| 368 | Ga0265323_10000494 | 3300028653 | Bacteria | 22202 |
| 369 | Ga0265338_10147195 | 3300028800 | Bacteria | 1836 |
| 370 | Ga0265324_10024448 | 3300029957 | Bacteria | 2145 |
| 371 | Ga0265328_10004602 | 3300031239 | Bacteria | 5976 |
| 372 | Ga0265320_10002096 | 3300031240 | Bacteria | 14041 |
| 373 | Ga0265325_10028825 | 3300031241 | Bacteria | 2989 |
| 374 | Ga0265340_10013937 | 3300031247 | Bacteria | 4213 |
| 375 | Ga0265331_10003637 | 3300031250 | Bacteria | 9844 |
| 376 | Ga0265331_10016779 | 3300031250 | Bacteria | 3836 |
| 377 | Ga0265316_10004383 | 3300031344 | Bacteria | 14067 |
| 378 | Ga0265316_10034721 | 3300031344 | Bacteria | 4094 |
| 379 | Ga0265316_10048762 | 3300031344 | Bacteria | 3341 |
| 380 | Ga0265316_10051525 | 3300031344 | Bacteria | 3233 |
| 381 | Ga0265316_10148786 | 3300031344 | Bacteria | 1755 |
| 382 | Ga0265313_10003403 | 3300031595 | Bacteria | 12897 |
| 383 | Ga0265314_10007071 | 3300031711 | Bacteria | 9794 |
| 384 | Ga0265314_10029624 | 3300031711 | Bacteria | 4064 |
| 385 | Ga0265314_10062338 | 3300031711 | Bacteria | 2534 |
| 386 | Ga0265342_10029625 | 3300031712 | Bacteria | 3397 |
| 387 | Ga0373926_0065275 | 3300035083 | Bacteria | 1331 |
| 388 | Ga0373934_0004488 | 3300035086 | Bacteria | 5155 |
| 389 | Ga0373923_0006278 | 3300035111 | Bacteria | 4097 |
| 390 | Ga0373923_0056041 | 3300035111 | Bacteria | 1663 |
| 391 | Ga0373953_0100207 | 3300035117 | Bacteria | 1219 |
| 392 | Ga0373954_0004934 | 3300035118 | Bacteria | 5761 |
| 393 | Ga0373943_0065179 | 3300035170 | Bacteria | 1831 |
| 394 | Ga0373943_0122629 | 3300035170 | Bacteria | 1383 |
| 395 | Ga0373955_0018248 | 3300035172 | Bacteria | 3486 |
| 396 | Ga0373955_0088309 | 3300035172 | Bacteria | 1763 |
| 397 | Ga0373955_0269999 | 3300035172 | Unclassified | 1022 |
| 398 | Ga0373935_0023558 | 3300035692 | Bacteria | 3784 |
| 399 | Ga0373927_0000811 | 3300035695 | Bacteria | 23915 |
| 400 | Ga0373927_0001052 | 3300035695 | Bacteria | 21044 |
| 401 | Ga0373927_0001406 | 3300035695 | Bacteria | 18142 |
| 402 | Ga0373927_0036360 | 3300035695 | Bacteria | 3203 |
| 403 | Ga0373927_0047091 | 3300035695 | Bacteria | 2789 |
| 404 | Ga0373927_0086915 | 3300035695 | Bacteria | 2030 |
| 405 | Ga0373933_0007086 | 3300035724 | Bacteria | 6108 |
| 406 | Ga0373933_0035941 | 3300035724 | Bacteria | 2897 |
| 407 | Ga0373933_0089740 | 3300035724 | Bacteria | 1895 |
| 408 | Ga0373933_0159286 | 3300035724 | Bacteria | 1433 |
| 409 | Ga0373947_0062259 | 3300035725 | Bacteria | 2270 |
| 410 | Ga0373947_0064560 | 3300035725 | Bacteria | 2232 |
| 411 | Ga0373947_0091199 | 3300035725 | Unclassified | 1901 |
| 412 | Ga0373947_0101524 | 3300035725 | Bacteria | 1809 |
| 413 | Ga0373947_0124228 | 3300035725 | Bacteria | 1642 |
| 414 | Ga0373937_0004135 | 3300036401 | Bacteria | 12311 |
| 415 | Ga0373937_0022825 | 3300036401 | Bacteria | 5629 |
| 416 | Ga0373937_0030704 | 3300036401 | Bacteria | 4866 |
| 417 | Ga0373937_0039054 | 3300036401 | Bacteria | 4326 |
| 418 | Ga0373937_0096547 | 3300036401 | Bacteria | 2741 |
| 419 | Ga0373937_0117988 | 3300036401 | Unclassified | 2472 |
| 420 | Ga0373925_0000480 | 3300037068 | Bacteria | 39960 |
| 421 | Ga0373925_0027022 | 3300037068 | Bacteria | 4202 |
| 422 | Ga0373925_0028602 | 3300037068 | Bacteria | 4084 |
| 423 | Ga0373925_0030600 | 3300037068 | Bacteria | 3951 |
| 424 | Ga0373925_0251116 | 3300037068 | Bacteria | 1418 |
| 425 | Ga0395900_0041293 | 3300037418 | Bacteria | 4756 |
| 426 | Ga0395900_0208570 | 3300037418 | Bacteria | 1974 |
| 427 | Ga0395900_0350549 | 3300037418 | Bacteria | 1450 |
| 428 | Ga0395905_0297946 | 3300037471 | Unclassified | 1500 |
| 429 | Ga0436364_0020602 | 3300037853 | Bacteria | 30148 |
| 430 | Ga0436364_0087697 | 3300037853 | Bacteria | 10011 |
| 431 | Ga0436364_0145635 | 3300037853 | Bacteria | 1248 |
| 432 | Ga0436364_0269053 | 3300037853 | Bacteria | 3339 |
| 433 | Ga0436364_0287040 | 3300037853 | Unclassified | 1256 |
| 434 | Ga0436364_0936420 | 3300037853 | Bacteria | 3941 |
| 435 | Ga0436364_1051074 | 3300037853 | Bacteria | 18524 |
| 436 | Ga0436364_1434597 | 3300037853 | Bacteria | 3998 |
