F465053

General Info

Members Datasets Scaffolds Average Seq Length
572 428 1144 129

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10395869|Ga0075364_103958692
Length 151
Sequence MGICLAVVHAAASLIQGEQSEMRKFLTALIVIPLGLILVTFAVANRHFVTVSFDPFIANDPSLSVTLPLFLLLILVAAIGVFAGGCAVWFGQRHWRRSARRHEADARAAKGELADLRAQAAAARPQPQRLPVPSGVGLYGPIGRDKQRATL

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
47 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
48 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
69 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
70 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
71 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
126 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
236 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
237 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
241 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
242 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
248 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
252 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
253 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
254 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
255 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
258 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
259 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
260 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
261 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
262 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
263 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
264 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
265 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
266 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
267 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
268 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
269 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
270 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
271 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
272 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
273 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
274 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
275 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
276 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
277 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
278 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
279 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
280 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
281 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
282 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
283 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
284 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
285 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
286 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
287 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
288 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
289 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
290 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
291 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
292 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
293 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
294 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
295 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
296 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
297 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
298 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
299 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
300 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
301 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
302 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
303 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
304 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
305 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
306 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
307 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
308 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
309 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
310 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
311 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
312 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
313 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
314 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
315 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
316 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
317 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
318 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
319 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
320 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
321 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
322 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
323 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
324 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
325 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
326 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
327 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
328 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
329 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
330 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
331 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
332 2922368715
333 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
334 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
335 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
336 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
337 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
338 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
339 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
340 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
341 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
342 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
343 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
344 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
345 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
346 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
347 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
348 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
349 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
350 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
351 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
352 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
353 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
354 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
355 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
356 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
357 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
358 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
359 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
360 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
361 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
362 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
363 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
364 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
365 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
366 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
367 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
368 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
369 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
370 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
371 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
372 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
373 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
374 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
375 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
376 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
377 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
378 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
379 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
380 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
381 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
382 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
383 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
384 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
385 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
386 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
387 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
388 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
389 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
390 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
391 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
392 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
393 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
394 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
395 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
396 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
397 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
398 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
399 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
400 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
401 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
402 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
403 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
404 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
405 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
406 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
407 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
408 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
409 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
410 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
411 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
412 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
413 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
414 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
415 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
416 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
417 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
418 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
419 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
420 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
421 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
422 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
423 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
424 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
425 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
426 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
427 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
428 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.4
Metatranscriptomes 0
Isolates 29.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.31
Nodule 25
Rhizoplane 6.82
Rhizosphere 38.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10395869 3300006051 Bacteria 942
2 JGI25153J46596_10012772 3300003215 Bacteria 3597
3 JGI25153J46596_10035951 3300003215 Bacteria 1596
4 JGI25153J46596_10066600 3300003215 Bacteria 952
5 JGI25160J50197_1007257 3300003354 Bacteria 4358
6 JGI25160J50197_1041459 3300003354 Bacteria 1057
7 Ga0055539_1022217 3300003752 Bacteria 750
8 Ga0055524_1018223 3300003775 Bacteria 2445
9 Ga0055543_1025478 3300004625 Bacteria 1055
10 Ga0055543_1034697 3300004625 Bacteria 869
11 Ga0065165_1002243 3300005262 Bacteria 17149
12 Ga0065165_1011462 3300005262 Bacteria 3694
13 Ga0065165_1018354 3300005262 Bacteria 2534
14 Ga0065165_1035411 3300005262 Bacteria 1533
15 Ga0070670_100066639 3300005331 Bacteria 3090
16 Ga0070668_100271994 3300005347 Bacteria 1412
17 Ga0070668_100355196 3300005347 Bacteria 1241
18 Ga0070675_100527734 3300005354 Bacteria 1066
19 Ga0070671_100613597 3300005355 Bacteria 940
20 Ga0070659_100130505 3300005366 Bacteria 2041
21 Ga0070667_100594104 3300005367 Bacteria 1019
22 Ga0070709_10008846 3300005434 Bacteria 5543