| 437 | Ga0436364_1471158 | 3300037853 | Bacteria | 8148 |
| 438 | Ga0436365_0252921 | 3300039437 | Bacteria | 2596 |
| 439 | Ga0436365_0441733 | 3300039437 | Unclassified | 1986 |
| 440 | Ga0436365_0719625 | 3300039437 | Bacteria | 2683 |
| 441 | Ga0436365_0787679 | 3300039437 | Unclassified | 1685 |
| 442 | Ga0436365_0934403 | 3300039437 | Bacteria | 1969 |
| 443 | Ga0436365_1067551 | 3300039437 | Bacteria | 4909 |
| 444 | Ga0436365_1243497 | 3300039437 | Bacteria | 1179 |
| 445 | Ga0436365_1462955 | 3300039437 | Bacteria | 6634 |
| 446 | Ga0436360_0920496 | 3300039438 | Bacteria | 2235 |
| 447 | Ga0436360_1173770 | 3300039438 | Bacteria | 1706 |
| 448 | Ga0436361_0017849 | 3300039447 | Bacteria | 2312 |
| 449 | Ga0436361_0824041 | 3300039447 | Bacteria | 75383 |
| 450 | Ga0436363_0752428 | 3300039450 | Bacteria | 1301 |
| 451 | Ga0436363_1368445 | 3300039450 | Unclassified | 3171 |
| 452 | Ga0436362_0793147 | 3300039453 | Unclassified | 2332 |
| 453 | Ga0436362_1129435 | 3300039453 | Bacteria | 6647 |
| 454 | Ga0453683_0235465 | 3300044673 | Bacteria | 1166 |
| 455 | Ga0453684_0099265 | 3300044712 | Archaea | 3567 |
| 456 | Ga0466959_0285029 | 3300045049 | Bacteria | 1133 |
| 457 | Ga0451576_0027465 | 3300045051 | Bacteria | 6112 |
| 458 | Ga0451576_0264768 | 3300045051 | Bacteria | 1797 |
| 459 | Ga0451576_0368069 | 3300045051 | Bacteria | 1506 |
| 460 | Ga0451576_0389940 | 3300045051 | Bacteria | 1460 |
| 461 | Ga0451576_0481780 | 3300045051 | Bacteria | 1303 |
| 462 | Ga0451576_0586957 | 3300045051 | Bacteria | 1171 |
| 463 | Ga0466958_0049999 | 3300045836 | Bacteria | 2531 |
| 464 | Ga0466967_0044380 | 3300045976 | Bacteria | 3856 |
| 465 | Ga0495592_0004706 | 3300046454 | Bacteria | 10011 |
| 466 | Ga0495651_0013846 | 3300046462 | Bacteria | 6238 |
| 467 | Ga0495651_0035383 | 3300046462 | Bacteria | 3888 |
| 468 | Ga0495653_0047626 | 3300046463 | Bacteria | 3315 |
| 469 | Ga0495653_0116758 | 3300046463 | Bacteria | 1908 |
| 470 | Ga0495580_0001811 | 3300046472 | Bacteria | 18805 |
| 471 | Ga0495580_0005973 | 3300046472 | Bacteria | 9975 |
| 472 | Ga0495580_0022406 | 3300046472 | Bacteria | 4648 |
| 473 | Ga0495580_0023546 | 3300046472 | Bacteria | 4520 |
| 474 | Ga0495580_0046062 | 3300046472 | Bacteria | 3096 |
| 475 | Ga0495580_0053127 | 3300046472 | Bacteria | 2860 |
| 476 | Ga0495580_0194441 | 3300046472 | Bacteria | 1399 |
| 477 | Ga0495580_0304982 | 3300046472 | Unclassified | 1084 |
| 478 | Ga0495582_0037720 | 3300046473 | Bacteria | 2658 |
| 479 | Ga0495662_0045764 | 3300046476 | Bacteria | 2112 |
| 480 | Ga0495664_0002499 | 3300046477 | Bacteria | 9875 |
| 481 | Ga0495628_0017443 | 3300046516 | Bacteria | 5977 |
| 482 | Ga0495652_0031436 | 3300046529 | Bacteria | 4650 |
| 483 | Ga0495665_0038421 | 3300046531 | Bacteria | 2552 |
| 484 | Ga0495665_0082455 | 3300046531 | Bacteria | 1691 |
| 485 | Ga0495640_0011227 | 3300046533 | Bacteria | 6896 |
| 486 | Ga0495587_0007340 | 3300046536 | Bacteria | 7145 |
| 487 | Ga0495587_0029160 | 3300046536 | Unclassified | 3352 |
| 488 | Ga0495645_0009582 | 3300046543 | Bacteria | 6775 |
| 489 | Ga0495667_0005114 | 3300046559 | Bacteria | 8862 |
| 490 | Ga0495667_0045212 | 3300046559 | Bacteria | 2916 |
| 491 | Ga0495634_0023461 | 3300046642 | Bacteria | 4337 |
| 492 | Ga0495634_0133849 | 3300046642 | Bacteria | 1578 |
| 493 | Ga0495635_0063723 | 3300046663 | Bacteria | 2531 |
| 494 | Ga0495599_0015749 | 3300046678 | Bacteria | 4693 |
| 495 | Ga0495599_0120609 | 3300046678 | Bacteria | 1630 |
| 496 | Ga0495623_0027157 | 3300046679 | Bacteria | 3681 |
| 497 | Ga0495646_0051446 | 3300046680 | Bacteria | 2493 |
| 498 | Ga0495658_0152528 | 3300046683 | Bacteria | 1420 |
| 499 | Ga0495613_0025094 | 3300046689 | Bacteria | 4442 |
| 500 | Ga0495613_0289480 | 3300046689 | Bacteria | 1136 |
| 501 | Ga0495624_0214447 | 3300046690 | Bacteria | 1167 |
| 502 | Ga0495604_0089762 | 3300047317 | Bacteria | 2284 |
| 503 | Ga0495636_0043740 | 3300047318 | Bacteria | 1864 |
| 504 | Ga0495674_0061045 | 3300047319 | Bacteria | 3287 |
| 505 | Ga0495674_0074703 | 3300047319 | Bacteria | 2918 |
| 506 | Ga0495674_0150425 | 3300047319 | Bacteria | 1952 |
| 507 | Ga0495680_0123761 | 3300047322 | Bacteria | 1907 |
| 508 | Ga0495675_0088355 | 3300047444 | Bacteria | 1947 |
| 509 | Ga0495675_0095498 | 3300047444 | Unclassified | 1864 |
| 510 | Ga0495675_0102603 | 3300047444 | Bacteria | 1789 |
| 511 | Ga0495684_0014023 | 3300047471 | Bacteria | 6165 |
| 512 | Ga0495684_0021489 | 3300047471 | Bacteria | 4968 |
| 513 | Ga0495684_0028462 | 3300047471 | Bacteria | 4290 |
| 514 | Ga0495684_0153526 | 3300047471 | Unclassified | 1720 |
| 515 | Ga0495684_0345044 | 3300047471 | Unclassified | 1059 |
| 516 | Ga0495602_0133251 | 3300048088 | Bacteria | 1978 |
| 517 | Ga0496112_0055136 | 3300048915 | Bacteria | 3907 |
| 518 | Ga0496112_0439793 | 3300048915 | Bacteria | 1242 |
| 519 | Ga0496115_0004558 | 3300048918 | Bacteria | 10028 |
| 520 | Ga0496115_0049452 | 3300048918 | Bacteria | 3366 |
| 521 | Ga0501308_004311 | 3300049128 | Bacteria | 1366 |
| 522 | Ga0501309_008057 | 3300049129 | Bacteria | 1319 |
| 523 | Ga0501305_007769 | 3300049161 | Bacteria | 1370 |
| 524 | Ga0501312_007361 | 3300049528 | Bacteria | 1401 |
| 525 | Ga0501324_003433 | 3300049540 | Bacteria | 1216 |
| 526 | Ga0501031_0004453 | 3300049568 | Bacteria | 9090 |
| 527 | Ga0501032_0002278 | 3300049569 | Bacteria | 15077 |
| 528 | Ga0501033_0005380 | 3300049570 | Bacteria | 10144 |
| 529 | Ga0501034_0010051 | 3300049571 | Bacteria | 9881 |
| 530 | Ga0501034_0039290 | 3300049571 | Bacteria | 4793 |
| 531 | Ga0501036_0000498 | 3300049572 | Bacteria | 28138 |
| 532 | Ga0501037_0004945 | 3300049573 | Bacteria | 9694 |
| 533 | Ga0501038_0013541 | 3300049574 | Bacteria | 7434 |
| 534 | Ga0501038_0060691 | 3300049574 | Bacteria | 3236 |
| 535 | Ga0501039_0036541 | 3300049575 | Bacteria | 3791 |
| 536 | Ga0501043_0006639 | 3300049579 | Bacteria | 9259 |
| 537 | Ga0501043_0124312 | 3300049579 | Bacteria | 2023 |
| 538 | Ga0501046_0002887 | 3300049580 | Bacteria | 15937 |
| 539 | Ga0501047_0008173 | 3300049581 | Bacteria | 9881 |
| 540 | Ga0501047_0396364 | 3300049581 | Bacteria | 1214 |
| 541 | Ga0501048_0006561 | 3300049582 | Bacteria | 8845 |
| 542 | Ga0501067_0001266 | 3300049583 | Bacteria | 13736 |
| 543 | Ga0501068_0000768 | 3300049584 | Bacteria | 16530 |
| 544 | Ga0501068_0312964 | 3300049584 | Bacteria | 1006 |
| 545 | Ga0501069_0003086 | 3300049585 | Bacteria | 8532 |
| 546 | Ga0501070_0006405 | 3300049586 | Bacteria | 10015 |
| 547 | Ga0501071_0268271 | 3300049587 | Unclassified | 1290 |
| 548 | Ga0501072_0000320 | 3300049588 | Bacteria | 34200 |
| 549 | Ga0501073_0000432 | 3300049589 | Bacteria | 28777 |
| 550 | Ga0501074_0025861 | 3300049590 | Bacteria | 4258 |
| 551 | Ga0501077_0000457 | 3300049593 | Bacteria | 24786 |
| 552 | Ga0501079_0001554 | 3300049741 | Bacteria | 16270 |
| 553 | Ga0501080_0000559 | 3300049742 | Bacteria | 29429 |
| 554 | Ga0501083_0009706 | 3300049744 | Bacteria | 6796 |
| 555 | Ga0501035_0018483 | 3300049822 | Bacteria | 6421 |
| 556 | Ga0501035_0020551 | 3300049822 | Bacteria | 6064 |
| 557 | Ga0501035_0097186 | 3300049822 | Bacteria | 2587 |
| 558 | Ga0501044_0000253 | 3300049823 | Bacteria | 67988 |
| 559 | Ga0501044_0014229 | 3300049823 | Bacteria | 8592 |
| 560 | Ga0501044_0050019 | 3300049823 | Bacteria | 4314 |
| 561 | Ga0501044_0144647 | 3300049823 | Bacteria | 2364 |
| 562 | Ga0501044_0191539 | 3300049823 | Bacteria | 2007 |
| 563 | Ga0501045_0061274 | 3300049824 | Bacteria | 2760 |
| 564 | nmdc:mga0qj67_21192_c1 | 3300050509 | Bacteria | 4984 |
| 565 | nmdc:mga06r32_42990_c1 | 3300050510 | Bacteria | 4298 |
| 566 | nmdc:mga06r32_67845_c1 | 3300050510 | Bacteria | 3444 |
| 567 | Ga0495619_0315063 | 3300053085 | Bacteria | 1083 |
| 568 | Ga0500568_0000656 | 3300053139 | Bacteria | 24982 |
| 569 | Ga0501084_0002969 | 3300054114 | Bacteria | 13736 |
| 570 | Ga0501082_0000628 | 3300060353 | Bacteria | 31112 |
| 571 | Ga0501082_0008060 | 3300060353 | Bacteria | 9088 |
| 572 | Ga0501082_0128114 | 3300060353 | Bacteria | 2202 |
| 573 | 2792745462 | 2791355123 | Bacteria | 8049106 |
| 574 | Ga0207648_10097614 | |||
| 575 | Ga0070658_10244281 | |||
| 576 | Ga0070676_10060553 | |||
| 577 | Ga0070683_100000088 | |||
| 578 | Ga0070683_100013541 | |||