23 Ga0070709_10873573 3300005434 Bacteria 710
24 Ga0070714_100006113 3300005435 Bacteria 9251
25 Ga0070713_100091253 3300005436 Bacteria 2620
26 Ga0070710_10000629 3300005437 Bacteria 16796
27 Ga0070662_100136729 3300005457 Bacteria 1895
28 Ga0070685_11009007 3300005466 Bacteria 625
29 Ga0068853_101008501 3300005539 Bacteria 801
30 Ga0068853_102314823 3300005539 Bacteria 520
31 Ga0070693_100191580 3300005547 Bacteria 1322
32 Ga0070693_101186972 3300005547 Bacteria 586
33 Ga0070665_101260426 3300005548 Bacteria 750
34 Ga0068855_100160671 3300005563 Bacteria 2550
35 Ga0070664_100675982 3300005564 Bacteria 961
36 Ga0070664_101572316 3300005564 Bacteria 623
37 Ga0068857_100152287 3300005577 Bacteria 2095
38 Ga0068854_100718618 3300005578 Bacteria 864
39 Ga0068854_100866882 3300005578 Bacteria 791
40 Ga0068856_100226189 3300005614 Bacteria 1886
41 Ga0068852_100042583 3300005616 Bacteria 3844
42 Ga0068852_100840285 3300005616 Bacteria 933
43 Ga0068859_100259597 3300005617 Bacteria 1828
44 Ga0068861_100637757 3300005719 Bacteria 983
45 Ga0068851_10253071 3300005834 Bacteria 1000
46 Ga0068863_100923861 3300005841 Bacteria 873
47 Ga0068858_100218292 3300005842 Bacteria 1805
48 Ga0070717_11266299 3300006028 Bacteria 671
49 Ga0070717_11532208 3300006028 Bacteria 605
50 Ga0075365_10132509 3300006038 Bacteria 1725
51 Ga0075365_10414135 3300006038 Bacteria 951
52 Ga0075365_10989685 3300006038 Bacteria 593
53 Ga0075368_10206795 3300006042 Bacteria 831
54 Ga0075363_100073363 3300006048 Bacteria 1862
55 Ga0075364_10109178 3300006051 Bacteria 1845
56 Ga0075364_10318263 3300006051 Bacteria 1059
57 Ga0070716_100000748 3300006173 Bacteria 13913
58 Ga0070712_100006771 3300006175 Bacteria 7128
59 Ga0075367_10443354 3300006178 Bacteria 823
60 Ga0075367_10605055 3300006178 Bacteria 696
61 Ga0075369_10021998 3300006186 Bacteria 2627
62 Ga0075369_10196451 3300006186 Bacteria 930
63 Ga0075369_10238965 3300006186 Bacteria 842
64 Ga0075370_10176576 3300006353 Bacteria 1256
65 Ga0075370_10227862 3300006353 Bacteria 1102
66 Ga0075370_10268890 3300006353 Bacteria 1012
67 Ga0068871_100894542 3300006358 Bacteria 823
68 Ga0068865_101506558 3300006881 Bacteria 603
69 Ga0097620_100259609 3300006931 Bacteria 1828
70 Ga0099825_1028816 3300006941 Bacteria 2651
71 Ga0099824_1028268 3300006942 Bacteria 2571
72 Ga0099823_1042103 3300006944 Bacteria 3214
73 Ga0105240_10009403 3300009093 Bacteria 13842
74 Ga0105245_10819841 3300009098 Bacteria 969
75 Ga0105247_10415607 3300009101 Bacteria 962
76 Ga0105243_10550053 3300009148 Bacteria 1103
77 Ga0105241_10158524 3300009174 Bacteria 1858
78 Ga0105241_10310930 3300009174 Bacteria 1355
79 Ga0105248_10281752 3300009177 Bacteria 1871
80 Ga0105237_10088185 3300009545 Bacteria 3092
81 Ga0105237_10222303 3300009545 Bacteria 1888
82 Ga0105237_10871095 3300009545 Bacteria 907
83 Ga0105237_11295799 3300009545 Bacteria 735
84 Ga0105237_11758720 3300009545 Bacteria 627
85 Ga0105238_11658773 3300009551 Bacteria 670
86 Ga0105249_10184800 3300009553 Bacteria 2030
87 Ga0105239_10842293 3300010375 Bacteria 1051
88 Ga0105239_10869895 3300010375 Bacteria 1034
89 Ga0105239_11256521 3300010375 Bacteria 854
90 Ga0105239_11323495 3300010375 Bacteria 831
91 Ga0105246_10112658 3300011119 Bacteria 2001
92 Ga0157369_10173206 3300013105 Bacteria 2273
93 Ga0157374_10285324 3300013296 Bacteria 1630
94 Ga0157374_10588331 3300013296 Bacteria 1122
95 Ga0157378_10134101 3300013297 Bacteria 2295
96 Ga0157378_10802592 3300013297 Bacteria 967
97 Ga0163162_10326677 3300013306 Bacteria 1666
98 Ga0163162_10638028 3300013306 Bacteria 1189
99 Ga0157372_10692383 3300013307 Bacteria 1186
100 Ga0157375_11998885 3300013308 Bacteria 689
101 Ga0163163_10024134 3300014325 Bacteria 5785
102 Ga0157376_10294985 3300014969 Bacteria 1532
103 Ga0157376_11869883 3300014969 Bacteria 637
104 Ga0214544_1000056 3300021320 Bacteria 132760
105 Ga0214542_1000071 3300021321 Bacteria 124568
106 Ga0214545_1000033 3300021324 Bacteria 124568
107 Ga0214543_1000105 3300021327 Bacteria 108404
108 Ga0209677_103578 3300025253 Bacteria 4941
109 Ga0209148_1000308 3300025254 Bacteria 70131
110 Ga0209233_1008039 3300025261 Bacteria 3294
111 Ga0209455_1004819 3300025272 Bacteria 4311
112 Ga0209673_1018499 3300025273 Bacteria 2532
113 Ga0209564_1012878 3300025295 Bacteria 3604
114 Ga0209758_1002182 3300025297 Bacteria 20519
115 Ga0209758_1006901 3300025297 Bacteria 7930
116 Ga0209758_1020122 3300025297 Bacteria 3176
117 Ga0209758_1038246 3300025297 Bacteria 1842
118 Ga0209256_1026454 3300025299 Bacteria 1671
119 Ga0207426_1000628 3300025302 Bacteria 44820
120 Ga0207426_1001629 3300025302 Bacteria 17670
121 Ga0207426_1007863 3300025302 Bacteria 4404
122 Ga0209257_1100839 3300025304 Bacteria 704
123 Ga0209257_1112912 3300025304 Bacteria 645
124 Ga0207656_10162487 3300025321 Bacteria 1063
125 Ga0207656_10196791 3300025321 Bacteria 972
126 Ga0207692_10000489 3300025898 Bacteria 13992
127 Ga0207688_10027074 3300025901 Bacteria 3153
128 Ga0207680_10296243 3300025903 Bacteria 1127
129 Ga0207647_10206943 3300025904 Bacteria 1134
130 Ga0207699_10004893 3300025906 Bacteria 6408
131 Ga0207654_10028153 3300025911 Bacteria 3062
132 Ga0207695_10000107 3300025913 Bacteria 252606
133 Ga0207671_10006428 3300025914 Bacteria 10463
134 Ga0207671_10066601 3300025914 Bacteria 2681
135 Ga0207671_10250388 3300025914 Bacteria 1393
136 Ga0207671_10693862 3300025914 Bacteria 810
137 Ga0207693_10015141 3300025915 Bacteria 6190
138 Ga0207657_10168070 3300025919 Bacteria 1778
139 Ga0207657_10497872 3300025919 Bacteria 955
140 Ga0207649_10446790 3300025920 Bacteria 975
141 Ga0207694_11335908 3300025924 Bacteria 606
142 Ga0207687_10173395 3300025927 Bacteria 1665
143 Ga0207700_10040368 3300025928 Bacteria 3406
144 Ga0207664_10004352 3300025929 Bacteria 9590
145 Ga0207644_10254448 3300025931 Bacteria 1402
146 Ga0207669_10698242 3300025937 Bacteria 834
147 Ga0207665_10001984 3300025939 Bacteria 13791
148 Ga0207711_10614359 3300025941 Bacteria 1014
149 Ga0207689_10183982 3300025942 Bacteria 1723
150 Ga0207679_10763843 3300025945 Bacteria 880
151 Ga0207667_10079182 3300025949 Bacteria 3406
152 Ga0207668_10408817 3300025972 Bacteria 1149
153 Ga0207640_10943048 3300025981 Bacteria 756