| 579 | Ga0070683_100017865 | |||
| 580 | Ga0070683_100134386 | |||
| 581 | Ga0070683_100165594 | |||
| 582 | Ga0070683_100189414 | |||
| 583 | Ga0070690_100017887 | |||
| 584 | Ga0070690_100111354 | |||
| 585 | Ga0070666_10079584 | |||
| 586 | Ga0070680_100001004 | |||
| 587 | Ga0068868_100228087 | |||
| 588 | Ga0070660_100040735 | |||
| 589 | Ga0070660_100184981 | |||
| 590 | Ga0070660_100217315 | |||
| 591 | Ga0070689_100447917 | |||
| 592 | Ga0070691_10001000 | |||
| 593 | Ga0070661_100036013 | |||
| 594 | Ga0070661_100121334 | |||
| 595 | Ga0070675_100486743 | |||
| 596 | Ga0070671_100179309 | |||
| 597 | Ga0070673_100006269 | |||
| 598 | Ga0070659_100154364 | |||
| 599 | Ga0070667_100084531 | |||
| 600 | Ga0070667_100254016 | |||
| 601 | Ga0070709_10039571 | |||
| 602 | Ga0070714_100012105 | |||
| 603 | Ga0070713_100023532 | |||
| 604 | Ga0070713_100043351 | |||
| 605 | Ga0070713_100121765 | |||
| 606 | Ga0070713_100610097 | |||
| 607 | Ga0070711_100040475 | |||
| 608 | Ga0070708_100322626 | |||
| 609 | Ga0070678_100057154 | |||
| 610 | Ga0070662_100060648 | |||
| 611 | Ga0070681_10035370 | |||
| 612 | Ga0070681_10112837 | |||
| 613 | Ga0070681_10112853 | |||
| 614 | Ga0070681_10232530 | |||
| 615 | Ga0070681_10260108 | |||
| 616 | Ga0070681_10348705 | |||
| 617 | Ga0070681_10408626 | |||
| 618 | Ga0068867_100243813 | |||
| 619 | Ga0070685_10235881 | |||
| 620 | Ga0070706_100426425 | |||
| 621 | Ga0070679_100178351 | |||
| 622 | Ga0070679_100269283 | |||
| 623 | Ga0070684_100000003 | |||
| 624 | Ga0070684_100000798 | |||
| 625 | Ga0070684_100055924 | |||
| 626 | Ga0070684_100125929 | |||
| 627 | Ga0070684_100192983 | |||
| 628 | Ga0068853_100003008 | |||
| 629 | Ga0068853_100290860 | |||
| 630 | Ga0068853_100372791 | |||
| 631 | Ga0070672_100252879 | |||
| 632 | Ga0070696_100015763 | |||
| 633 | Ga0070665_100001546 | |||
| 634 | Ga0070665_100168791 | |||
| 635 | Ga0070665_100675888 | |||
| 636 | Ga0068855_100002936 | |||
| 637 | Ga0068855_100003533 | |||
| 638 | Ga0068855_100010435 | |||
| 639 | Ga0068855_100015926 | |||
| 640 | Ga0068855_100017262 | |||
| 641 | Ga0068855_100027065 | |||
| 642 | Ga0068855_100094149 | |||
| 643 | Ga0068855_100366234 | |||
| 644 | Ga0070664_100191325 | |||
| 645 | Ga0070664_100219813 | |||
| 646 | Ga0068857_100001280 | |||
| 647 | Ga0068857_100023692 | |||
| 648 | Ga0068857_100233536 | |||
| 649 | Ga0068856_100002863 | |||
| 650 | Ga0068856_100005113 | |||
| 651 | Ga0068856_100006893 | |||
| 652 | Ga0068856_100018477 | |||
| 653 | Ga0068856_100042307 | |||
| 654 | Ga0068856_100079593 | |||
| 655 | Ga0068856_100104537 | |||
| 656 | Ga0068856_100141082 | |||
| 657 | Ga0068856_100166505 | |||
| 658 | Ga0068852_100124908 | |||
| 659 | Ga0068852_100297709 | |||
| 660 | Ga0068859_100101811 | |||
| 661 | Ga0068859_100320865 | |||
| 662 | Ga0068859_100459754 | |||
| 663 | Ga0068863_100036579 | |||
| 664 | Ga0068863_100142828 | |||
| 665 | Ga0068863_100155700 | |||
| 666 | Ga0068863_100407093 | |||
| 667 | Ga0068858_100017291 | |||
| 668 | Ga0068858_100032804 | |||
| 669 | Ga0068858_100040760 | |||
| 670 | Ga0068858_100065708 | |||
| 671 | Ga0068860_100016589 | |||
| 672 | Ga0068860_100184793 | |||
| 673 | Ga0081455_10040858 | |||
| 674 | Ga0070717_10013700 | |||
| 675 | Ga0070717_10058973 | |||
| 676 | Ga0070717_10277445 | |||
| 677 | Ga0070717_10349896 | |||
| 678 | Ga0070716_100160288 | |||
| 679 | Ga0070712_100031011 | |||
| 680 | Ga0070712_100113679 | |||
| 681 | Ga0097621_100026689 | |||
| 682 | Ga0097621_100046214 | |||
| 683 | Ga0097621_100096436 | |||
| 684 | Ga0097621_100116672 | |||
| 685 | Ga0097621_100139108 | |||
| 686 | Ga0097621_100156443 | |||
| 687 | Ga0068871_100014312 | |||
| 688 | Ga0068871_100066982 | |||
| 689 | Ga0068871_100116433 | |||
| 690 | Ga0068871_100126839 | |||
| 691 | Ga0068871_100232699 | |||
| 692 | Ga0068871_100429969 | |||
| 693 | Ga0075430_100092214 | |||
| 694 | Ga0075431_100002583 | |||
| 695 | Ga0075431_100462388 | |||
| 696 | Ga0075433_10482316 | |||
| 697 | Ga0068865_100429334 | |||
| 698 | Ga0075436_100021352 | |||
| 699 | Ga0097620_100101811 | |||
| 700 | Ga0097620_100320847 | |||
| 701 | Ga0097620_100459798 | |||
| 702 | Ga0105240_10000519 | |||
| 703 | Ga0105240_10000877 | |||
| 704 | Ga0105240_10001298 | |||
| 705 | Ga0105240_10077441 | |||
| 706 | Ga0105240_10239292 | |||
| 707 | Ga0105240_10246183 | |||
| 708 | Ga0105245_10007593 | |||
| 709 | Ga0105245_10015249 | |||
| 710 | Ga0105245_10021042 | |||
| 711 | Ga0105245_10021645 | |||
| 712 | Ga0105245_10028778 | |||
| 713 | Ga0105245_10062270 | |||
| 714 | Ga0105245_10213509 | |||
| 715 | Ga0105247_10070015 | |||
| 716 | Ga0105247_10147098 | |||
| 717 | Ga0114129_10430575 | |||
| 718 | Ga0105243_10106225 | |||
| 719 | Ga0105241_10007088 | |||
| 720 | Ga0105241_10008537 | |||
| 721 | Ga0105241_10009610 | |||
| 722 | Ga0105241_10093260 | |||
| 723 | Ga0105241_10228015 | |||
| 724 | Ga0105241_10252869 | |||
| 725 | Ga0105241_10387611 | |||
| 726 | Ga0105241_10478017 | |||
| 727 | Ga0105242_10006709 | |||
| 728 | Ga0105242_10040533 | |||
| 729 | Ga0105248_10017829 | |||
| 730 | Ga0105248_10050021 | |||
| 731 | Ga0105248_10121372 | |||
| 732 | Ga0105248_10152825 | |||
| 733 | Ga0105248_10171603 | |||
| 734 | Ga0105248_10221119 | |||
| 735 | Ga0105248_10368416 | |||
| 736 | Ga0105237_10004151 | |||
| 737 | Ga0105237_10091785 | |||
| 738 | Ga0105237_10103718 | |||
| 739 | Ga0105237_10150325 | |||
| 740 | Ga0105237_10237127 | |||
| 741 | Ga0105237_10333944 | |||
| 742 | Ga0105237_10550479 | |||
| 743 | Ga0105238_10091364 | |||
| 744 | Ga0105238_10110087 | |||
| 745 | Ga0105249_10010890 | |||
| 746 | Ga0105249_10244807 | |||
| 747 | Ga0105249_10326903 | |||
| 748 | Ga0105239_10002634 | |||
| 749 | Ga0105239_10007999 | |||
| 750 | Ga0105239_10013772 | |||
| 751 | Ga0105239_10034304 | |||
| 752 | Ga0105239_10036180 | |||
| 753 | Ga0105239_10058970 | |||
| 754 | Ga0105239_10145939 | |||
| 755 | Ga0105239_10184746 | |||
| 756 | Ga0105239_10195433 | |||
| 757 | Ga0105246_10051147 | |||
| 758 | Ga0105246_10148761 | |||
| 759 | Ga0157373_10027411 | |||
| 760 | Ga0157373_10048423 | |||
| 761 | Ga0157370_10002850 | |||
| 762 | Ga0157370_10013208 | |||
| 763 | Ga0157370_10092229 | |||
| 764 | Ga0157370_10094080 | |||
| 765 | Ga0157369_10006968 | |||
| 766 | Ga0157369_10007301 | |||
| 767 | Ga0157369_10013990 | |||
| 768 | Ga0157369_10018191 | |||
| 769 | Ga0157374_10036825 | |||
| 770 | Ga0157374_10082792 | |||
| 771 | Ga0157374_10088526 | |||
| 772 | Ga0157374_10096229 | |||
| 773 | Ga0157374_10266467 | |||
| 774 | Ga0157374_10353807 | |||
| 775 | Ga0157378_10003184 | |||
| 776 | Ga0157378_10084266 | |||
| 777 | Ga0163162_10058958 | |||
| 778 | Ga0163162_10477695 | |||
| 779 | Ga0163162_10489753 | |||
| 780 | Ga0157372_10040395 | |||
| 781 | Ga0157372_10093476 | |||
| 782 | Ga0157372_10094674 | |||
| 783 | Ga0157372_10136835 | |||
| 784 | Ga0157372_10215777 | |||
| 785 | Ga0157372_10515169 | |||
| 786 | Ga0157372_10693269 | |||
| 787 | Ga0157375_10110752 | |||
| 788 | Ga0157375_10255927 | |||
| 789 | Ga0157375_10322427 | |||
| 790 | Ga0157375_10462674 | |||
| 791 | Ga0157375_10906337 | |||
| 792 | Ga0163163_10006504 | |||
| 793 | Ga0163163_10028360 | |||
| 794 | Ga0163163_10052123 | |||
| 795 | Ga0163163_10071793 | |||
| 796 | Ga0163163_10151640 | |||
| 797 | Ga0163163_10182093 | |||
| 798 | Ga0163163_10250851 | |||
| 799 | Ga0163163_10367207 | |||
| 800 | Ga0163163_10416490 | |||
| 801 | Ga0157379_10016384 | |||
| 802 | Ga0157379_10142060 | |||
| 803 | Ga0157379_10610207 | |||
| 804 | Ga0157376_10054882 | |||
| 805 | Ga0157376_10181092 | |||
| 806 | Ga0157376_10199553 | |||
| 807 | Ga0157376_10312107 | |||
| 808 | Ga0157376_10421879 | |||
| 809 | Ga0206350_11593772 | |||
| 810 | Ga0213872_10000111 | |||
| 811 | Ga0213876_10042471 | |||
| 812 | Ga0213876_10085482 | |||
| 813 | Ga0213876_10096881 | |||
| 814 | Ga0213876_10135899 | |||
| 815 | Ga0213875_10004682 | |||
| 816 | Ga0213875_10070087 | |||
| 817 | Ga0213875_10077069 | |||
| 818 | Ga0213875_10164853 | |||
| 819 | Ga0224712_10062530 | |||
| 820 | Ga0207710_10049490 | |||
| 821 | Ga0207680_10102176 | |||
| 822 | Ga0207680_10223671 | |||
| 823 | Ga0207699_10014678 | |||
| 824 | Ga0207699_10085546 | |||
| 825 | Ga0207684_10367550 | |||
| 826 | Ga0207654_10013549 | |||