154 Ga0207640_11179815 3300025981 Bacteria 680
155 Ga0207640_11368132 3300025981 Bacteria 633
156 Ga0207658_10453079 3300025986 Bacteria 1136
157 Ga0207677_10290108 3300026023 Bacteria 1347
158 Ga0207703_11129364 3300026035 Bacteria 753
159 Ga0207703_11381202 3300026035 Bacteria 677
160 Ga0207639_11041528 3300026041 Bacteria 767
161 Ga0207639_11093082 3300026041 Bacteria 748
162 Ga0207678_10178565 3300026067 Bacteria 1813
163 Ga0207678_10185745 3300026067 Bacteria 1775
164 Ga0207676_10321954 3300026095 Bacteria 1420
165 Ga0207698_10029531 3300026142 Bacteria 3928
166 Ga0207698_10210391 3300026142 Bacteria 1749
167 Ga0207698_10805355 3300026142 Bacteria 942
168 Ga0209389_1000208 3300027296 Bacteria 42287
169 Ga0209389_1000217 3300027296 Bacteria 39758
170 Ga0209589_1000032 3300027357 Bacteria 141881
171 Ga0209489_101970 3300027361 Bacteria 42287
172 Ga0209489_102214 3300027361 Bacteria 39758
173 Ga0209700_100011 3300027363 Bacteria 362159
174 Ga0268266_10322399 3300028379 Bacteria 1446
175 Ga0268266_12300927 3300028379 Bacteria 510
176 Ga0307511_10144762 3300030521 Bacteria 1384
177 Ga0307508_10263383 3300031616 Bacteria 1318
178 Ga0307510_10005143 3300033180 Bacteria 15547
179 Ga0395898_0121456 3300037466 Bacteria 2503
180 Ga0395905_0023934 3300037471 Bacteria 5766
181 Ga0395905_0128578 3300037471 Bacteria 2382
182 Ga0436365_0141650 3300039437 Bacteria 1412
183 Ga0436365_0778976 3300039437 Bacteria 824
184 Ga0451797_0576291 3300041453 Bacteria 735
185 Ga0451795_0194109 3300041456 Bacteria 1588
186 Ga0451807_2739048 3300041486 Bacteria 983
187 Ga0451833_0757510 3300041491 Bacteria 1443
188 Ga0451835_0405682 3300041492 Bacteria 2169
189 Ga0451849_0739337 3300041505 Bacteria 964
190 Ga0451853_0516734 3300041512 Bacteria 1853
191 Ga0466972_0012108 3300044658 Bacteria 4333
192 Ga0466972_0080945 3300044658 Bacteria 1546
193 Ga0466972_0154933 3300044658 Bacteria 1076
194 Ga0466965_0017444 3300044683 Bacteria 3432
195 Ga0466966_0022759 3300044684 Bacteria 4108
196 Ga0466961_0000662 3300044693 Bacteria 21706
197 Ga0466961_0290227 3300044693 Bacteria 1000
198 Ga0466961_0716038 3300044693 Bacteria 599
199 Ga0466963_0040413 3300044694 Bacteria 3057
200 Ga0466964_0026846 3300044706 Bacteria 2256
201 Ga0466964_0036335 3300044706 Bacteria 1975
202 Ga0466964_0361674 3300044706 Bacteria 748
203 Ga0466968_0013317 3300044735 Bacteria 3233
204 Ga0466968_0082913 3300044735 Bacteria 1412
205 Ga0466970_0433747 3300044765 Bacteria 752
206 Ga0466957_0315736 3300044842 Bacteria 1053
207 Ga0466960_0132121 3300044901 Bacteria 1318
208 Ga0466960_0416008 3300044901 Bacteria 776
209 Ga0466959_0058958 3300045049 Bacteria 2796
210 Ga0466959_0385622 3300045049 Bacteria 953
211 Ga0466967_1377483 3300045976 Bacteria 702
212 Ga0495590_0201735 3300046457 Bacteria 731
213 Ga0495629_0017589 3300046459 Bacteria 5124
214 Ga0495651_0018695 3300046462 Bacteria 5369
215 Ga0495651_0020933 3300046462 Bacteria 5078
216 Ga0495653_0416154 3300046463 Bacteria 851
217 Ga0495653_0455136 3300046463 Bacteria 804
218 Ga0495582_0029475 3300046473 Bacteria 3013
219 Ga0495605_0384107 3300046474 Bacteria 586
220 Ga0495662_0108799 3300046476 Bacteria 1358
221 Ga0495662_0240270 3300046476 Bacteria 892
222 Ga0495664_0019582 3300046477 Bacteria 3893
223 Ga0495664_0020677 3300046477 Bacteria 3798
224 Ga0495596_0432637 3300046500 Bacteria 513
225 Ga0495606_0258064 3300046507 Bacteria 963
226 Ga0495606_0372432 3300046507 Bacteria 751
227 Ga0495606_0375225 3300046507 Bacteria 747
228 Ga0495608_0058276 3300046511 Bacteria 2547
229 Ga0495608_0235413 3300046511 Bacteria 1145
230 Ga0495610_0075230 3300046512 Bacteria 1564
231 Ga0495610_0264456 3300046512 Bacteria 676
232 Ga0495620_0088909 3300046515 Bacteria 1241
233 Ga0495628_0654868 3300046516 Bacteria 745
234 Ga0495652_0015310 3300046529 Bacteria 6864
235 Ga0495652_0286207 3300046529 Bacteria 1204
236 Ga0495652_0404079 3300046529 Bacteria 966
237 Ga0495665_0211983 3300046531 Bacteria 1003
238 Ga0495640_0016170 3300046533 Bacteria 5586
239 Ga0495640_0318621 3300046533 Bacteria 963
240 Ga0495587_0072035 3300046536 Bacteria 2009
241 Ga0495587_0129098 3300046536 Bacteria 1445
242 Ga0495597_0032709 3300046542 Bacteria 2358
243 Ga0495645_0008934 3300046543 Bacteria 7000
244 Ga0495622_0070629 3300046557 Bacteria 1611
245 Ga0495622_0135998 3300046557 Bacteria 1117
246 Ga0495668_0034297 3300046616 Bacteria 2848
247 Ga0495668_0091745 3300046616 Bacteria 1664
248 Ga0495668_0100589 3300046616 Bacteria 1582
249 Ga0495668_0349234 3300046616 Bacteria 812
250 Ga0495634_0234370 3300046642 Bacteria 1128
251 Ga0495611_0168946 3300046648 Bacteria 1022
252 Ga0495611_0268847 3300046648 Bacteria 789
253 Ga0495625_0405455 3300046660 Bacteria 851
254 Ga0495635_0009992 3300046663 Bacteria 6634
255 Ga0495635_0096270 3300046663 Bacteria 2023
256 Ga0495588_0043969 3300046674 Bacteria 2286
257 Ga0495588_0206761 3300046674 Bacteria 1037
258 Ga0495657_0030217 3300046675 Bacteria 3796
259 Ga0495657_0064789 3300046675 Bacteria 2405
260 Ga0495599_0026057 3300046678 Bacteria 3663
261 Ga0495623_0341015 3300046679 Bacteria 818
262 Ga0495646_0238727 3300046680 Bacteria 977
263 Ga0495646_0658867 3300046680 Bacteria 529
264 Ga0495658_0241339 3300046683 Bacteria 1135
265 Ga0495613_0026391 3300046689 Bacteria 4327
266 Ga0495624_0046243 3300046690 Bacteria 2768
267 Ga0495600_0007962 3300046809 Bacteria 6493
268 Ga0495600_0097425 3300046809 Bacteria 1917
269 Ga0495660_0102555 3300046810 Bacteria 1471
270 Ga0495604_0020963 3300047317 Bacteria 5215
271 Ga0495604_0354892 3300047317 Bacteria 973
272 Ga0495674_0219166 3300047319 Bacteria 1573
273 Ga0495674_0276535 3300047319 Bacteria 1376
274 Ga0495676_0313623 3300047321 Bacteria 1055
275 Ga0495687_024499 3300047443 Bacteria 2867
276 Ga0495675_0147936 3300047444 Bacteria 1452
277 Ga0495673_0090510 3300047469 Bacteria 1251
278 Ga0495684_0032324 3300047471 Bacteria 4017
279 Ga0495684_0268497 3300047471 Bacteria 1235
280 Ga0495686_0046722 3300047472 Bacteria 2735
281 Ga0495686_0103581 3300047472 Bacteria 1714
282 Ga0495686_0404239 3300047472 Bacteria 732
283 Ga0495593_0107342 3300047673 Bacteria 1427
284 Ga0495593_0314328 3300047673 Bacteria 783
285 Ga0495602_0122714 3300048088 Bacteria 2087
286 Ga0495602_0429549 3300048088 Bacteria 936
287 Ga0496100_0698900 3300048903 Bacteria 791
288 Ga0496100_0780448 3300048903 Bacteria 748
289 Ga0496100_0894405 3300048903 Bacteria 697
290 Ga0496101_0196731 3300048904 Bacteria 1557
291 Ga0496101_0544971 3300048904 Bacteria 917
292 Ga0496101_0825764 3300048904 Bacteria 731
293 Ga0496102_0140823 3300048905 Bacteria 2261
294 Ga0496102_0837768 3300048905 Bacteria 842
295 Ga0496102_1249408 3300048905 Bacteria 662
296 Ga0496103_0112199 3300048906 Bacteria 1732
297 Ga0496103_0464042 3300048906 Bacteria 812
298 Ga0496104_0018514 3300048907 Bacteria 6354
299 Ga0496104_0327827 3300048907 Bacteria 1444
300 Ga0496105_0032766 3300048908 Bacteria 4266
301 Ga0496105_0499128 3300048908 Bacteria 955
302 Ga0496105_0609445 3300048908 Bacteria 846
303 Ga0496106_0197558 3300048909 Bacteria 1600
304 Ga0496106_0549337 3300048909 Bacteria 927
305 Ga0496106_1095902 3300048909 Bacteria 624
306 Ga0496107_0094331 3300048910 Bacteria 2189
307 Ga0496107_0453230 3300048910 Bacteria 953
308 Ga0496108_0197351 3300048911 Bacteria 1746
309 Ga0496108_0253413 3300048911 Bacteria 1531
310 Ga0496108_0767277 3300048911 Bacteria 833
311 Ga0496109_0438627 3300048912 Bacteria 1234
312 Ga0496109_0463021 3300048912 Bacteria 1197
313 Ga0496110_0395777 3300048913 Bacteria 1259
314 Ga0496110_0806259 3300048913 Bacteria 843
315 Ga0496111_0595804 3300048914 Bacteria 809
316 Ga0496112_0473095 3300048915 Bacteria 1190
317 Ga0496113_0499619 3300048916 Bacteria 976
318 Ga0496113_0618394 3300048916 Bacteria 867
319 Ga0496113_0634680 3300048916 Bacteria 854
320 Ga0496114_0087329 3300048917 Bacteria 2644
321 Ga0496115_0084025 3300048918 Bacteria 2595
322 Ga0496115_0876766 3300048918 Bacteria 693
323 Ga0496116_0098418 3300048919 Bacteria 1755
324 Ga0496118_0058777 3300048921 Bacteria 2869
325 Ga0496118_0091761 3300048921 Bacteria 2087
326 Ga0496118_0125495 3300048921 Bacteria 1662
327 Ga0496118_0144650 3300048921 Bacteria 1500
328 Ga0496119_0033986 3300048922 Bacteria 3368
329 Ga0496119_0088058 3300048922 Bacteria 1771
330 Ga0496119_0510423 3300048922 Bacteria 558
331 Ga0496120_0065702 3300048923 Bacteria 2008
332 Ga0496120_0092006 3300048923 Bacteria 1618
333 Ga0496121_0075538 3300048924 Bacteria 2691
334 Ga0496121_0095019 3300048924 Bacteria 2317
335 Ga0496121_0247498 3300048924 Bacteria 1238
336 Ga0496122_0165204 3300048925 Bacteria 1343
337 Ga0496122_0330268 3300048925 Bacteria 806
338 Ga0496123_0060737 3300048926 Bacteria 2435
339 Ga0496124_0513251 3300048927 Bacteria 800
340 Ga0496125_0095806 3300048928 Bacteria 2206
341 Ga0496125_0103548 3300048928 Bacteria 2088
342 Ga0496125_0235954 3300048928 Bacteria 1165
343 Ga0496126_0097498 3300048929 Bacteria 2576
344 Ga0496126_0135201 3300048929 Bacteria 2127
345 Ga0496126_0930762 3300048929 Bacteria 657
346 Ga0495682_0152803 3300049460 Bacteria 823
347 nmdc:mga03n38_547750_c1 3300050490 Bacteria 654
348 nmdc:mga00v17_256474_c1 3300050491 Bacteria 1134
349 nmdc:mga00v17_474784_c1 3300050491 Bacteria 811
350 nmdc:mga0yw44_192896_c1 3300050492 Bacteria 1344
351 nmdc:mga0yw44_197875_c1 3300050492 Bacteria 1327
352 nmdc:mga0yw44_664241_c1 3300050492 Bacteria 708
353 nmdc:mga0k408_312454_c1 3300050493 Bacteria 938
354 nmdc:mga06z11_228271_c1 3300050494 Bacteria 1090
355 nmdc:mga07m45_113698_c2 3300050496 Bacteria 515
356 nmdc:mga07m45_39854_c1 3300050496 Bacteria 1689
357 nmdc:mga07m45_642709_c1 3300050496 Bacteria 612
358 nmdc:mga0sz30_129668_c1 3300050516 Bacteria 1111
359 nmdc:mga0sz30_3632_c1 3300050516 Bacteria 5562
360 Ga0495655_0095585 3300053083 Bacteria 872
361 Ga0495619_0340881 3300053085 Bacteria 1037
362 Ga0500578_0075040 3300053086 Bacteria 2154
363 Ga0500578_0312177 3300053086 Bacteria 929
364 Ga0500578_0580502 3300053086 Bacteria 619
365 Ga0500643_000049 3300053087 Bacteria 147107
366 Ga0500647_0006641 3300053091 Bacteria 4908
367 Ga0500583_0029366 3300053092 Bacteria 2396
368 Ga0500651_0053276 3300053093 Bacteria 2537
369 Ga0500566_0260901 3300053094 Bacteria 837
370 Ga0500650_0077077 3300053098 Bacteria 1558
371 Ga0500650_0472682 3300053098 Bacteria 535
372 Ga0500555_004288 3300053103 Bacteria 4056
373 Ga0500556_0191723 3300053104 Bacteria 807
374 Ga0500557_000815 3300053105 Bacteria 4525
375 Ga0500569_012078 3300053109 Bacteria 2081
376 Ga0500594_0019864 3300053118 Bacteria 1669
377 Ga0500595_030678 3300053119 Bacteria 1809
378 Ga0500608_111181 3300053122 Bacteria 1256
379 Ga0500621_045961 3300053126 Bacteria 1766
380 Ga0500621_289322 3300053126 Bacteria 530
381 Ga0500626_172730 3300053128 Bacteria 878
382 Ga0500642_0000272 3300053130 Bacteria 19386
383 Ga0500658_0342884 3300053134 Bacteria 686
384 Ga0500559_0103201 3300053136 Bacteria 1315
385 Ga0500568_0144103 3300053139 Bacteria 882
386 Ga0500568_0239584 3300053139 Bacteria 661
387 Ga0500577_0034149 3300053142 Bacteria 1804
388 Ga0500577_0137040 3300053142 Bacteria 1030
389 Ga0500577_0275271 3300053142 Bacteria 733
390 Ga0500590_078850 3300053148 Bacteria 1622
391 Ga0500604_0158947 3300053151 Bacteria 769
392 Ga0500622_0012316 3300053156 Bacteria 4633
393 Ga0500627_0285681 3300053158 Bacteria 723
394 Ga0500633_0005051 3300053160 Bacteria 3094
395 Ga0500638_048138 3300053162 Bacteria 2063
396 Ga0500639_157341 3300053163 Bacteria 1039
397 Ga0500636_0161679 3300053177 Bacteria 1220
398 Ga0500636_0425705 3300053177 Bacteria 608
399 Ga0500625_024626 3300053729 Bacteria 2844
400 Ga0500645_070512 3300053730 Bacteria 1003
401 Ga0500609_005348 3300053731 Bacteria 1756
402 Ga0500599_000772 3300053736 Bacteria 3503
403 2507505116 2507262055 Bacteria 8048963
404 2508539051 2508501009 Bacteria 7784016
405 2508695368 2508501042 Bacteria 8719808
406 2511399421 2511231028 Bacteria 8046582
407 2513623221 2513237092 Bacteria 8341956
408 2513639801 2513237094 Bacteria 8789602
409 2513647713 2513237095 Bacteria 8976980
410 2513699273 2513237102 Bacteria 7703324
411 2513719812 2513237104 Bacteria 10034502
412 2513873661 2513237139 Bacteria 8737671
413 2514012355 2513237161 Bacteria 8871253
414 2515625617 2515154112 Bacteria 8294334
415 2524435971 2524023205 Bacteria 8918781
416 2528852465 2528768022 Bacteria 10457665
417 2617350979 2617270735 Bacteria 9163226
418 2617373634 2617270741 Bacteria 8201522
419 2745081568 2744054633 Bacteria 8678936
420 2793064910 2791355196 Bacteria 7323613
421 2805915744 2802429603 Bacteria 8777136
422 2818237532 2816332527 Bacteria 8933356
423 2824606074 2824600985 Bacteria 8488197
424 2824612209 2824609381 Bacteria 8672835
425 2824620688 2824617872 Bacteria 8814715
426 2824629885 2824626560 Bacteria 8813858
427 2824638300 2824635225 Bacteria 8785348
428 2824655534 2824653114 Bacteria 8493680
429 2824663889 2824661429 Bacteria 9877870
430 2824676971 2824671348 Bacteria 8369588
431 2824712771 2824704595 Bacteria 9667483
432 2824760364 2824753945 Bacteria 9787441
433 2824770814 2824763712 Bacteria 9792355
434 2824775643 2824773399 Bacteria 8360218
435 2838124379 2838122688 Bacteria 8803140
436 2841945072 2841941048 Bacteria 8688029
437 2841951858 2841949485 Bacteria 8680857
438 2841965743 2841957949 Bacteria 8652217
439 2841973766 2841966195 Bacteria 8673214
440 2841980092 2841974524 Bacteria 8931498
441 2841985275 2841983080 Bacteria 8395090
442 2842043623 2842038055 Bacteria 8002051
443 2842052387 2842045827 Bacteria 8006841
444 2844315172 2844315083 Bacteria 8138177
445 2847930956 2847930680 Bacteria 9342022
446 2847942012 2847939898 Bacteria 8606328
447 2849082923 2849076700 Bacteria 7039503
448 2857511807 2857509624 Bacteria 7472071
449 2874597115 2874590934 Bacteria 8299676
450 2874616649 2874612657 Bacteria 8252029
451 2874624667 2874620515 Bacteria 8290088
452 2874628931 2874628541 Bacteria 8630250
453 2874646921 2874645413 Bacteria 8214782
454 2876765563 2876761206 Bacteria 10111113
455 2876777579 2876771140 Bacteria 8287509
456 2876825661 2876818435 Bacteria 8274608
457 2879076140 2879074833 Bacteria 8279565
458 2879083313 2879083081 Bacteria 8587928
459 2879108692 2879099564 Bacteria 10442239
460 2879130945 2879127579 Bacteria 8294491
461 2879148820 2879142872 Bacteria 8267021
462 2881365797 2881364244 Bacteria 7710352
463 2881665943 2881665667 Bacteria 8175609
464 2885371159 2885366525 Bacteria 8326213
465 2885410516 2885409591 Bacteria 9235467
466 2888379712 2888378607 Bacteria 9652610
467 2888390795 2888388044 Bacteria 7304136
468 2888420430 2888419890 Bacteria 7857137
469 2903732074 2903727486 Bacteria 8281579
470 2904670378 2904666416 Bacteria 8226587
471 2904715703 2904711408 Bacteria 9771557
472 2906603121 2906602504 Bacteria 8295279
473 2906633408 2906626472 Bacteria 8826946
474 2906652038 2906643746 Bacteria 8722424
475 2908776106 2908775508 Bacteria 8092255
476 2922368809
477 2922396313 2922393267 Bacteria 8285685
478 2929618456 2929615660 Bacteria 9193770
479 2929628859 2929624759 Bacteria 9339455
480 2932786631 2932784394 Bacteria 9704911
481 2932794442 2932794094 Bacteria 7915132
482 2932806724 2932801729 Bacteria 7987968
483 2932812309 2932809354 Bacteria 9135765
484 2932823300 2932818245 Bacteria 9955613
485 2932829859 2932828146 Bacteria 9745859
486 2933580831 2933577622 Bacteria 9116884
487 2935615308 2935608549 Bacteria 8203142
488 2935618377 2935616580 Bacteria 9032984
489 2935641225 2935638405 Bacteria 10015038
490 2935654869 2935648319 Bacteria 8801166
491 2935663698 2935656913 Bacteria 8965014
492 2935670141 2935665750 Bacteria 9571747
493 2935680861 2935675223 Bacteria 9928132
494 2935689878 2935684952 Bacteria 9590419
495 2935698400 2935694250 Bacteria 9291695
496 2935707543 2935703347 Bacteria 10242284
497 2935717398 2935713505 Bacteria 9608509
498 2935723933 2935722832 Bacteria 9608746
499 2935740142 2935732158 Bacteria 9706831
500 2935749405 2935741537 Bacteria 9707219
501 2935757232 2935750917 Bacteria 9590372
502 2935763679 2935760218 Bacteria 9817913
503 2935782245 2935777560 Bacteria 8077691
504 2935789198 2935785616 Bacteria 7962367
505 2935797135 2935793552 Bacteria 8012592
506 2935804080 2935801545 Bacteria 9301974
507 2935815164 2935810662 Bacteria 9401221
508 2935825314 2935819856 Bacteria 8261050
509 2935830956 2935827899 Bacteria 10038562
510 2935841567 2935837841 Bacteria 9454360
511 2935853148 2935847175 Bacteria 8228321
512 2935862528 2935855204 Bacteria 9035059
513 2935866544 2935864058 Bacteria 9784707
514 2935874851 2935873716 Bacteria 9632195
515 2935888495 2935883170 Bacteria 7964738
516 2935910104 2935908558 Bacteria 8568796
517 2935918599 2935916978 Bacteria 9113783
518 2935927985 2935926038 Bacteria 8601059
519 2935936143 2935934488 Bacteria 8602579
520 2935944304 2935942939 Bacteria 8599779
521 2935952741 2935951376 Bacteria 8602333
522 2935962521 2935959822 Bacteria 7869783
523 2935969581 2935967501 Bacteria 8603075
524 2935977657 2935975950 Bacteria 8347125
525 2935985026 2935984226 Bacteria 8302647
526 2935994357 2935992306 Bacteria 9802711
527 2936004665 2936002035 Bacteria 9362176
528 2936017905 2936011229 Bacteria 8801034
529 2936026408 2936019824 Bacteria 8804134
530 2936031544 2936028420 Bacteria 8965941
531 2936043231 2936037263 Bacteria 9446081
532 2936053330 2936046547 Bacteria 8903709
533 2936056195 2936055302 Bacteria 8785755
534 2940563146 2940556831 Bacteria 9590747
535 2941535633 2941531003 Bacteria 7653939
536 2941543063 2941538514 Bacteria 9402094
537 3005486779 3005483717 Bacteria 7877331
538 3005509301 3005506211 Bacteria 6943378
539 3005594029 3005587118 Bacteria 7794411
540 3005594901 3005594810 Bacteria 8716512
541 3005710879 3005710791 Bacteria 7622528
542 3005718178 3005718088 Bacteria 8283608
543 8016518337 8016511872 Bacteria 9921665
544 8016526015 8016522445 Bacteria 8156687
545 8016539619 8016530956 Bacteria 8155261
546 8016543918 8016539877 Bacteria 8155419
547 8016557811 8016557553 Bacteria 8154380
548 8016569321 8016566248 Bacteria 8158151
549 8016581943 8016575299 Bacteria 8154085
550 8016586506 8016583857 Bacteria 10421953
551 8016595832 8016595262 Bacteria 8149947
552 8016606695 8016603502 Bacteria 8731218
553 8016618593 8016613128 Bacteria 8794220
554 8016623340 8016622563 Bacteria 7999408
555 8016635800 8016630954 Bacteria 9217207
556 8017058321 8017057580 Bacteria 10023680
557 8019530900 8019530166 Bacteria 8155624
558 8019540677 8019538911 Bacteria 7872763
559 8019550363 8019547302 Bacteria 7996444
560 8019577386 8019576017 Bacteria 10049540
561 8019595469 8019586578 Bacteria 10212056
562 8019606289 8019597564 Bacteria 10041141
563 8019612244 8019608314 Bacteria 10042931
564 8019622845 8019619141 Bacteria 9218857
565 8019630267 8019629233 Bacteria 8687553
566 8019640343 8019638758 Bacteria 9062356
567 8019667096 8019659431 Bacteria 8577854
568 8019676886 8019668869 Bacteria 8791617
569 8019679104 8019678201 Bacteria 8863603
570 8019696421 8019687851 Bacteria 8712826
571 8055742307 8055742211 Bacteria 9226248
572 8056971163 8056967851 Bacteria 9038162
573 Ga0075364_10395869
574 JGI25153J46596_10012772
575 JGI25153J46596_10035951
576 JGI25153J46596_10066600
577 JGI25160J50197_1007257
578 JGI25160J50197_1041459
579 Ga0055539_1022217
580 Ga0055524_1018223
581 Ga0055543_1025478
582 Ga0055543_1034697
583 Ga0065165_1002243
584 Ga0065165_1011462
585 Ga0065165_1018354
586 Ga0065165_1035411
587 Ga0070670_100066639
588 Ga0070668_100271994
589 Ga0070668_100355196
590 Ga0070675_100527734
591 Ga0070671_100613597
592 Ga0070659_100130505
593 Ga0070667_100594104
594 Ga0070709_10008846
595 Ga0070709_10873573
596 Ga0070714_100006113
597 Ga0070713_100091253
598 Ga0070710_10000629
599 Ga0070662_100136729
600 Ga0070685_11009007
601 Ga0068853_101008501
602 Ga0068853_102314823
603 Ga0070693_100191580
604 Ga0070693_101186972
605 Ga0070665_101260426
606 Ga0068855_100160671
607 Ga0070664_100675982
608 Ga0070664_101572316
609 Ga0068857_100152287
610 Ga0068854_100718618
611 Ga0068854_100866882
612 Ga0068856_100226189
613 Ga0068852_100042583
614 Ga0068852_100840285
615 Ga0068859_100259597
616 Ga0068861_100637757
617 Ga0068851_10253071
618 Ga0068863_100923861
619 Ga0068858_100218292
620 Ga0070717_11266299
621 Ga0070717_11532208
622 Ga0075365_10132509
623 Ga0075365_10414135
624 Ga0075365_10989685
625 Ga0075368_10206795
626 Ga0075363_100073363
627 Ga0075364_10109178
628 Ga0075364_10318263
629 Ga0070716_100000748
630 Ga0070712_100006771
631 Ga0075367_10443354
632 Ga0075367_10605055
633 Ga0075369_10021998
634 Ga0075369_10196451
635 Ga0075369_10238965
636 Ga0075370_10176576
637 Ga0075370_10227862
638 Ga0075370_10268890
639 Ga0068871_100894542
640 Ga0068865_101506558
641 Ga0097620_100259609
642 Ga0099825_1028816
643 Ga0099824_1028268
644 Ga0099823_1042103
645 Ga0105240_10009403
646 Ga0105245_10819841
647 Ga0105247_10415607
648 Ga0105243_10550053
649 Ga0105241_10158524
650 Ga0105241_10310930
651 Ga0105248_10281752
652 Ga0105237_10088185
653 Ga0105237_10222303
654 Ga0105237_10871095
655 Ga0105237_11295799
656 Ga0105237_11758720
657 Ga0105238_11658773
658 Ga0105249_10184800
659 Ga0105239_10842293
660 Ga0105239_10869895
661 Ga0105239_11256521
662 Ga0105239_11323495
663 Ga0105246_10112658
664 Ga0157369_10173206
665 Ga0157374_10285324
666 Ga0157374_10588331
667 Ga0157378_10134101
668 Ga0157378_10802592
669 Ga0163162_10326677
670 Ga0163162_10638028
671 Ga0157372_10692383
672 Ga0157375_11998885
673 Ga0163163_10024134
674 Ga0157376_10294985
675 Ga0157376_11869883
676 Ga0214544_1000056
677 Ga0214542_1000071
678 Ga0214545_1000033
679 Ga0214543_1000105
680 Ga0209677_103578
681 Ga0209148_1000308
682 Ga0209233_1008039
683 Ga0209455_1004819
684 Ga0209673_1018499
685 Ga0209564_1012878
686 Ga0209758_1002182
687 Ga0209758_1006901
688 Ga0209758_1020122
689 Ga0209758_1038246
690 Ga0209256_1026454
691 Ga0207426_1000628
692 Ga0207426_1001629
693 Ga0207426_1007863
694 Ga0209257_1100839
695 Ga0209257_1112912
696 Ga0207656_10162487
697 Ga0207656_10196791
698 Ga0207692_10000489
699 Ga0207688_10027074
700 Ga0207680_10296243
701 Ga0207647_10206943
702 Ga0207699_10004893
703 Ga0207654_10028153
704 Ga0207695_10000107
705 Ga0207671_10006428
706 Ga0207671_10066601
707 Ga0207671_10250388
708 Ga0207671_10693862
709 Ga0207693_10015141
710 Ga0207657_10168070
711 Ga0207657_10497872
712 Ga0207649_10446790
713 Ga0207694_11335908
714 Ga0207687_10173395
715 Ga0207700_10040368
716 Ga0207664_10004352
717 Ga0207644_10254448
718 Ga0207669_10698242
719 Ga0207665_10001984
720 Ga0207711_10614359
721 Ga0207689_10183982
722 Ga0207679_10763843
723 Ga0207667_10079182
724 Ga0207668_10408817
725 Ga0207640_10943048
726 Ga0207640_11179815
727 Ga0207640_11368132
728 Ga0207658_10453079
729 Ga0207677_10290108
730 Ga0207703_11129364
731 Ga0207703_11381202
732 Ga0207639_11041528
733 Ga0207639_11093082
734 Ga0207678_10178565
735 Ga0207678_10185745
736 Ga0207676_10321954
737 Ga0207698_10029531
738 Ga0207698_10210391
739 Ga0207698_10805355
740 Ga0209389_1000208
741 Ga0209389_1000217
742 Ga0209589_1000032
743 Ga0209489_101970
744 Ga0209489_102214
745 Ga0209700_100011
746 Ga0268266_10322399
747 Ga0268266_12300927
748 Ga0307511_10144762
749 Ga0307508_10263383
750 Ga0307510_10005143
751 Ga0395898_0121456
752 Ga0395905_0023934
753 Ga0395905_0128578
754 Ga0436365_0141650
755 Ga0436365_0778976
756 Ga0451797_0576291
757 Ga0451795_0194109
758 Ga0451807_2739048
759 Ga0451833_0757510
760 Ga0451835_0405682
761 Ga0451849_0739337
762 Ga0451853_0516734
763 Ga0466972_0012108
764 Ga0466972_0080945
765 Ga0466972_0154933
766 Ga0466965_0017444
767 Ga0466966_0022759
768 Ga0466961_0000662
769 Ga0466961_0290227
770 Ga0466961_0716038
771 Ga0466963_0040413
772 Ga0466964_0026846
773 Ga0466964_0036335
774 Ga0466964_0361674
775 Ga0466968_0013317
776 Ga0466968_0082913
777 Ga0466970_0433747
778 Ga0466957_0315736
779 Ga0466960_0132121
780 Ga0466960_0416008
781 Ga0466959_0058958
782 Ga0466959_0385622
783 Ga0466967_1377483
784 Ga0495590_0201735
785 Ga0495629_0017589
786 Ga0495651_0018695
787 Ga0495651_0020933
788 Ga0495653_0416154
789 Ga0495653_0455136
790 Ga0495582_0029475
791 Ga0495605_0384107
792 Ga0495662_0108799
793 Ga0495662_0240270
794 Ga0495664_0019582
795 Ga0495664_0020677
796 Ga0495596_0432637
797 Ga0495606_0258064
798 Ga0495606_0372432
799 Ga0495606_0375225
800 Ga0495608_0058276
801 Ga0495608_0235413
802 Ga0495610_0075230
803 Ga0495610_0264456
804 Ga0495620_0088909
805 Ga0495628_0654868
806 Ga0495652_0015310
807 Ga0495652_0286207
808 Ga0495652_0404079
809 Ga0495665_0211983
810 Ga0495640_0016170
811 Ga0495640_0318621
812 Ga0495587_0072035
813 Ga0495587_0129098
814 Ga0495597_0032709
815 Ga0495645_0008934
816 Ga0495622_0070629
817 Ga0495622_0135998
818 Ga0495668_0034297
819 Ga0495668_0091745
820 Ga0495668_0100589
821 Ga0495668_0349234
822 Ga0495634_0234370
823 Ga0495611_0168946
824 Ga0495611_0268847
825 Ga0495625_0405455
826 Ga0495635_0009992
827 Ga0495635_0096270
828 Ga0495588_0043969
829 Ga0495588_0206761
830 Ga0495657_0030217
831 Ga0495657_0064789
832 Ga0495599_0026057
833 Ga0495623_0341015
834 Ga0495646_0238727
835 Ga0495646_0658867
836 Ga0495658_0241339
837 Ga0495613_0026391
838 Ga0495624_0046243
839 Ga0495600_0007962
840 Ga0495600_0097425
841 Ga0495660_0102555
842 Ga0495604_0020963
843 Ga0495604_0354892
844 Ga0495674_0219166
845 Ga0495674_0276535
846 Ga0495676_0313623
847 Ga0495687_024499
848 Ga0495675_0147936
849 Ga0495673_0090510
850 Ga0495684_0032324
851 Ga0495684_0268497
852 Ga0495686_0046722
853 Ga0495686_0103581
854 Ga0495686_0404239
855 Ga0495593_0107342
856 Ga0495593_0314328
857 Ga0495602_0122714
858 Ga0495602_0429549
859 Ga0496100_0698900
860 Ga0496100_0780448
861 Ga0496100_0894405
862 Ga0496101_0196731
863 Ga0496101_0544971
864 Ga0496101_0825764
865 Ga0496102_0140823
866 Ga0496102_0837768
867 Ga0496102_1249408
868 Ga0496103_0112199
869 Ga0496103_0464042
870 Ga0496104_0018514
871 Ga0496104_0327827
872 Ga0496105_0032766
873 Ga0496105_0499128
874 Ga0496105_0609445
875 Ga0496106_0197558
876 Ga0496106_0549337
877 Ga0496106_1095902
878 Ga0496107_0094331
879 Ga0496107_0453230
880 Ga0496108_0197351
881 Ga0496108_0253413
882 Ga0496108_0767277
883 Ga0496109_0438627
884 Ga0496109_0463021
885 Ga0496110_0395777
886 Ga0496110_0806259
887 Ga0496111_0595804
888 Ga0496112_0473095
889 Ga0496113_0499619
890 Ga0496113_0618394
891 Ga0496113_0634680
892 Ga0496114_0087329
893 Ga0496115_0084025
894 Ga0496115_0876766
895 Ga0496116_0098418
896 Ga0496118_0058777
897 Ga0496118_0091761
898 Ga0496118_0125495
899 Ga0496118_0144650
900 Ga0496119_0033986
901 Ga0496119_0088058
902 Ga0496119_0510423
903 Ga0496120_0065702
904 Ga0496120_0092006
905 Ga0496121_0075538
906 Ga0496121_0095019
907 Ga0496121_0247498
908 Ga0496122_0165204
909 Ga0496122_0330268
910 Ga0496123_0060737
911 Ga0496124_0513251
912 Ga0496125_0095806
913 Ga0496125_0103548
914 Ga0496125_0235954
915 Ga0496126_0097498
916 Ga0496126_0135201
917 Ga0496126_0930762
918 Ga0495682_0152803
919 nmdc:mga03n38_547750_c1
920 nmdc:mga00v17_256474_c1
921 nmdc:mga00v17_474784_c1
922 nmdc:mga0yw44_192896_c1
923 nmdc:mga0yw44_197875_c1
924 nmdc:mga0yw44_664241_c1
925 nmdc:mga0k408_312454_c1
926 nmdc:mga06z11_228271_c1
927 nmdc:mga07m45_113698_c2
928 nmdc:mga07m45_39854_c1
929 nmdc:mga07m45_642709_c1
930 nmdc:mga0sz30_129668_c1
931 nmdc:mga0sz30_3632_c1
932 Ga0495655_0095585
933 Ga0495619_0340881
934 Ga0500578_0075040
935 Ga0500578_0312177
936 Ga0500578_0580502
937 Ga0500643_000049
938 Ga0500647_0006641
939 Ga0500583_0029366
940 Ga0500651_0053276
941 Ga0500566_0260901
942 Ga0500650_0077077
943 Ga0500650_0472682
944 Ga0500555_004288
945 Ga0500556_0191723
946 Ga0500557_000815
947 Ga0500569_012078
948 Ga0500594_0019864
949 Ga0500595_030678
950 Ga0500608_111181
951 Ga0500621_045961
952 Ga0500621_289322
953 Ga0500626_172730
954 Ga0500642_0000272
955 Ga0500658_0342884
956 Ga0500559_0103201
957 Ga0500568_0144103
958 Ga0500568_0239584
959 Ga0500577_0034149
960 Ga0500577_0137040
961 Ga0500577_0275271
962 Ga0500590_078850
963 Ga0500604_0158947
964 Ga0500622_0012316
965 Ga0500627_0285681
966 Ga0500633_0005051
967 Ga0500638_048138
968 Ga0500639_157341
969 Ga0500636_0161679
970 Ga0500636_0425705
971 Ga0500625_024626
972 Ga0500645_070512
973 Ga0500609_005348
974 Ga0500599_000772
975 2507505116
976 2508539051
977 2508695368
978 2511399421
979 2513623221
980 2513639801
981 2513647713
982 2513699273
983 2513719812
984 2513873661
985 2514012355
986 2515625617
987 2524435971
988 2528852465
989 2617350979
990 2617373634
991 2745081568
992 2793064910
993 2805915744
994 2818237532
995 2824606074
996 2824612209
997 2824620688
998 2824629885
999 2824638300
1000 2824655534
1001 2824663889
1002 2824676971
1003 2824712771
1004 2824760364
1005 2824770814
1006 2824775643
1007 2838124379
1008 2841945072
1009 2841951858
1010 2841965743
1011 2841973766
1012 2841980092
1013 2841985275
1014 2842043623
1015 2842052387
1016 2844315172
1017 2847930956
1018 2847942012
1019 2849082923
1020 2857511807
1021 2874597115
1022 2874616649
1023 2874624667
1024 2874628931
1025 2874646921
1026 2876765563
1027 2876777579
1028 2876825661
1029 2879076140
1030 2879083313
1031 2879108692
1032 2879130945
1033 2879148820
1034 2881365797
1035 2881665943
1036 2885371159
1037 2885410516
1038 2888379712
1039 2888390795
1040 2888420430
1041 2903732074
1042 2904670378
1043 2904715703
1044 2906603121
1045 2906633408
1046 2906652038
1047 2908776106
1048 2922368809
1049 2922396313
1050 2929618456
1051 2929628859
1052 2932786631
1053 2932794442
1054 2932806724
1055 2932812309
1056 2932823300
1057 2932829859
1058 2933580831
1059 2935615308
1060 2935618377
1061 2935641225
1062 2935654869
1063 2935663698
1064 2935670141
1065 2935680861
1066 2935689878
1067 2935698400
1068 2935707543
1069 2935717398
1070 2935723933
1071 2935740142
1072 2935749405
1073 2935757232
1074 2935763679
1075 2935782245
1076 2935789198
1077 2935797135
1078 2935804080
1079 2935815164
1080 2935825314
1081 2935830956
1082 2935841567
1083 2935853148
1084 2935862528
1085 2935866544
1086 2935874851
1087 2935888495
1088 2935910104
1089 2935918599
1090 2935927985
1091 2935936143
1092 2935944304
1093 2935952741
1094 2935962521
1095 2935969581
1096 2935977657
1097 2935985026
1098 2935994357
1099 2936004665
1100 2936017905
1101 2936026408
1102 2936031544
1103 2936043231
1104 2936053330
1105 2936056195
1106 2940563146
1107 2941535633
1108 2941543063
1109 3005486779
1110 3005509301
1111 3005594029
1112 3005594901
1113 3005710879
1114 3005718178
1115 8016518337
1116 8016526015
1117 8016539619
1118 8016543918
1119 8016557811
1120 8016569321
1121 8016581943
1122 8016586506
1123 8016595832
1124 8016606695
1125 8016618593
1126 8016623340
1127 8016635800
1128 8017058321
1129 8019530900
1130 8019540677
1131 8019550363
1132 8019577386
1133 8019595469
1134 8019606289
1135 8019612244
1136 8019622845
1137 8019630267
1138 8019640343
1139 8019667096
1140 8019676886
1141 8019679104
1142 8019696421
1143 8055742307
1144 8056971163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map