| 827 | Ga0207654_10015786 | |||
| 828 | Ga0207654_10038916 | |||
| 829 | Ga0207654_10096190 | |||
| 830 | Ga0207654_10172849 | |||
| 831 | Ga0207707_10011060 | |||
| 832 | Ga0207707_10012776 | |||
| 833 | Ga0207707_10087318 | |||
| 834 | Ga0207695_10000391 | |||
| 835 | Ga0207695_10002384 | |||
| 836 | Ga0207695_10010532 | |||
| 837 | Ga0207695_10011537 | |||
| 838 | Ga0207695_10067113 | |||
| 839 | Ga0207695_10072599 | |||
| 840 | Ga0207695_10495425 | |||
| 841 | Ga0207671_10034569 | |||
| 842 | Ga0207671_10082346 | |||
| 843 | Ga0207671_10132192 | |||
| 844 | Ga0207671_10138715 | |||
| 845 | Ga0207671_10204025 | |||
| 846 | Ga0207671_10290548 | |||
| 847 | Ga0207693_10041952 | |||
| 848 | Ga0207693_10187643 | |||
| 849 | Ga0207663_10096302 | |||
| 850 | Ga0207660_10014266 | |||
| 851 | Ga0207660_10230786 | |||
| 852 | Ga0207657_10052403 | |||
| 853 | Ga0207657_10183022 | |||
| 854 | Ga0207657_10232671 | |||
| 855 | Ga0207649_10023396 | |||
| 856 | Ga0207649_10107639 | |||
| 857 | Ga0207649_10308229 | |||
| 858 | Ga0207652_10161237 | |||
| 859 | Ga0207681_10349721 | |||
| 860 | Ga0207694_10005810 | |||
| 861 | Ga0207694_10054851 | |||
| 862 | Ga0207694_10074865 | |||
| 863 | Ga0207687_10005183 | |||
| 864 | Ga0207687_10011059 | |||
| 865 | Ga0207687_10013587 | |||
| 866 | Ga0207687_10023570 | |||
| 867 | Ga0207687_10166716 | |||
| 868 | Ga0207700_10045865 | |||
| 869 | Ga0207700_10143868 | |||
| 870 | Ga0207700_10217159 | |||
| 871 | Ga0207690_10109149 | |||
| 872 | Ga0207706_10152157 | |||
| 873 | Ga0207706_10155928 | |||
| 874 | Ga0207686_10004810 | |||
| 875 | Ga0207686_10009921 | |||
| 876 | Ga0207686_10016942 | |||
| 877 | Ga0207686_10052158 | |||
| 878 | Ga0207709_10033072 | |||
| 879 | Ga0207704_10205357 | |||
| 880 | Ga0207665_10190559 | |||
| 881 | Ga0207711_10013815 | |||
| 882 | Ga0207711_10304955 | |||
| 883 | Ga0207689_10049889 | |||
| 884 | Ga0207689_10058674 | |||
| 885 | Ga0207689_10446176 | |||
| 886 | Ga0207661_10000019 | |||
| 887 | Ga0207661_10024196 | |||
| 888 | Ga0207661_10026207 | |||
| 889 | Ga0207661_10070651 | |||
| 890 | Ga0207661_10100367 | |||
| 891 | Ga0207661_10124797 | |||
| 892 | Ga0207661_10446084 | |||
| 893 | Ga0207679_10098009 | |||
| 894 | Ga0207667_10003404 | |||
| 895 | Ga0207667_10019198 | |||
| 896 | Ga0207667_10032642 | |||
| 897 | Ga0207667_10041967 | |||
| 898 | Ga0207667_10065567 | |||
| 899 | Ga0207667_10322446 | |||
| 900 | Ga0207667_10330324 | |||
| 901 | Ga0207651_10035302 | |||
| 902 | Ga0207651_10198586 | |||
| 903 | Ga0207651_10308577 | |||
| 904 | Ga0207712_10005651 | |||
| 905 | Ga0207712_10424186 | |||
| 906 | Ga0207640_10323685 | |||
| 907 | Ga0207658_10018393 | |||
| 908 | Ga0207658_10053961 | |||
| 909 | Ga0207677_10146413 | |||
| 910 | Ga0207677_10537366 | |||
| 911 | Ga0207703_10005186 | |||
| 912 | Ga0207703_10038621 | |||
| 913 | Ga0207703_10038809 | |||
| 914 | Ga0207703_10136128 | |||
| 915 | Ga0207703_10199554 | |||
| 916 | Ga0207639_10014319 | |||
| 917 | Ga0207639_10359157 | |||
| 918 | Ga0207702_10002595 | |||
| 919 | Ga0207702_10010108 | |||
| 920 | Ga0207702_10014908 | |||
| 921 | Ga0207702_10035891 | |||
| 922 | Ga0207702_10161464 | |||
| 923 | Ga0207702_10299571 | |||
| 924 | Ga0207641_10052665 | |||
| 925 | Ga0207641_10147173 | |||
| 926 | Ga0207641_10264221 | |||
| 927 | Ga0207648_10019833 | |||
| 928 | Ga0207648_10104829 | |||
| 929 | Ga0207648_10293523 | |||
| 930 | Ga0207674_10001618 | |||
| 931 | Ga0207674_10002324 | |||
| 932 | Ga0207683_10009506 | |||
| 933 | Ga0207683_10111483 | |||
| 934 | Ga0207698_10059471 | |||
| 935 | Ga0268266_10003350 | |||
| 936 | Ga0268266_10197063 | |||
| 937 | Ga0268266_10204213 | |||
| 938 | Ga0268266_10470307 | |||
| 939 | Ga0268264_10012605 | |||
| 940 | Ga0268264_10125179 | |||
| 941 | Ga0265323_10000494 | |||
| 942 | Ga0265338_10147195 | |||
| 943 | Ga0265324_10024448 | |||
| 944 | Ga0265328_10004602 | |||
| 945 | Ga0265320_10002096 | |||
| 946 | Ga0265325_10028825 | |||
| 947 | Ga0265340_10013937 | |||
| 948 | Ga0265331_10003637 | |||
| 949 | Ga0265331_10016779 | |||
| 950 | Ga0265316_10004383 | |||
| 951 | Ga0265316_10034721 | |||
| 952 | Ga0265316_10048762 | |||
| 953 | Ga0265316_10051525 | |||
| 954 | Ga0265316_10148786 | |||
| 955 | Ga0265313_10003403 | |||
| 956 | Ga0265314_10007071 | |||
| 957 | Ga0265314_10029624 | |||
| 958 | Ga0265314_10062338 | |||
| 959 | Ga0265342_10029625 | |||
| 960 | Ga0373926_0065275 | |||
| 961 | Ga0373934_0004488 | |||
| 962 | Ga0373923_0006278 | |||
| 963 | Ga0373923_0056041 | |||
| 964 | Ga0373953_0100207 | |||
| 965 | Ga0373954_0004934 | |||
| 966 | Ga0373943_0065179 | |||
| 967 | Ga0373943_0122629 | |||
| 968 | Ga0373955_0018248 | |||
| 969 | Ga0373955_0088309 | |||
| 970 | Ga0373955_0269999 | |||
| 971 | Ga0373935_0023558 | |||
| 972 | Ga0373927_0000811 | |||
| 973 | Ga0373927_0001052 | |||
| 974 | Ga0373927_0001406 | |||
| 975 | Ga0373927_0036360 | |||
| 976 | Ga0373927_0047091 | |||
| 977 | Ga0373927_0086915 | |||
| 978 | Ga0373933_0007086 | |||
| 979 | Ga0373933_0035941 | |||
| 980 | Ga0373933_0089740 | |||
| 981 | Ga0373933_0159286 | |||
| 982 | Ga0373947_0062259 | |||
| 983 | Ga0373947_0064560 | |||
| 984 | Ga0373947_0091199 | |||
| 985 | Ga0373947_0101524 | |||
| 986 | Ga0373947_0124228 | |||
| 987 | Ga0373937_0004135 | |||
| 988 | Ga0373937_0022825 | |||
| 989 | Ga0373937_0030704 | |||
| 990 | Ga0373937_0039054 | |||
| 991 | Ga0373937_0096547 | |||
| 992 | Ga0373937_0117988 | |||
| 993 | Ga0373925_0000480 | |||
| 994 | Ga0373925_0027022 | |||
| 995 | Ga0373925_0028602 | |||
| 996 | Ga0373925_0030600 | |||
| 997 | Ga0373925_0251116 | |||
| 998 | Ga0395900_0041293 | |||
| 999 | Ga0395900_0208570 | |||
| 1000 | Ga0395900_0350549 | |||
| 1001 | Ga0395905_0297946 | |||
| 1002 | Ga0436364_0020602 | |||
| 1003 | Ga0436364_0087697 | |||
| 1004 | Ga0436364_0145635 | |||
| 1005 | Ga0436364_0269053 | |||
| 1006 | Ga0436364_0287040 | |||
| 1007 | Ga0436364_0936420 | |||
| 1008 | Ga0436364_1051074 | |||
| 1009 | Ga0436364_1434597 | |||
| 1010 | Ga0436364_1471158 | |||
| 1011 | Ga0436365_0252921 | |||
| 1012 | Ga0436365_0441733 | |||
| 1013 | Ga0436365_0719625 | |||
| 1014 | Ga0436365_0787679 | |||
| 1015 | Ga0436365_0934403 | |||
| 1016 | Ga0436365_1067551 | |||
| 1017 | Ga0436365_1243497 | |||
| 1018 | Ga0436365_1462955 | |||
| 1019 | Ga0436360_0920496 | |||
| 1020 | Ga0436360_1173770 | |||
| 1021 | Ga0436361_0017849 | |||
| 1022 | Ga0436361_0824041 | |||
| 1023 | Ga0436363_0752428 | |||
| 1024 | Ga0436363_1368445 | |||
| 1025 | Ga0436362_0793147 | |||
| 1026 | Ga0436362_1129435 | |||
| 1027 | Ga0453683_0235465 | |||
| 1028 | Ga0453684_0099265 | |||
| 1029 | Ga0466959_0285029 | |||
| 1030 | Ga0451576_0027465 | |||
| 1031 | Ga0451576_0264768 | |||
| 1032 | Ga0451576_0368069 | |||
| 1033 | Ga0451576_0389940 | |||
| 1034 | Ga0451576_0481780 | |||
| 1035 | Ga0451576_0586957 | |||
| 1036 | Ga0466958_0049999 | |||
| 1037 | Ga0466967_0044380 | |||
| 1038 | Ga0495592_0004706 | |||
| 1039 | Ga0495651_0013846 | |||
| 1040 | Ga0495651_0035383 | |||
| 1041 | Ga0495653_0047626 | |||
| 1042 | Ga0495653_0116758 | |||
| 1043 | Ga0495580_0001811 | |||
| 1044 | Ga0495580_0005973 | |||
| 1045 | Ga0495580_0022406 | |||
| 1046 | Ga0495580_0023546 | |||
| 1047 | Ga0495580_0046062 | |||
| 1048 | Ga0495580_0053127 | |||
| 1049 | Ga0495580_0194441 | |||
| 1050 | Ga0495580_0304982 | |||
| 1051 | Ga0495582_0037720 | |||
| 1052 | Ga0495662_0045764 | |||
| 1053 | Ga0495664_0002499 | |||
| 1054 | Ga0495628_0017443 | |||
| 1055 | Ga0495652_0031436 | |||
| 1056 | Ga0495665_0038421 | |||
| 1057 | Ga0495665_0082455 | |||
| 1058 | Ga0495640_0011227 | |||
| 1059 | Ga0495587_0007340 | |||
| 1060 | Ga0495587_0029160 | |||
| 1061 | Ga0495645_0009582 | |||
| 1062 | Ga0495667_0005114 | |||
| 1063 | Ga0495667_0045212 | |||
| 1064 | Ga0495634_0023461 | |||
| 1065 | Ga0495634_0133849 | |||
| 1066 | Ga0495635_0063723 | |||
| 1067 | Ga0495599_0015749 | |||
| 1068 | Ga0495599_0120609 | |||
| 1069 | Ga0495623_0027157 | |||
| 1070 | Ga0495646_0051446 | |||
| 1071 | Ga0495658_0152528 | |||
| 1072 | Ga0495613_0025094 | |||
| 1073 | Ga0495613_0289480 | |||
| 1074 | Ga0495624_0214447 | |||
| 1075 | Ga0495604_0089762 | |||
| 1076 | Ga0495636_0043740 | |||
| 1077 | Ga0495674_0061045 | |||
| 1078 | Ga0495674_0074703 | |||
| 1079 | Ga0495674_0150425 | |||
| 1080 | Ga0495680_0123761 | |||
| 1081 | Ga0495675_0088355 | |||
| 1082 | Ga0495675_0095498 | |||
| 1083 | Ga0495675_0102603 | |||
| 1084 | Ga0495684_0014023 | |||
| 1085 | Ga0495684_0021489 | |||
| 1086 | Ga0495684_0028462 | |||
| 1087 | Ga0495684_0153526 | |||
| 1088 | Ga0495684_0345044 | |||
| 1089 | Ga0495602_0133251 | |||
| 1090 | Ga0496112_0055136 | |||
| 1091 | Ga0496112_0439793 | |||
| 1092 | Ga0496115_0004558 | |||
| 1093 | Ga0496115_0049452 | |||
| 1094 | Ga0501308_004311 | |||
| 1095 | Ga0501309_008057 | |||
| 1096 | Ga0501305_007769 | |||
| 1097 | Ga0501312_007361 | |||
| 1098 | Ga0501324_003433 | |||
| 1099 | Ga0501031_0004453 | |||
| 1100 | Ga0501032_0002278 | |||
| 1101 | Ga0501033_0005380 | |||
| 1102 | Ga0501034_0010051 | |||
| 1103 | Ga0501034_0039290 | |||
| 1104 | Ga0501036_0000498 | |||
| 1105 | Ga0501037_0004945 | |||
| 1106 | Ga0501038_0013541 | |||
| 1107 | Ga0501038_0060691 | |||
| 1108 | Ga0501039_0036541 | |||
| 1109 | Ga0501043_0006639 | |||
| 1110 | Ga0501043_0124312 | |||
| 1111 | Ga0501046_0002887 | |||
| 1112 | Ga0501047_0008173 | |||
| 1113 | Ga0501047_0396364 | |||
| 1114 | Ga0501048_0006561 | |||
| 1115 | Ga0501067_0001266 | |||
| 1116 | Ga0501068_0000768 | |||
| 1117 | Ga0501068_0312964 | |||
| 1118 | Ga0501069_0003086 | |||
| 1119 | Ga0501070_0006405 | |||
| 1120 | Ga0501071_0268271 | |||
| 1121 | Ga0501072_0000320 | |||
| 1122 | Ga0501073_0000432 | |||
| 1123 | Ga0501074_0025861 | |||
| 1124 | Ga0501077_0000457 | |||
| 1125 | Ga0501079_0001554 | |||
| 1126 | Ga0501080_0000559 | |||
| 1127 | Ga0501083_0009706 | |||
| 1128 | Ga0501035_0018483 | |||
| 1129 | Ga0501035_0020551 | |||
| 1130 | Ga0501035_0097186 | |||
| 1131 | Ga0501044_0000253 | |||
| 1132 | Ga0501044_0014229 | |||
| 1133 | Ga0501044_0050019 | |||
| 1134 | Ga0501044_0144647 | |||
| 1135 | Ga0501044_0191539 | |||
| 1136 | Ga0501045_0061274 | |||
| 1137 | nmdc:mga0qj67_21192_c1 | |||
| 1138 | nmdc:mga06r32_42990_c1 | |||
| 1139 | nmdc:mga06r32_67845_c1 | |||
| 1140 | Ga0495619_0315063 | |||
| 1141 | Ga0500568_0000656 | |||
| 1142 | Ga0501084_0002969 | |||
| 1143 | Ga0501082_0000628 | |||
| 1144 | Ga0501082_0008060 | |||
| 1145 | Ga0501082_0128114 | |||
| 1146 | 2792745462 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p4p-assembly1.cif.gz_A | structure of the quinolinate synthase a84l variant complexed with citrate | 0.9614 | 7 | 308 |
| 5lqm-assembly1.cif.gz_A | structure of quinolinate synthase y21f mutant in complex with citrate | 0.961 | 7 | 308 |
| 6ora-assembly2.cif.gz_B | an unexpected intermediate in the reaction catalyzed by quinolinate synthase | 0.9545 | 6 | 309 |
| 6f4l-assembly1.cif.gz_A | structure of quinolinate synthase with inhibitor-derived quinolinate | 0.9525 | 7 | 309 |
| 7p4q-assembly1.cif.gz_A | structure of the quinolinate synthase s124a variant complexed with citrate | 0.952 | 7 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57850_5_79_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9896 | 8 | 81 | 3.40.50.10800 |
| af_P11458_25_111_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9781 | 8 | 83 | 3.40.50.10800 |
| af_P9WJK1_121_190_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9711 | 94 | 163 | 3.40.50.10800 |
| af_Q57850_5_79_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9638 | 8 | 81 | 3.40.50.10800 |
| af_P9WJK1_121_190_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9577 | 94 | 163 | 3.40.50.10800 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350UMH4-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9958 | 1 | 309 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A496RG29-F1-model_v4 | quinolinate synthase (EC 2.5.1.72) | 0.9939 | 7 | 87 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A7C3LKM5-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9916 | 1 | 259 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A356FV10-F1-model_v4 | quinolinate synthase (EC 2.5.1.72) | 0.9911 | 64 | 174 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A6P0LQ32-F1-model_v4 | quinolinate synthase (EC 2.5.1.72) | 0.9895 | 6 | 136 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |