F464936
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 571 | 264 | 1142 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10004897|Ga0105245_100048979 |
| Length | 173 |
| Sequence | MAATSGPVNDSGRQLLRHTVSTLAYRAGKTLRDAPDTFASFSTGEKGRTPAQILAHMGDLFDWALSIAQGKQAWRDSEPLPWPEEVKRFFRTLEAFDGYLASDAPLAASPEKLFQGPIADALTHTGQIAILRRMAGCPMRRENYYRAEIVAGCVGEEQAAPVGRSDQQAPRAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 98 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 163 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.12 |
| Metatranscriptomes | 0.88 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.25 |
| Rhizosphere | 93.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 34.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105245_10004897 | 3300009098 | Bacteria | 11773 |
| 2 | SwRhRL3b_contig_2779551 | 2162886006 | Bacteria | 902 |
| 3 | SwRhRL3b_contig_4178110 | 2162886006 | Bacteria | 1699 |
| 4 | JGI25406J46586_10083987 | 3300003203 | Bacteria | 971 |
| 5 | rootH1_10252652 | 3300003323 | Unclassified | 1538 |
| 6 | Ga0058863_10013587 | 3300004799 | Unclassified | 1206 |
| 7 | Ga0065704_10112719 | 3300005289 | Unclassified | 1917 |
| 8 | Ga0065712_10383174 | 3300005290 | Bacteria | 750 |
| 9 | Ga0065707_10012500 | 3300005295 | Bacteria | 1697 |
| 10 | Ga0070658_10326582 | 3300005327 | Bacteria | 1310 |
| 11 | Ga0070676_10042342 | 3300005328 | Bacteria | 2643 |
| 12 | Ga0070683_100015514 | 3300005329 | Bacteria | 6695 |
| 13 | Ga0070683_100068498 | 3300005329 | Unclassified | 3307 |
| 14 | Ga0070683_100075403 | 3300005329 | Bacteria | 3151 |
| 15 | Ga0070683_100634850 | 3300005329 | Bacteria | 1022 |
| 16 | Ga0070670_100162920 | 3300005331 | Bacteria | 1933 |
| 17 | Ga0068869_100275106 | 3300005334 | Unclassified | 1352 |
| 18 | Ga0068869_100381234 | 3300005334 | Bacteria | 1156 |
| 19 | Ga0070666_10985885 | 3300005335 | Unclassified | 625 |
| 20 | Ga0070680_100593510 | 3300005336 | Unclassified | 950 |
| 21 | Ga0070682_100044294 | 3300005337 | Bacteria | 2754 |
| 22 | Ga0070682_100252719 | 3300005337 | Unclassified | 1272 |
| 23 | Ga0068868_100018233 | 3300005338 | Bacteria | 5244 |
| 24 | Ga0070691_10020822 | 3300005341 | Bacteria | 3032 |
| 25 | Ga0070661_100008470 | 3300005344 | Bacteria | 7114 |
| 26 | Ga0070661_100073097 | 3300005344 | Bacteria | 2524 |
| 27 | Ga0070661_100639310 | 3300005344 | Bacteria | 863 |
| 28 | Ga0070668_100283482 | 3300005347 | Unclassified | 1384 |
| 29 | Ga0070675_100111661 | 3300005354 | Bacteria | 2313 |
| 30 | Ga0070673_100008961 | 3300005364 | Bacteria | 6691 |
| 31 | Ga0070709_10201518 | 3300005434 | Bacteria | 1410 |
| 32 | Ga0070709_11129612 | 3300005434 | Unclassified | 628 |
| 33 | Ga0070714_100007726 | 3300005435 | Bacteria | 8376 |
| 34 | Ga0070714_100052990 | 3300005435 | Bacteria | 3461 |
| 35 | Ga0070714_100105576 | 3300005435 | Bacteria | 2487 |
| 36 | Ga0070714_100267407 | 3300005435 | Bacteria | 1585 |
| 37 | Ga0070713_100066976 | 3300005436 | Bacteria | 3022 |
| 38 | Ga0070713_100108646 | 3300005436 | Unclassified | 2415 |
| 39 | Ga0070713_100187238 | 3300005436 | Bacteria | 1863 |
| 40 | Ga0070713_100392408 | 3300005436 | Unclassified | 1295 |
| 41 | Ga0070713_100458190 | 3300005436 | Bacteria | 1199 |
| 42 | Ga0070713_100605168 | 3300005436 | Unclassified | 1041 |
| 43 | Ga0070713_100765451 | 3300005436 | Bacteria | 924 |
| 44 | Ga0070713_100802595 | 3300005436 | Unclassified | 902 |
| 45 | Ga0070710_10118591 | 3300005437 | Unclassified | 1598 |
| 46 | Ga0070710_10325566 | 3300005437 | Bacteria | 1010 |
| 47 | Ga0070710_10473375 | 3300005437 | Unclassified | 853 |
| 48 | Ga0070710_10829245 | 3300005437 | Unclassified | 662 |
| 49 | Ga0070711_100005541 | 3300005439 | Bacteria | 7560 |
| 50 | Ga0070711_100227540 | 3300005439 | Bacteria | 1453 |
| 51 | Ga0070711_100347595 | 3300005439 | Bacteria | 1192 |
| 52 | Ga0070711_101499484 | 3300005439 | Bacteria | 588 |
| 53 | Ga0070711_101832205 | 3300005439 | Unclassified | 533 |
| 54 | Ga0070705_100000686 | 3300005440 | Bacteria | 19399 |
| 55 | Ga0070700_101296392 | 3300005441 | Unclassified | 612 |
| 56 | Ga0070694_100000317 | 3300005444 | Bacteria | 25971 |
| 57 | Ga0070708_100000002 | 3300005445 | Bacteria | 195857 |
| 58 | Ga0070663_100593534 | 3300005455 | Bacteria | 931 |
| 59 | Ga0070678_100214333 | 3300005456 | Bacteria | 1597 |
| 60 | Ga0070681_10232553 | 3300005458 | Bacteria | 1757 |
| 61 | Ga0070681_10495743 | 3300005458 | Unclassified | 1134 |
| 62 | Ga0070681_10619385 | 3300005458 | Unclassified | 997 |
| 63 | Ga0070706_100008336 | 3300005467 | Bacteria | 9654 |
| 64 | Ga0070706_100771771 | 3300005467 | Bacteria | 890 |
| 65 | Ga0070707_100408915 | 3300005468 | Bacteria | 1317 |
| 66 | Ga0070698_100006598 | 3300005471 | Bacteria | 12581 |
| 67 | Ga0070698_100039870 | 3300005471 | Bacteria | 4829 |
| 68 | Ga0070699_100000483 | 3300005518 | Bacteria | 37967 |
| 69 | Ga0070699_101071784 | 3300005518 | Bacteria | 739 |
| 70 | Ga0070679_100858085 | 3300005530 | Unclassified | 851 |
| 71 | Ga0070684_100002219 | 3300005535 | Bacteria | 14329 |
| 72 | Ga0070684_100051120 | 3300005535 | Bacteria | 3590 |
| 73 | Ga0070684_100173565 | 3300005535 | Bacteria | 1958 |
| 74 | Ga0070684_100271665 | 3300005535 | Unclassified | 1552 |
| 75 | Ga0070684_100707427 | 3300005535 | Unclassified | 939 |
| 76 | Ga0070697_100100307 | 3300005536 | Unclassified | 2404 |
| 77 | Ga0070697_101457022 | 3300005536 | Unclassified | 612 |
| 78 | Ga0068853_100024797 | 3300005539 | Bacteria | 5031 |
| 79 | Ga0068853_100119048 | 3300005539 | Bacteria | 2353 |
| 80 | Ga0068853_100161813 | 3300005539 | Bacteria | 2020 |
| 81 | Ga0070672_100013140 | 3300005543 | Bacteria | 5837 |
| 82 | Ga0070695_100000115 | 3300005545 | Bacteria | 35742 |
| 83 | Ga0070696_100000303 | 3300005546 | Bacteria | 29759 |
| 84 | Ga0070696_101385896 | 3300005546 | Bacteria | 599 |
| 85 | Ga0070693_100024674 | 3300005547 | Bacteria | 3227 |
| 86 | Ga0070693_100214091 | 3300005547 | Unclassified | 1259 |
| 87 | Ga0070693_100477723 | 3300005547 | Bacteria | 880 |
| 88 | Ga0068855_100002549 | 3300005563 | Bacteria | 22448 |
| 89 | Ga0068855_100025864 | 3300005563 | Bacteria | 7019 |
| 90 | Ga0068855_100033538 | 3300005563 | Bacteria | 6126 |
| 91 | Ga0068855_100186640 | 3300005563 | Unclassified | 2341 |
| 92 | Ga0068855_100398105 | 3300005563 | Bacteria | 1509 |
| 93 | Ga0070664_100251654 | 3300005564 | Unclassified | 1588 |
| 94 | Ga0070664_100815986 | 3300005564 | Unclassified | 873 |
| 95 | Ga0070664_100912571 | 3300005564 | Bacteria | 824 |
| 96 | Ga0068857_100080026 | 3300005577 | Bacteria | 2918 |
| 97 | Ga0068857_100159055 | 3300005577 | Bacteria | 2049 |
| 98 | Ga0068854_100027270 | 3300005578 | Bacteria | 3936 |
| 99 | Ga0068854_100114794 | 3300005578 | Bacteria | 2036 |
| 100 | Ga0068854_101908380 | 3300005578 | Unclassified | 546 |
| 101 | Ga0068856_100006613 | 3300005614 | Bacteria | 11356 |
| 102 | Ga0068856_100009318 | 3300005614 | Bacteria | 9535 |
| 103 | Ga0068856_100025597 | 3300005614 | Bacteria | 5754 |
| 104 | Ga0068856_100078534 | 3300005614 | Bacteria | 3272 |
| 105 | Ga0068856_100144230 | 3300005614 | Bacteria | 2389 |
| 106 | Ga0068852_100001843 | 3300005616 | Bacteria | 14406 |
| 107 | Ga0068852_100020336 | 3300005616 | Bacteria | 5278 |
| 108 | Ga0068852_100603974 | 3300005616 | Bacteria | 1101 |
| 109 | Ga0068852_101422290 | 3300005616 | Unclassified | 716 |
| 110 | Ga0068864_100438033 | 3300005618 | Unclassified | 1248 |
| 111 | Ga0068861_100388891 | 3300005719 | Unclassified | 1234 |
| 112 | Ga0068851_10000736 | 3300005834 | Bacteria | 13995 |
| 113 | Ga0068851_10012540 | 3300005834 | Bacteria | 3997 |
| 114 | Ga0068851_10190635 | 3300005834 | Unclassified | 1140 |
| 115 | Ga0068863_100072097 | 3300005841 | Bacteria | 3268 |
| 116 | Ga0068863_100954421 | 3300005841 | Unclassified | 859 |
| 117 | Ga0068858_100189495 | 3300005842 | Unclassified | 1943 |
| 118 | Ga0068858_100405602 | 3300005842 | Unclassified | 1310 |
| 119 | Ga0081539_10066233 | 3300005985 | Unclassified | 1958 |
| 120 | Ga0070717_10075091 | 3300006028 | Bacteria | 2827 |
| 121 | Ga0070717_10136240 | 3300006028 | Bacteria | 2115 |
| 122 | Ga0070717_10208702 | 3300006028 | Unclassified | 1713 |
| 123 | Ga0070717_10220828 | 3300006028 | Unclassified | 1665 |
| 124 | Ga0070717_10268129 | 3300006028 | Unclassified | 1512 |
| 125 | Ga0070715_10023807 | 3300006163 | Unclassified | 2403 |
| 126 | Ga0070715_10222153 | 3300006163 | Unclassified | 972 |
| 127 | Ga0070715_10314846 | 3300006163 | Unclassified | 842 |
| 128 | Ga0070716_100041752 | 3300006173 | Bacteria | 2557 |
| 129 | Ga0070716_100078516 | 3300006173 | Bacteria | 1963 |
| 130 | Ga0070716_100547631 | 3300006173 | Unclassified | 862 |
| 131 | Ga0070712_100012073 | 3300006175 | Bacteria | 5490 |
| 132 | Ga0070712_100025539 | 3300006175 | Unclassified | 3928 |
| 133 | Ga0070712_100244153 | 3300006175 | Bacteria | 1432 |
| 134 | Ga0070712_100361955 | 3300006175 | Unclassified | 1190 |
| 135 | Ga0070712_100451029 | 3300006175 | Unclassified | 1071 |
| 136 | Ga0070712_100833417 | 3300006175 | Unclassified | 793 |
| 137 | Ga0097621_100008852 | 3300006237 | Bacteria | 7277 |
| 138 | Ga0097621_100522197 | 3300006237 | Bacteria | 1078 |
| 139 | Ga0097621_101031654 | 3300006237 | Bacteria | 770 |
| 140 | Ga0075428_100000525 | 3300006844 | Bacteria | 39005 |
| 141 | Ga0068865_100053870 | 3300006881 | Bacteria | 2793 |
| 142 | Ga0075436_100059842 | 3300006914 | Bacteria | 2631 |
| 143 | Ga0075436_100104009 | 3300006914 | Unclassified | 1979 |
| 144 | Ga0075436_100117141 | 3300006914 | Bacteria | 1862 |
| 145 | Ga0097620_100215981 | 3300006931 | Bacteria | 2005 |
| 146 | Ga0075435_100396140 | 3300007076 | Unclassified | 1187 |
| 147 | Ga0075435_100671236 | 3300007076 | Bacteria | 900 |
| 148 | Ga0099794_10116504 | 3300007265 | Bacteria | 1342 |
| 149 | Ga0099795_10038816 | 3300007788 | Bacteria | 1683 |
| 150 | Ga0099795_10160094 | 3300007788 | Unclassified | 928 |
| 151 | Ga0105240_10005609 | 3300009093 | Bacteria | 18632 |
| 152 | Ga0105240_10008420 | 3300009093 | Bacteria | 14757 |
| 153 | Ga0105240_10012468 | 3300009093 | Bacteria | 11727 |
| 154 | Ga0105240_10049138 | 3300009093 | Bacteria | 5327 |
| 155 | Ga0105240_10056796 | 3300009093 | Bacteria | 4896 |
| 156 | Ga0105240_10097985 | 3300009093 | Bacteria | 3572 |
| 157 | Ga0105240_10553235 | 3300009093 | Unclassified | 1273 |
| 158 | Ga0105240_10581317 | 3300009093 | Bacteria | 1236 |
| 159 | Ga0111539_10004636 | 3300009094 | Bacteria | 17955 |
| 160 | Ga0105245_10060927 | 3300009098 | Bacteria | 3400 |
| 161 | Ga0114129_10141105 | 3300009147 | Bacteria | 3303 |
| 162 | Ga0105243_10041557 | 3300009148 | Unclassified | 3596 |
| 163 | Ga0105241_10002177 | 3300009174 | Bacteria | 14765 |
| 164 | Ga0105241_10012499 | 3300009174 | Bacteria | 6225 |
| 165 | Ga0105241_10026448 | 3300009174 | Bacteria | 4317 |
| 166 | Ga0105241_10141301 | 3300009174 | Unclassified | 1961 |
| 167 | Ga0105241_10163331 | 3300009174 | Bacteria | 1833 |
| 168 | Ga0105241_11333352 | 3300009174 | Bacteria | 685 |
| 169 | Ga0105241_11430642 | 3300009174 | Bacteria | 663 |
| 170 | Ga0105242_10309286 | 3300009176 | Bacteria | 1445 |
| 171 | Ga0105248_10036210 | 3300009177 | Bacteria | 5519 |
| 172 | Ga0105248_10084174 | 3300009177 | Bacteria | 3578 |
| 173 | Ga0105248_11447876 | 3300009177 | Unclassified | 777 |
| 174 | Ga0105237_10005052 | 3300009545 | Bacteria | 15009 |
| 175 | Ga0105237_10039685 | 3300009545 | Bacteria | 4752 |
| 176 | Ga0105237_10607589 | 3300009545 | Unclassified | 1101 |
| 177 | Ga0105238_10002314 | 3300009551 | Bacteria | 19163 |
| 178 | Ga0105238_10005322 | 3300009551 | Bacteria | 12715 |
| 179 | Ga0105238_10073878 | 3300009551 | Bacteria | 3403 |
| 180 | Ga0105238_10088193 | 3300009551 | Bacteria | 3089 |
| 181 | Ga0105238_10275050 | 3300009551 | Unclassified | 1665 |
| 182 | Ga0105238_10401560 | 3300009551 | Bacteria | 1364 |
| 183 | Ga0105238_10902892 | 3300009551 | Unclassified | 902 |
| 184 | Ga0105238_11724076 | 3300009551 | Unclassified | 658 |
| 185 | Ga0105239_10070267 | 3300010375 | Unclassified | 3846 |
| 186 | Ga0105239_10214303 | 3300010375 | Unclassified | 2159 |
| 187 | Ga0105239_10351620 | 3300010375 | Bacteria | 1664 |
| 188 | Ga0105239_10536897 | 3300010375 | Bacteria | 1331 |
| 189 | Ga0105239_12031306 | 3300010375 | Unclassified | 668 |
| 190 | Ga0105246_10131601 | 3300011119 | Unclassified | 1869 |
| 191 | Ga0105246_10751747 | 3300011119 | Unclassified | 860 |
| 192 | Ga0105246_11435860 | 3300011119 | Unclassified | 645 |
| 193 | Ga0157373_10141774 | 3300013100 | Bacteria | 1690 |
| 194 | Ga0157373_10165181 | 3300013100 | Bacteria | 1558 |
| 195 | Ga0157371_10177506 | 3300013102 | Bacteria | 1523 |
| 196 | Ga0157370_10651838 | 3300013104 | Unclassified | 962 |
| 197 | Ga0157369_10010048 | 3300013105 | Bacteria | 10808 |
| 198 | Ga0157369_10020268 | 3300013105 | Bacteria | 7433 |
| 199 | Ga0157369_10086408 | 3300013105 | Bacteria | 3350 |
| 200 | Ga0157369_10261696 | 3300013105 | Unclassified | 1804 |
| 201 | Ga0157369_10600323 | 3300013105 | Bacteria | 1136 |
| 202 | Ga0157369_11063703 | 3300013105 | Unclassified | 828 |
| 203 | Ga0157374_10137119 | 3300013296 | Viruses | 2373 |
| 204 | Ga0157374_10433384 | 3300013296 | Bacteria | 1314 |
| 205 | Ga0157374_10989266 | 3300013296 | Unclassified | 860 |
| 206 | Ga0157378_10061341 | 3300013297 | Bacteria | 3355 |
| 207 | Ga0157378_10159129 | 3300013297 | Bacteria | 2111 |
| 208 | Ga0163162_10947275 | 3300013306 | Unclassified | 972 |
| 209 | Ga0157372_10006091 | 3300013307 | Bacteria | 12812 |
| 210 | Ga0157372_10006283 | 3300013307 | Bacteria | 12636 |
| 211 | Ga0157372_10010207 | 3300013307 | Bacteria | 9972 |
| 212 | Ga0157372_10065204 | 3300013307 | Bacteria | 4089 |
| 213 | Ga0157372_10741487 | 3300013307 | Unclassified | 1142 |
| 214 | Ga0157372_10914315 | 3300013307 | Unclassified | 1018 |
| 215 | Ga0157372_10975130 | 3300013307 | Unclassified | 982 |
| 216 | Ga0157375_10169127 | 3300013308 | Bacteria | 2332 |
| 217 | Ga0163163_10285932 | 3300014325 | Unclassified | 1701 |
| 218 | Ga0157380_10149186 | 3300014326 | Unclassified | 2019 |
| 219 | Ga0157379_10160465 | 3300014968 | Bacteria | 2029 |
| 220 | Ga0157376_10136799 | 3300014969 | Bacteria | 2193 |
| 221 | Ga0157376_10152685 | 3300014969 | Unclassified | 2084 |
| 222 | Ga0157376_10361239 | 3300014969 | Bacteria | 1393 |
| 223 | Ga0157376_11260403 | 3300014969 | Unclassified | 769 |
| 224 | Ga0163161_10016089 | 3300017792 | Bacteria | 5221 |
| 225 | Ga0224712_10075945 | 3300022467 | Bacteria | 1375 |
| 226 | Ga0228600_1004342 | 3300024123 | Unclassified | 1033 |
| 227 | Ga0224572_1035591 | 3300024225 | Unclassified | 944 |
| 228 | Ga0207656_10036122 | 3300025321 | Bacteria | 2073 |
| 229 | Ga0207656_10071848 | 3300025321 | Bacteria | 1539 |
| 230 | Ga0207656_10178191 | 3300025321 | Unclassified | 1019 |
| 231 | Ga0207692_10399378 | 3300025898 | Unclassified | 857 |
| 232 | Ga0207680_10155079 | 3300025903 | Unclassified | 1530 |
| 233 | Ga0207685_10159137 | 3300025905 | Unclassified | 1029 |
| 234 | Ga0207685_10409052 | 3300025905 | Unclassified | 697 |
| 235 | Ga0207699_10021419 | 3300025906 | Bacteria | 3484 |
| 236 | Ga0207699_10145715 | 3300025906 | Bacteria | 1561 |
| 237 | Ga0207699_10438524 | 3300025906 | Unclassified | 935 |
| 238 | Ga0207645_10057587 | 3300025907 | Bacteria | 2481 |
| 239 | Ga0207705_11002375 | 3300025909 | Unclassified | 645 |
| 240 | Ga0207684_10006638 | 3300025910 | Bacteria | 10516 |
| 241 | Ga0207654_10000639 | 3300025911 | Bacteria | 19764 |
| 242 | Ga0207654_10094488 | 3300025911 | Bacteria | 1830 |
| 243 | Ga0207654_10131843 | 3300025911 | Bacteria | 1583 |
| 244 | Ga0207707_10038366 | 3300025912 | Bacteria | 4186 |
| 245 | Ga0207707_10187647 | 3300025912 | Unclassified | 1804 |
| 246 | Ga0207707_10465576 | 3300025912 | Unclassified | 1081 |
| 247 | Ga0207695_10007206 | 3300025913 | Bacteria | 14220 |
| 248 | Ga0207695_10048020 | 3300025913 | Bacteria | 4511 |
| 249 | Ga0207695_10057772 | 3300025913 | Unclassified | 4030 |
| 250 | Ga0207695_10109749 | 3300025913 | Bacteria | 2740 |
| 251 | Ga0207695_10214636 | 3300025913 | Bacteria | 1834 |
| 252 | Ga0207695_10383923 | 3300025913 | Bacteria | 1290 |
| 253 | Ga0207695_10543717 | 3300025913 | Bacteria | 1043 |
| 254 | Ga0207695_11247543 | 3300025913 | Unclassified | 624 |
| 255 | Ga0207671_10000388 | 3300025914 | Bacteria | 61765 |
| 256 | Ga0207671_10282252 | 3300025914 | Bacteria | 1310 |
| 257 | Ga0207671_10284445 | 3300025914 | Bacteria | 1305 |
| 258 | Ga0207693_10003880 | 3300025915 | Bacteria | 12731 |
| 259 | Ga0207693_10006076 | 3300025915 | Bacteria | 10001 |
| 260 | Ga0207693_10009934 | 3300025915 | Bacteria | 7737 |
| 261 | Ga0207693_10052056 | 3300025915 | Bacteria | 3211 |
| 262 | Ga0207663_10003536 | 3300025916 | Bacteria | 7666 |
| 263 | Ga0207663_10131321 | 3300025916 | Unclassified | 1731 |
| 264 | Ga0207663_10238334 | 3300025916 | Bacteria | 1333 |
| 265 | Ga0207663_10897956 | 3300025916 | Unclassified | 708 |
| 266 | Ga0207663_10938915 | 3300025916 | Unclassified | 693 |
| 267 | Ga0207660_10124793 | 3300025917 | Bacteria | 1954 |
| 268 | Ga0207649_10028600 | 3300025920 | Bacteria | 3283 |
| 269 | Ga0207649_10089907 | 3300025920 | Bacteria | 2008 |
| 270 | Ga0207652_10766569 | 3300025921 | Unclassified | 858 |
| 271 | Ga0207646_10208000 | 3300025922 | Unclassified | 1767 |
| 272 | Ga0207681_10436098 | 3300025923 | Unclassified | 1064 |
| 273 | Ga0207694_10001625 | 3300025924 | Bacteria | 18894 |
| 274 | Ga0207694_10182728 | 3300025924 | Unclassified | 1701 |
| 275 | Ga0207694_10491408 | 3300025924 | Bacteria | 1027 |
| 276 | Ga0207659_10239698 | 3300025926 | Bacteria | 1466 |
| 277 | Ga0207687_10002392 | 3300025927 | Bacteria | 12713 |
| 278 | Ga0207687_10112716 | 3300025927 | Bacteria | 2022 |
| 279 | Ga0207700_10034377 | 3300025928 | Bacteria | 3638 |
| 280 | Ga0207700_10071551 | 3300025928 | Bacteria | 2671 |
| 281 | Ga0207700_10125864 | 3300025928 | Bacteria | 2085 |
| 282 | Ga0207700_10226142 | 3300025928 | Bacteria | 1589 |
| 283 | Ga0207700_10251409 | 3300025928 | Bacteria | 1510 |
| 284 | Ga0207700_10699827 | 3300025928 | Unclassified | 905 |
| 285 | Ga0207700_10855217 | 3300025928 | Unclassified | 814 |
| 286 | Ga0207700_11495325 | 3300025928 | Unclassified | 599 |
| 287 | Ga0207664_10145404 | 3300025929 | Unclassified | 2010 |
| 288 | Ga0207664_10445033 | 3300025929 | Unclassified | 1156 |
| 289 | Ga0207664_10484779 | 3300025929 | Unclassified | 1106 |
| 290 | Ga0207664_10549385 | 3300025929 | Bacteria | 1036 |
| 291 | Ga0207644_10752244 | 3300025931 | Unclassified | 814 |
| 292 | Ga0207706_10004319 | 3300025933 | Bacteria | 13353 |
| 293 | Ga0207686_10269700 | 3300025934 | Unclassified | 1251 |
| 294 | Ga0207709_10011049 | 3300025935 | Bacteria | 4979 |
| 295 | Ga0207665_10000103 | 3300025939 | Bacteria | 55197 |
| 296 | Ga0207665_10011247 | 3300025939 | Bacteria | 5872 |
| 297 | Ga0207665_10046269 | 3300025939 | Bacteria | 2916 |
| 298 | Ga0207665_10069614 | 3300025939 | Bacteria | 2400 |
| 299 | Ga0207665_10070254 | 3300025939 | Bacteria | 2389 |
| 300 | Ga0207691_10006018 | 3300025940 | Bacteria | 11714 |
| 301 | Ga0207711_10198601 | 3300025941 | Bacteria | 1830 |
| 302 | Ga0207661_10010401 | 3300025944 | Bacteria | 6697 |
| 303 | Ga0207661_10088795 | 3300025944 | Unclassified | 2570 |
| 304 | Ga0207679_10133735 | 3300025945 | Bacteria | 1994 |
| 305 | Ga0207679_11002035 | 3300025945 | Bacteria | 766 |
| 306 | Ga0207667_10010737 | 3300025949 | Bacteria | 10682 |
| 307 | Ga0207667_10017875 | 3300025949 | Bacteria | 7970 |
| 308 | Ga0207667_10027010 | 3300025949 | Bacteria | 6261 |
| 309 | Ga0207667_10511984 | 3300025949 | Unclassified | 1216 |
| 310 | Ga0207668_10749160 | 3300025972 | Unclassified | 862 |
| 311 | Ga0207640_10013029 | 3300025981 | Bacteria | 4755 |
| 312 | Ga0207640_10319535 | 3300025981 | Bacteria | 1235 |
| 313 | Ga0207640_10325067 | 3300025981 | Unclassified | 1226 |
| 314 | Ga0207640_10392087 | 3300025981 | Unclassified | 1128 |
| 315 | Ga0207677_10060843 | 3300026023 | Viruses | 2612 |
| 316 | Ga0207677_10127895 | 3300026023 | Bacteria | 1923 |
| 317 | Ga0207639_10000064 | 3300026041 | Bacteria | 99860 |
| 318 | Ga0207639_10044826 | 3300026041 | Bacteria | 3328 |
| 319 | Ga0207639_10223648 | 3300026041 | Bacteria | 1627 |
| 320 | Ga0207678_10359351 | 3300026067 | Bacteria | 1257 |
| 321 | Ga0207708_11047197 | 3300026075 | Unclassified | 710 |
| 322 | Ga0207702_10015298 | 3300026078 | Bacteria | 6360 |
| 323 | Ga0207702_10022455 | 3300026078 | Bacteria | 5231 |
| 324 | Ga0207702_11122711 | 3300026078 | Unclassified | 780 |
| 325 | Ga0207641_10139122 | 3300026088 | Bacteria | 2188 |
| 326 | Ga0207641_11095776 | 3300026088 | Unclassified | 795 |
| 327 | Ga0207676_11071442 | 3300026095 | Unclassified | 796 |
| 328 | Ga0207674_10096411 | 3300026116 | Bacteria | 2943 |
| 329 | Ga0207674_10657725 | 3300026116 | Unclassified | 1012 |
| 330 | Ga0207675_100518785 | 3300026118 | Unclassified | 1188 |
| 331 | Ga0207683_10000490 | 3300026121 | Bacteria | 36567 |
| 332 | Ga0207698_10001305 | 3300026142 | Bacteria | 14519 |
| 333 | Ga0207698_10052450 | 3300026142 | Bacteria | 3125 |
| 334 | Ga0207698_10148396 | 3300026142 | Unclassified | 2031 |
| 335 | Ga0207698_10672602 | 3300026142 | Bacteria | 1028 |
| 336 | Ga0207698_10699137 | 3300026142 | Unclassified | 1009 |
| 337 | Ga0207698_11484255 | 3300026142 | Unclassified | 693 |
| 338 | Ga0209588_1036683 | 3300027671 | Bacteria | 1578 |
| 339 | Ga0207428_10055006 | 3300027907 | Unclassified | 3166 |
| 340 | Ga0268266_10240062 | 3300028379 | Bacteria | 1672 |
| 341 | Ga0265323_10000163 | 3300028653 | Bacteria | 39972 |
| 342 | Ga0265338_10139557 | 3300028800 | Bacteria | 1901 |
| 343 | Ga0265338_10420583 | 3300028800 | Bacteria | 950 |
| 344 | Ga0265762_1000240 | 3300030760 | Bacteria | 8904 |
| 345 | Ga0265760_10057661 | 3300031090 | Bacteria | 1176 |
| 346 | Ga0265760_10084172 | 3300031090 | Unclassified | 988 |
| 347 | Ga0265330_10028575 | 3300031235 | Bacteria | 2512 |
| 348 | Ga0265330_10061969 | 3300031235 | Bacteria | 1627 |
| 349 | Ga0265330_10067307 | 3300031235 | Bacteria | 1552 |
| 350 | Ga0265330_10246900 | 3300031235 | Bacteria | 752 |
| 351 | Ga0265332_10129780 | 3300031238 | Unclassified | 1057 |
| 352 | Ga0265328_10247657 | 3300031239 | Unclassified | 682 |
| 353 | Ga0265325_10145736 | 3300031241 | Bacteria | 1123 |
| 354 | Ga0265325_10239529 | 3300031241 | Unclassified | 825 |
| 355 | Ga0265339_10012622 | 3300031249 | Bacteria | 5148 |
| 356 | Ga0265339_10112939 | 3300031249 | Unclassified | 1404 |
| 357 | Ga0265331_10135982 | 3300031250 | Unclassified | 1119 |
| 358 | Ga0265331_10332670 | 3300031250 | Unclassified | 680 |
| 359 | Ga0265316_10006547 | 3300031344 | Bacteria | 11110 |
| 360 | Ga0265316_10504591 | 3300031344 | Bacteria | 864 |
| 361 | Ga0265314_10027735 | 3300031711 | Unclassified | 4237 |
| 362 | Ga0265342_10040785 | 3300031712 | Bacteria | 2814 |
| 363 | Ga0265342_10062056 | 3300031712 | Unclassified | 2201 |
| 364 | Ga0265342_10106382 | 3300031712 | Bacteria | 1592 |
| 365 | Ga0316215_1018454 | 3300033544 | Unclassified | 705 |
| 366 | Ga0373926_0000846 | 3300035083 | Bacteria | 8715 |
| 367 | Ga0373926_0003233 | 3300035083 | Bacteria | 5234 |
| 368 | Ga0373934_0001080 | 3300035086 | Bacteria | 9872 |
| 369 | Ga0373944_0014214 | 3300035089 | Bacteria | 2220 |
| 370 | Ga0373944_0036748 | 3300035089 | Bacteria | 1497 |
| 371 | Ga0373923_0011965 | 3300035111 | Bacteria | 3196 |
| 372 | Ga0373923_0020519 | 3300035111 | Unclassified | 2568 |
| 373 | Ga0373923_0057652 | 3300035111 | Unclassified | 1643 |
| 374 | Ga0373936_0003804 | 3300035113 | Bacteria | 5685 |
| 375 | Ga0373936_0020060 | 3300035113 | Unclassified | 2594 |
| 376 | Ga0373945_0037425 | 3300035116 | Bacteria | 1741 |
| 377 | Ga0373954_0108888 | 3300035118 | Bacteria | 1339 |
| 378 | Ga0373954_0323450 | 3300035118 | Unclassified | 761 |
| 379 | Ga0373956_0007699 | 3300035119 | Bacteria | 4342 |
| 380 | Ga0373956_0088026 | 3300035119 | Bacteria | 1430 |
| 381 | Ga0373956_0334637 | 3300035119 | Unclassified | 721 |
| 382 | Ga0373957_0003808 | 3300035120 | Unclassified | 4521 |
| 383 | Ga0373957_0101802 | 3300035120 | Unclassified | 1151 |
| 384 | Ga0373943_0002365 | 3300035170 | Bacteria | 8555 |
| 385 | Ga0373943_0280518 | 3300035170 | Bacteria | 942 |
| 386 | Ga0373946_0003548 | 3300035171 | Bacteria | 5538 |
| 387 | Ga0373946_0015880 | 3300035171 | Unclassified | 2862 |
| 388 | Ga0373946_0037436 | 3300035171 | Bacteria | 1971 |
| 389 | Ga0373946_0446778 | 3300035171 | Unclassified | 658 |
| 390 | Ga0373955_0000379 | 3300035172 | Bacteria | 18767 |
| 391 | Ga0373955_0611565 | 3300035172 | Unclassified | 668 |
| 392 | Ga0373955_0670463 | 3300035172 | Unclassified | 636 |
| 393 | Ga0373924_0000669 | 3300035410 | Bacteria | 10668 |
| 394 | Ga0373924_0000695 | 3300035410 | Bacteria | 10470 |
| 395 | Ga0373924_0017614 | 3300035410 | Bacteria | 2743 |
| 396 | Ga0373924_0061865 | 3300035410 | Bacteria | 1567 |
| 397 | Ga0373931_0121968 | 3300035691 | Bacteria | 1491 |
| 398 | Ga0373935_0005912 | 3300035692 | Bacteria | 7251 |
| 399 | Ga0373935_0012581 | 3300035692 | Bacteria | 5092 |
| 400 | Ga0373935_0161628 | 3300035692 | Bacteria | 1527 |
| 401 | Ga0373927_0000220 | 3300035695 | Bacteria | 45246 |
| 402 | Ga0373927_0129886 | 3300035695 | Bacteria | 1645 |
| 403 | Ga0373933_0000317 | 3300035724 | Bacteria | 31226 |
| 404 | Ga0373933_0034218 | 3300035724 | Bacteria | 2960 |
| 405 | Ga0373933_0956143 | 3300035724 | Unclassified | 564 |
| 406 | Ga0373947_0003779 | 3300035725 | Bacteria | 8927 |
| 407 | Ga0373947_0003925 | 3300035725 | Bacteria | 8746 |
| 408 | Ga0373947_0364060 | 3300035725 | Unclassified | 971 |
| 409 | Ga0373937_0000711 | 3300036401 | Bacteria | 29037 |
| 410 | Ga0373937_0008085 | 3300036401 | Bacteria | 9130 |
| 411 | Ga0373937_0015905 | 3300036401 | Bacteria | 6673 |
| 412 | Ga0373937_0107274 | 3300036401 | Bacteria | 2597 |
| 413 | Ga0373937_0195248 | 3300036401 | Bacteria | 1902 |
| 414 | Ga0373937_0541190 | 3300036401 | Unclassified | 1106 |
| 415 | Ga0373937_1150255 | 3300036401 | Bacteria | 725 |
| 416 | Ga0373925_0004535 | 3300037068 | Bacteria | 10495 |
| 417 | Ga0373925_0010701 | 3300037068 | Bacteria | 6652 |
| 418 | Ga0373925_0058449 | 3300037068 | Unclassified | 2891 |
| 419 | Ga0395898_0910824 | 3300037466 | Unclassified | 817 |
| 420 | Ga0395905_0116963 | 3300037471 | Bacteria | 2505 |
| 421 | Ga0395905_0160196 | 3300037471 | Bacteria | 2115 |
| 422 | Ga0436363_0064800 | 3300039450 | Unclassified | 931 |
| 423 | Ga0451853_3857372 | 3300041512 | Bacteria | 539 |
| 424 | Ga0451577_0295231 | 3300042876 | Bacteria | 1469 |
| 425 | Ga0466969_0261696 | 3300044656 | Bacteria | 784 |
| 426 | Ga0466963_0535518 | 3300044694 | Unclassified | 827 |
| 427 | Ga0466957_0000039 | 3300044842 | Bacteria | 47226 |
| 428 | Ga0466957_0957362 | 3300044842 | Unclassified | 613 |
| 429 | Ga0466959_0090816 | 3300045049 | Bacteria | 2193 |
| 430 | Ga0451576_0089464 | 3300045051 | Bacteria | 3202 |
| 431 | Ga0451576_0142510 | 3300045051 | Unclassified | 2499 |
| 432 | Ga0466958_0515433 | 3300045836 | Bacteria | 776 |
| 433 | Ga0466967_0233321 | 3300045976 | Bacteria | 1753 |
| 434 | Ga0466967_0248492 | 3300045976 | Bacteria | 1699 |
| 435 | Ga0495592_0002329 | 3300046454 | Bacteria | 13417 |
| 436 | Ga0495603_0001244 | 3300046455 | Bacteria | 14878 |
| 437 | Ga0495629_0017241 | 3300046459 | Bacteria | 5180 |
| 438 | Ga0495629_0022912 | 3300046459 | Unclassified | 4451 |
| 439 | Ga0495629_0158309 | 3300046459 | Unclassified | 1573 |
| 440 | Ga0495629_0197129 | 3300046459 | Unclassified | 1393 |
| 441 | Ga0495629_0325840 | 3300046459 | Bacteria | 1050 |
| 442 | Ga0495641_0233757 | 3300046461 | Bacteria | 825 |
| 443 | Ga0495651_0001100 | 3300046462 | Bacteria | 20855 |
| 444 | Ga0495651_0405845 | 3300046462 | Bacteria | 889 |
| 445 | Ga0495653_0000346 | 3300046463 | Bacteria | 37819 |
| 446 | Ga0495580_0013848 | 3300046472 | Bacteria | 6141 |
| 447 | Ga0495580_0072373 | 3300046472 | Bacteria | 2407 |
| 448 | Ga0495580_0125434 | 3300046472 | Bacteria | 1782 |
| 449 | Ga0495580_0472083 | 3300046472 | Unclassified | 840 |
| 450 | Ga0495580_0508660 | 3300046472 | Unclassified | 803 |
| 451 | Ga0495582_0038193 | 3300046473 | Bacteria | 2642 |
| 452 | Ga0495582_0062528 | 3300046473 | Bacteria | 2056 |
| 453 | Ga0495582_0124576 | 3300046473 | Unclassified | 1453 |
| 454 | Ga0495639_0001645 | 3300046475 | Bacteria | 9949 |
| 455 | Ga0495639_0045551 | 3300046475 | Bacteria | 1984 |
| 456 | Ga0495664_0150888 | 3300046477 | Bacteria | 1409 |
| 457 | Ga0495594_0411424 | 3300046499 | Bacteria | 769 |
| 458 | Ga0495608_0000130 | 3300046511 | Bacteria | 53676 |
| 459 | Ga0495608_0123890 | 3300046511 | Bacteria | 1656 |
| 460 | Ga0495608_0137479 | 3300046511 | Bacteria | 1561 |
| 461 | Ga0495618_0159173 | 3300046514 | Bacteria | 1440 |
| 462 | Ga0495618_0303459 | 3300046514 | Bacteria | 992 |
| 463 | Ga0495628_0001724 | 3300046516 | Bacteria | 19899 |
| 464 | Ga0495630_0009665 | 3300046517 | Bacteria | 6936 |
| 465 | Ga0495630_0022743 | 3300046517 | Bacteria | 4630 |
| 466 | Ga0495630_0040716 | 3300046517 | Bacteria | 3472 |
| 467 | Ga0495630_0104640 | 3300046517 | Unclassified | 2142 |
| 468 | Ga0495663_0009900 | 3300046525 | Bacteria | 2647 |
| 469 | Ga0495666_0355977 | 3300046526 | Bacteria | 659 |
| 470 | Ga0495642_0031962 | 3300046528 | Bacteria | 2110 |
| 471 | Ga0495652_0000260 | 3300046529 | Bacteria | 62378 |
| 472 | Ga0495652_0713859 | 3300046529 | Unclassified | 674 |
| 473 | Ga0495665_0091478 | 3300046531 | Bacteria | 1598 |
| 474 | Ga0495665_0153704 | 3300046531 | Bacteria | 1200 |
| 475 | Ga0495665_0222672 | 3300046531 | Unclassified | 975 |
| 476 | Ga0495640_0140647 | 3300046533 | Unclassified | 1556 |
| 477 | Ga0495640_0494140 | 3300046533 | Unclassified | 745 |
| 478 | Ga0495586_0056253 | 3300046535 | Bacteria | 2133 |
| 479 | Ga0495587_0000132 | 3300046536 | Bacteria | 56457 |
| 480 | Ga0495587_0145918 | 3300046536 | Unclassified | 1349 |
| 481 | Ga0495645_0002791 | 3300046543 | Bacteria | 11849 |
| 482 | Ga0495645_0017616 | 3300046543 | Bacteria | 5119 |
| 483 | Ga0495645_0091174 | 3300046543 | Bacteria | 2177 |
| 484 | Ga0495645_0329641 | 3300046543 | Unclassified | 989 |
| 485 | Ga0495667_0000330 | 3300046559 | Bacteria | 29916 |
| 486 | Ga0495667_0116575 | 3300046559 | Unclassified | 1725 |
| 487 | Ga0495667_0486064 | 3300046559 | Unclassified | 774 |
| 488 | Ga0495635_0000050 | 3300046663 | Bacteria | 76087 |
| 489 | Ga0495635_0230090 | 3300046663 | Bacteria | 1252 |
| 490 | Ga0495635_0594289 | 3300046663 | Unclassified | 723 |
| 491 | Ga0495659_0076121 | 3300046664 | Bacteria | 1265 |
| 492 | Ga0495588_0005099 | 3300046674 | Bacteria | 5838 |
| 493 | Ga0495657_0000157 | 3300046675 | Bacteria | 61489 |
| 494 | Ga0495657_0062956 | 3300046675 | Bacteria | 2449 |
| 495 | Ga0495599_0001450 | 3300046678 | Bacteria | 13606 |
| 496 | Ga0495599_0239687 | 3300046678 | Unclassified | 1106 |
| 497 | Ga0495599_0773989 | 3300046678 | Unclassified | 549 |
| 498 | Ga0495623_0002250 | 3300046679 | Bacteria | 12842 |
| 499 | Ga0495623_0084977 | 3300046679 | Bacteria | 1952 |
| 500 | Ga0495646_0000225 | 3300046680 | Bacteria | 28086 |
| 501 | Ga0495646_0311419 | 3300046680 | Unclassified | 831 |
| 502 | Ga0495647_0101322 | 3300046681 | Bacteria | 1193 |
| 503 | Ga0495658_0007691 | 3300046683 | Bacteria | 5340 |
| 504 | Ga0495658_0198932 | 3300046683 | Bacteria | 1248 |
| 505 | Ga0495613_0003107 | 3300046689 | Bacteria | 12426 |
| 506 | Ga0495613_0009617 | 3300046689 | Bacteria | 7182 |
| 507 | Ga0495613_0026893 | 3300046689 | Bacteria | 4283 |
| 508 | Ga0495613_0074345 | 3300046689 | Bacteria | 2475 |
| 509 | Ga0495581_0005366 | 3300047315 | Bacteria | 7417 |
| 510 | Ga0495604_0000207 | 3300047317 | Bacteria | 53831 |
| 511 | Ga0495604_0705864 | 3300047317 | Unclassified | 640 |
| 512 | Ga0495674_0003516 | 3300047319 | Bacteria | 15259 |
| 513 | Ga0495674_0059549 | 3300047319 | Bacteria | 3335 |
| 514 | Ga0495676_0245510 | 3300047321 | Unclassified | 1224 |
| 515 | Ga0495675_0000353 | 3300047444 | Bacteria | 32273 |
| 516 | Ga0495675_0166770 | 3300047444 | Bacteria | 1354 |
| 517 | Ga0495685_069268 | 3300047447 | Bacteria | 1183 |
| 518 | Ga0495684_0000160 | 3300047471 | Bacteria | 50298 |
| 519 | Ga0495684_0029995 | 3300047471 | Bacteria | 4176 |
| 520 | Ga0495684_0155021 | 3300047471 | Bacteria | 1711 |
| 521 | Ga0495593_0001372 | 3300047673 | Bacteria | 14240 |
| 522 | Ga0495593_0088194 | 3300047673 | Bacteria | 1599 |
| 523 | Ga0495593_0386326 | 3300047673 | Unclassified | 700 |
| 524 | Ga0495602_0001852 | 3300048088 | Bacteria | 21171 |
| 525 | Ga0495602_0544237 | 3300048088 | Unclassified | 805 |
| 526 | Ga0495614_0002026 | 3300048089 | Bacteria | 8907 |
| 527 | Ga0495614_0095031 | 3300048089 | Bacteria | 1299 |
| 528 | Ga0496100_0029519 | 3300048903 | Bacteria | 3393 |
| 529 | Ga0496100_0446177 | 3300048903 | Unclassified | 991 |
| 530 | Ga0496101_0158719 | 3300048904 | Bacteria | 1734 |
| 531 | Ga0496102_0019733 | 3300048905 | Bacteria | 5942 |
| 532 | Ga0496102_1854855 | 3300048905 | Unclassified | 520 |
| 533 | Ga0496103_0499433 | 3300048906 | Unclassified | 778 |
| 534 | Ga0496104_0011136 | 3300048907 | Bacteria | 8047 |
| 535 | Ga0496104_0020528 | 3300048907 | Bacteria | 6057 |
| 536 | Ga0496104_0080276 | 3300048907 | Bacteria | 3110 |
| 537 | Ga0496104_1293363 | 3300048907 | Unclassified | 632 |
| 538 | Ga0496105_0001167 | 3300048908 | Bacteria | 18283 |
| 539 | Ga0496105_0044122 | 3300048908 | Bacteria | 3676 |
| 540 | Ga0496105_0243319 | 3300048908 | Bacteria | 1459 |
| 541 | Ga0496105_0260378 | 3300048908 | Bacteria | 1403 |
| 542 | Ga0496106_0068670 | 3300048909 | Unclassified | 2704 |
| 543 | Ga0496106_0174140 | 3300048909 | Unclassified | 1707 |
| 544 | Ga0496110_0394022 | 3300048913 | Bacteria | 1262 |
| 545 | Ga0496110_0499063 | 3300048913 | Unclassified | 1108 |
| 546 | Ga0496110_0574542 | 3300048913 | Unclassified | 1024 |
| 547 | Ga0496110_1435503 | 3300048913 | Unclassified | 600 |
| 548 | Ga0496111_0708950 | 3300048914 | Unclassified | 732 |
| 549 | Ga0496112_0096782 | 3300048915 | Bacteria | 2922 |
| 550 | Ga0496112_0107096 | 3300048915 | Bacteria | 2765 |
| 551 | Ga0496113_0000557 | 3300048916 | Bacteria | 18513 |
| 552 | Ga0496114_0055326 | 3300048917 | Unclassified | 3309 |
| 553 | Ga0496114_0396847 | 3300048917 | Bacteria | 1222 |
| 554 | Ga0496115_0062821 | 3300048918 | Unclassified | 2996 |
| 555 | Ga0496115_0488901 | 3300048918 | Unclassified | 990 |
| 556 | Ga0496115_0613899 | 3300048918 | Eukaryota | 863 |
| 557 | Ga0496115_0741963 | 3300048918 | Unclassified | 768 |
| 558 | Ga0501073_0127063 | 3300049589 | Unclassified | 1767 |
| 559 | Ga0501079_0561633 | 3300049741 | Unclassified | 898 |
| 560 | Ga0501044_1511772 | 3300049823 | Bacteria | 536 |
| 561 | nmdc:mga05p37_461085_c1 | 3300050507 | Bacteria | 1468 |
| 562 | nmdc:mga08y16_1895_c1 | 3300050511 | Bacteria | 21305 |
| 563 | nmdc:mga0rr50_275934_c1 | 3300050513 | Unclassified | 1402 |
| 564 | nmdc:mga08x19_1223_c1 | 3300050514 | Bacteria | 15980 |
| 565 | nmdc:mga08x19_133429_c1 | 3300050514 | Bacteria | 1672 |
| 566 | nmdc:mga08x19_792243_c1 | 3300050514 | Unclassified | 673 |
| 567 | Ga0495601_0060155 | 3300053077 | Bacteria | 2410 |
| 568 | Ga0495612_0004132 | 3300053078 | Bacteria | 6012 |
| 569 | Ga0495595_0199721 | 3300053084 | Unclassified | 995 |
| 570 | Ga0495619_0000932 | 3300053085 | Bacteria | 19215 |
| 571 | Ga0501084_0666117 | 3300054114 | Unclassified | 878 |
| 572 | Ga0105245_10004897 | |||
| 573 | SwRhRL3b_contig_2779551 | |||
| 574 | SwRhRL3b_contig_4178110 | |||
| 575 | JGI25406J46586_10083987 | |||
| 576 | rootH1_10252652 | |||
| 577 | Ga0058863_10013587 | |||
| 578 | Ga0065704_10112719 | |||
| 579 | Ga0065712_10383174 | |||
| 580 | Ga0065707_10012500 | |||
| 581 | Ga0070658_10326582 | |||
| 582 | Ga0070676_10042342 | |||
| 583 | Ga0070683_100015514 | |||
| 584 | Ga0070683_100068498 | |||
| 585 | Ga0070683_100075403 | |||
| 586 | Ga0070683_100634850 | |||
| 587 | Ga0070670_100162920 | |||
| 588 | Ga0068869_100275106 | |||
| 589 | Ga0068869_100381234 | |||
| 590 | Ga0070666_10985885 | |||
| 591 | Ga0070680_100593510 | |||
| 592 | Ga0070682_100044294 | |||
| 593 | Ga0070682_100252719 | |||
| 594 | Ga0068868_100018233 | |||
| 595 | Ga0070691_10020822 | |||
| 596 | Ga0070661_100008470 | |||
| 597 | Ga0070661_100073097 | |||
| 598 | Ga0070661_100639310 | |||
| 599 | Ga0070668_100283482 | |||
| 600 | Ga0070675_100111661 | |||
| 601 | Ga0070673_100008961 | |||
| 602 | Ga0070709_10201518 | |||
| 603 | Ga0070709_11129612 | |||
| 604 | Ga0070714_100007726 | |||
| 605 | Ga0070714_100052990 | |||
| 606 | Ga0070714_100105576 | |||
| 607 | Ga0070714_100267407 | |||
| 608 | Ga0070713_100066976 | |||
| 609 | Ga0070713_100108646 | |||
| 610 | Ga0070713_100187238 | |||
| 611 | Ga0070713_100392408 | |||
| 612 | Ga0070713_100458190 | |||
| 613 | Ga0070713_100605168 | |||
| 614 | Ga0070713_100765451 | |||
| 615 | Ga0070713_100802595 | |||
| 616 | Ga0070710_10118591 | |||
| 617 | Ga0070710_10325566 | |||
| 618 | Ga0070710_10473375 | |||
| 619 | Ga0070710_10829245 | |||
| 620 | Ga0070711_100005541 | |||
| 621 | Ga0070711_100227540 | |||
| 622 | Ga0070711_100347595 | |||
| 623 | Ga0070711_101499484 | |||
| 624 | Ga0070711_101832205 | |||
| 625 | Ga0070705_100000686 | |||
| 626 | Ga0070700_101296392 | |||
| 627 | Ga0070694_100000317 | |||
| 628 | Ga0070708_100000002 | |||
| 629 | Ga0070663_100593534 | |||
| 630 | Ga0070678_100214333 | |||
| 631 | Ga0070681_10232553 | |||
| 632 | Ga0070681_10495743 | |||
| 633 | Ga0070681_10619385 | |||
| 634 | Ga0070706_100008336 | |||
| 635 | Ga0070706_100771771 | |||
| 636 | Ga0070707_100408915 | |||
| 637 | Ga0070698_100006598 | |||
| 638 | Ga0070698_100039870 | |||
| 639 | Ga0070699_100000483 | |||
| 640 | Ga0070699_101071784 | |||
| 641 | Ga0070679_100858085 | |||
| 642 | Ga0070684_100002219 | |||
| 643 | Ga0070684_100051120 | |||
| 644 | Ga0070684_100173565 | |||
| 645 | Ga0070684_100271665 | |||
| 646 | Ga0070684_100707427 | |||
| 647 | Ga0070697_100100307 | |||
| 648 | Ga0070697_101457022 | |||
| 649 | Ga0068853_100024797 | |||
| 650 | Ga0068853_100119048 | |||
| 651 | Ga0068853_100161813 | |||
| 652 | Ga0070672_100013140 | |||
| 653 | Ga0070695_100000115 | |||
| 654 | Ga0070696_100000303 | |||
| 655 | Ga0070696_101385896 | |||
| 656 | Ga0070693_100024674 | |||
| 657 | Ga0070693_100214091 | |||
| 658 | Ga0070693_100477723 | |||
| 659 | Ga0068855_100002549 | |||
| 660 | Ga0068855_100025864 | |||
| 661 | Ga0068855_100033538 | |||
| 662 | Ga0068855_100186640 | |||
| 663 | Ga0068855_100398105 | |||
| 664 | Ga0070664_100251654 | |||
| 665 | Ga0070664_100815986 | |||
| 666 | Ga0070664_100912571 | |||
| 667 | Ga0068857_100080026 | |||
| 668 | Ga0068857_100159055 | |||
| 669 | Ga0068854_100027270 | |||
| 670 | Ga0068854_100114794 | |||
| 671 | Ga0068854_101908380 | |||
| 672 | Ga0068856_100006613 | |||
| 673 | Ga0068856_100009318 | |||
| 674 | Ga0068856_100025597 | |||
| 675 | Ga0068856_100078534 | |||
| 676 | Ga0068856_100144230 | |||
| 677 | Ga0068852_100001843 | |||
| 678 | Ga0068852_100020336 | |||
| 679 | Ga0068852_100603974 | |||
| 680 | Ga0068852_101422290 | |||
| 681 | Ga0068864_100438033 | |||
| 682 | Ga0068861_100388891 | |||
| 683 | Ga0068851_10000736 | |||
| 684 | Ga0068851_10012540 | |||
| 685 | Ga0068851_10190635 | |||
| 686 | Ga0068863_100072097 | |||
| 687 | Ga0068863_100954421 | |||
| 688 | Ga0068858_100189495 | |||
| 689 | Ga0068858_100405602 | |||
| 690 | Ga0081539_10066233 | |||
| 691 | Ga0070717_10075091 | |||
| 692 | Ga0070717_10136240 | |||
| 693 | Ga0070717_10208702 | |||
| 694 | Ga0070717_10220828 | |||
| 695 | Ga0070717_10268129 | |||
| 696 | Ga0070715_10023807 | |||
| 697 | Ga0070715_10222153 | |||
| 698 | Ga0070715_10314846 | |||
| 699 | Ga0070716_100041752 | |||
| 700 | Ga0070716_100078516 | |||
| 701 | Ga0070716_100547631 | |||
| 702 | Ga0070712_100012073 | |||
| 703 | Ga0070712_100025539 | |||
| 704 | Ga0070712_100244153 | |||
| 705 | Ga0070712_100361955 | |||
| 706 | Ga0070712_100451029 | |||
| 707 | Ga0070712_100833417 | |||
| 708 | Ga0097621_100008852 | |||
| 709 | Ga0097621_100522197 | |||
| 710 | Ga0097621_101031654 | |||
| 711 | Ga0075428_100000525 | |||
| 712 | Ga0068865_100053870 | |||
| 713 | Ga0075436_100059842 | |||
| 714 | Ga0075436_100104009 | |||
| 715 | Ga0075436_100117141 | |||
| 716 | Ga0097620_100215981 | |||
| 717 | Ga0075435_100396140 | |||
| 718 | Ga0075435_100671236 | |||
| 719 | Ga0099794_10116504 | |||
| 720 | Ga0099795_10038816 | |||
| 721 | Ga0099795_10160094 | |||
| 722 | Ga0105240_10005609 | |||
| 723 | Ga0105240_10008420 | |||
| 724 | Ga0105240_10012468 | |||
| 725 | Ga0105240_10049138 | |||
| 726 | Ga0105240_10056796 | |||
| 727 | Ga0105240_10097985 | |||
| 728 | Ga0105240_10553235 | |||
| 729 | Ga0105240_10581317 | |||
| 730 | Ga0111539_10004636 | |||
| 731 | Ga0105245_10060927 | |||
| 732 | Ga0114129_10141105 | |||
| 733 | Ga0105243_10041557 | |||
| 734 | Ga0105241_10002177 | |||
| 735 | Ga0105241_10012499 | |||
| 736 | Ga0105241_10026448 | |||
| 737 | Ga0105241_10141301 | |||
| 738 | Ga0105241_10163331 | |||
| 739 | Ga0105241_11333352 | |||
| 740 | Ga0105241_11430642 | |||
| 741 | Ga0105242_10309286 | |||
| 742 | Ga0105248_10036210 | |||
| 743 | Ga0105248_10084174 | |||
| 744 | Ga0105248_11447876 | |||
| 745 | Ga0105237_10005052 | |||
| 746 | Ga0105237_10039685 | |||
| 747 | Ga0105237_10607589 | |||
| 748 | Ga0105238_10002314 | |||
| 749 | Ga0105238_10005322 | |||
| 750 | Ga0105238_10073878 | |||
| 751 | Ga0105238_10088193 | |||
| 752 | Ga0105238_10275050 | |||
| 753 | Ga0105238_10401560 | |||
| 754 | Ga0105238_10902892 | |||
| 755 | Ga0105238_11724076 | |||
| 756 | Ga0105239_10070267 | |||
| 757 | Ga0105239_10214303 | |||
| 758 | Ga0105239_10351620 | |||
| 759 | Ga0105239_10536897 | |||
| 760 | Ga0105239_12031306 | |||
| 761 | Ga0105246_10131601 | |||
| 762 | Ga0105246_10751747 | |||
| 763 | Ga0105246_11435860 | |||
| 764 | Ga0157373_10141774 | |||
| 765 | Ga0157373_10165181 | |||
| 766 | Ga0157371_10177506 | |||
| 767 | Ga0157370_10651838 | |||
| 768 | Ga0157369_10010048 | |||
| 769 | Ga0157369_10020268 | |||
| 770 | Ga0157369_10086408 | |||
| 771 | Ga0157369_10261696 | |||
| 772 | Ga0157369_10600323 | |||
| 773 | Ga0157369_11063703 | |||
| 774 | Ga0157374_10137119 | |||
| 775 | Ga0157374_10433384 | |||
| 776 | Ga0157374_10989266 | |||
| 777 | Ga0157378_10061341 | |||
| 778 | Ga0157378_10159129 | |||
| 779 | Ga0163162_10947275 | |||
| 780 | Ga0157372_10006091 | |||
| 781 | Ga0157372_10006283 | |||
| 782 | Ga0157372_10010207 | |||
| 783 | Ga0157372_10065204 | |||
| 784 | Ga0157372_10741487 | |||
| 785 | Ga0157372_10914315 | |||
| 786 | Ga0157372_10975130 | |||
| 787 | Ga0157375_10169127 | |||
| 788 | Ga0163163_10285932 | |||
| 789 | Ga0157380_10149186 | |||
| 790 | Ga0157379_10160465 | |||
| 791 | Ga0157376_10136799 | |||
| 792 | Ga0157376_10152685 | |||
| 793 | Ga0157376_10361239 | |||
| 794 | Ga0157376_11260403 | |||
| 795 | Ga0163161_10016089 | |||
| 796 | Ga0224712_10075945 | |||
| 797 | Ga0228600_1004342 | |||
| 798 | Ga0224572_1035591 | |||
| 799 | Ga0207656_10036122 | |||
| 800 | Ga0207656_10071848 | |||
| 801 | Ga0207656_10178191 | |||
| 802 | Ga0207692_10399378 | |||
| 803 | Ga0207680_10155079 | |||
| 804 | Ga0207685_10159137 | |||
| 805 | Ga0207685_10409052 | |||
| 806 | Ga0207699_10021419 | |||
| 807 | Ga0207699_10145715 | |||
| 808 | Ga0207699_10438524 | |||
| 809 | Ga0207645_10057587 | |||
| 810 | Ga0207705_11002375 | |||
| 811 | Ga0207684_10006638 | |||
| 812 | Ga0207654_10000639 | |||
| 813 | Ga0207654_10094488 | |||
| 814 | Ga0207654_10131843 | |||
| 815 | Ga0207707_10038366 | |||
| 816 | Ga0207707_10187647 | |||
| 817 | Ga0207707_10465576 | |||
| 818 | Ga0207695_10007206 | |||
| 819 | Ga0207695_10048020 | |||
| 820 | Ga0207695_10057772 | |||
| 821 | Ga0207695_10109749 | |||
| 822 | Ga0207695_10214636 | |||
| 823 | Ga0207695_10383923 | |||
| 824 | Ga0207695_10543717 | |||
| 825 | Ga0207695_11247543 | |||
| 826 | Ga0207671_10000388 | |||
| 827 | Ga0207671_10282252 | |||
| 828 | Ga0207671_10284445 | |||
| 829 | Ga0207693_10003880 | |||
| 830 | Ga0207693_10006076 | |||
| 831 | Ga0207693_10009934 | |||
| 832 | Ga0207693_10052056 | |||
| 833 | Ga0207663_10003536 | |||
| 834 | Ga0207663_10131321 | |||
| 835 | Ga0207663_10238334 | |||
| 836 | Ga0207663_10897956 | |||
| 837 | Ga0207663_10938915 | |||
| 838 | Ga0207660_10124793 | |||
| 839 | Ga0207649_10028600 | |||
| 840 | Ga0207649_10089907 | |||
| 841 | Ga0207652_10766569 | |||
| 842 | Ga0207646_10208000 | |||
| 843 | Ga0207681_10436098 | |||
| 844 | Ga0207694_10001625 | |||
| 845 | Ga0207694_10182728 | |||
| 846 | Ga0207694_10491408 | |||
| 847 | Ga0207659_10239698 | |||
| 848 | Ga0207687_10002392 | |||
| 849 | Ga0207687_10112716 | |||
| 850 | Ga0207700_10034377 | |||
| 851 | Ga0207700_10071551 | |||
| 852 | Ga0207700_10125864 | |||
| 853 | Ga0207700_10226142 | |||
| 854 | Ga0207700_10251409 | |||
| 855 | Ga0207700_10699827 | |||
| 856 | Ga0207700_10855217 | |||
| 857 | Ga0207700_11495325 | |||
| 858 | Ga0207664_10145404 | |||
| 859 | Ga0207664_10445033 | |||
| 860 | Ga0207664_10484779 | |||
| 861 | Ga0207664_10549385 | |||
| 862 | Ga0207644_10752244 | |||
| 863 | Ga0207706_10004319 | |||
| 864 | Ga0207686_10269700 | |||
| 865 | Ga0207709_10011049 | |||
| 866 | Ga0207665_10000103 | |||
| 867 | Ga0207665_10011247 | |||
| 868 | Ga0207665_10046269 | |||
| 869 | Ga0207665_10069614 | |||
| 870 | Ga0207665_10070254 | |||
| 871 | Ga0207691_10006018 | |||
| 872 | Ga0207711_10198601 | |||
| 873 | Ga0207661_10010401 | |||
| 874 | Ga0207661_10088795 | |||
| 875 | Ga0207679_10133735 | |||
| 876 | Ga0207679_11002035 | |||
| 877 | Ga0207667_10010737 | |||
| 878 | Ga0207667_10017875 | |||
| 879 | Ga0207667_10027010 | |||
| 880 | Ga0207667_10511984 | |||
| 881 | Ga0207668_10749160 | |||
| 882 | Ga0207640_10013029 | |||
| 883 | Ga0207640_10319535 | |||
| 884 | Ga0207640_10325067 | |||
| 885 | Ga0207640_10392087 | |||
| 886 | Ga0207677_10060843 | |||
| 887 | Ga0207677_10127895 | |||
| 888 | Ga0207639_10000064 | |||
| 889 | Ga0207639_10044826 | |||
| 890 | Ga0207639_10223648 | |||
| 891 | Ga0207678_10359351 | |||
| 892 | Ga0207708_11047197 | |||
| 893 | Ga0207702_10015298 | |||
| 894 | Ga0207702_10022455 | |||
| 895 | Ga0207702_11122711 | |||
| 896 | Ga0207641_10139122 | |||
| 897 | Ga0207641_11095776 | |||
| 898 | Ga0207676_11071442 | |||
| 899 | Ga0207674_10096411 | |||
| 900 | Ga0207674_10657725 | |||
| 901 | Ga0207675_100518785 | |||
| 902 | Ga0207683_10000490 | |||
| 903 | Ga0207698_10001305 | |||
| 904 | Ga0207698_10052450 | |||
| 905 | Ga0207698_10148396 | |||
| 906 | Ga0207698_10672602 | |||
| 907 | Ga0207698_10699137 | |||
| 908 | Ga0207698_11484255 | |||
| 909 | Ga0209588_1036683 | |||
| 910 | Ga0207428_10055006 | |||
| 911 | Ga0268266_10240062 | |||
| 912 | Ga0265323_10000163 | |||
| 913 | Ga0265338_10139557 | |||
| 914 | Ga0265338_10420583 | |||
| 915 | Ga0265762_1000240 | |||
| 916 | Ga0265760_10057661 | |||
| 917 | Ga0265760_10084172 | |||
| 918 | Ga0265330_10028575 | |||
| 919 | Ga0265330_10061969 | |||
| 920 | Ga0265330_10067307 | |||
| 921 | Ga0265330_10246900 | |||
| 922 | Ga0265332_10129780 | |||
| 923 | Ga0265328_10247657 | |||
| 924 | Ga0265325_10145736 | |||
| 925 | Ga0265325_10239529 | |||
| 926 | Ga0265339_10012622 | |||
| 927 | Ga0265339_10112939 | |||
| 928 | Ga0265331_10135982 | |||
| 929 | Ga0265331_10332670 | |||
| 930 | Ga0265316_10006547 | |||
| 931 | Ga0265316_10504591 | |||
| 932 | Ga0265314_10027735 | |||
| 933 | Ga0265342_10040785 | |||
| 934 | Ga0265342_10062056 | |||
| 935 | Ga0265342_10106382 | |||
| 936 | Ga0316215_1018454 | |||
| 937 | Ga0373926_0000846 | |||
| 938 | Ga0373926_0003233 | |||
| 939 | Ga0373934_0001080 | |||
| 940 | Ga0373944_0014214 | |||
| 941 | Ga0373944_0036748 | |||
| 942 | Ga0373923_0011965 | |||
| 943 | Ga0373923_0020519 | |||
| 944 | Ga0373923_0057652 | |||
| 945 | Ga0373936_0003804 | |||
| 946 | Ga0373936_0020060 | |||
| 947 | Ga0373945_0037425 | |||
| 948 | Ga0373954_0108888 | |||
| 949 | Ga0373954_0323450 | |||
| 950 | Ga0373956_0007699 | |||
| 951 | Ga0373956_0088026 | |||
| 952 | Ga0373956_0334637 | |||
| 953 | Ga0373957_0003808 | |||
| 954 | Ga0373957_0101802 | |||
| 955 | Ga0373943_0002365 | |||
| 956 | Ga0373943_0280518 | |||
| 957 | Ga0373946_0003548 | |||
| 958 | Ga0373946_0015880 | |||
| 959 | Ga0373946_0037436 | |||
| 960 | Ga0373946_0446778 | |||
| 961 | Ga0373955_0000379 | |||
| 962 | Ga0373955_0611565 | |||
| 963 | Ga0373955_0670463 | |||
| 964 | Ga0373924_0000669 | |||
| 965 | Ga0373924_0000695 | |||
| 966 | Ga0373924_0017614 | |||
| 967 | Ga0373924_0061865 | |||
| 968 | Ga0373931_0121968 | |||
| 969 | Ga0373935_0005912 | |||
| 970 | Ga0373935_0012581 | |||
| 971 | Ga0373935_0161628 | |||
| 972 | Ga0373927_0000220 | |||
| 973 | Ga0373927_0129886 | |||
| 974 | Ga0373933_0000317 | |||
| 975 | Ga0373933_0034218 | |||
| 976 | Ga0373933_0956143 | |||
| 977 | Ga0373947_0003779 | |||
| 978 | Ga0373947_0003925 | |||
| 979 | Ga0373947_0364060 | |||
| 980 | Ga0373937_0000711 | |||
| 981 | Ga0373937_0008085 | |||
| 982 | Ga0373937_0015905 | |||
| 983 | Ga0373937_0107274 | |||
| 984 | Ga0373937_0195248 | |||
| 985 | Ga0373937_0541190 | |||
| 986 | Ga0373937_1150255 | |||
| 987 | Ga0373925_0004535 | |||
| 988 | Ga0373925_0010701 | |||
| 989 | Ga0373925_0058449 | |||
| 990 | Ga0395898_0910824 | |||
| 991 | Ga0395905_0116963 | |||
| 992 | Ga0395905_0160196 | |||
| 993 | Ga0436363_0064800 | |||
| 994 | Ga0451853_3857372 | |||
| 995 | Ga0451577_0295231 | |||
| 996 | Ga0466969_0261696 | |||
| 997 | Ga0466963_0535518 | |||
| 998 | Ga0466957_0000039 | |||
| 999 | Ga0466957_0957362 | |||
| 1000 | Ga0466959_0090816 | |||
| 1001 | Ga0451576_0089464 | |||
| 1002 | Ga0451576_0142510 | |||
| 1003 | Ga0466958_0515433 | |||
| 1004 | Ga0466967_0233321 | |||
| 1005 | Ga0466967_0248492 | |||
| 1006 | Ga0495592_0002329 | |||
| 1007 | Ga0495603_0001244 | |||
| 1008 | Ga0495629_0017241 | |||
| 1009 | Ga0495629_0022912 | |||
| 1010 | Ga0495629_0158309 | |||
| 1011 | Ga0495629_0197129 | |||
| 1012 | Ga0495629_0325840 | |||
| 1013 | Ga0495641_0233757 | |||
| 1014 | Ga0495651_0001100 | |||
| 1015 | Ga0495651_0405845 | |||
| 1016 | Ga0495653_0000346 | |||
| 1017 | Ga0495580_0013848 | |||
| 1018 | Ga0495580_0072373 | |||
| 1019 | Ga0495580_0125434 | |||
| 1020 | Ga0495580_0472083 | |||
| 1021 | Ga0495580_0508660 | |||
| 1022 | Ga0495582_0038193 | |||
| 1023 | Ga0495582_0062528 | |||
| 1024 | Ga0495582_0124576 | |||
| 1025 | Ga0495639_0001645 | |||
| 1026 | Ga0495639_0045551 | |||
| 1027 | Ga0495664_0150888 | |||
| 1028 | Ga0495594_0411424 | |||
| 1029 | Ga0495608_0000130 | |||
| 1030 | Ga0495608_0123890 | |||
| 1031 | Ga0495608_0137479 | |||
| 1032 | Ga0495618_0159173 | |||
| 1033 | Ga0495618_0303459 | |||
| 1034 | Ga0495628_0001724 | |||
| 1035 | Ga0495630_0009665 | |||
| 1036 | Ga0495630_0022743 | |||
| 1037 | Ga0495630_0040716 | |||
| 1038 | Ga0495630_0104640 | |||
| 1039 | Ga0495663_0009900 | |||
| 1040 | Ga0495666_0355977 | |||
| 1041 | Ga0495642_0031962 | |||
| 1042 | Ga0495652_0000260 | |||
| 1043 | Ga0495652_0713859 | |||
| 1044 | Ga0495665_0091478 | |||
| 1045 | Ga0495665_0153704 | |||
| 1046 | Ga0495665_0222672 | |||
| 1047 | Ga0495640_0140647 | |||
| 1048 | Ga0495640_0494140 | |||
| 1049 | Ga0495586_0056253 | |||
| 1050 | Ga0495587_0000132 | |||
| 1051 | Ga0495587_0145918 | |||
| 1052 | Ga0495645_0002791 | |||
| 1053 | Ga0495645_0017616 | |||
| 1054 | Ga0495645_0091174 | |||
| 1055 | Ga0495645_0329641 | |||
| 1056 | Ga0495667_0000330 | |||
| 1057 | Ga0495667_0116575 | |||
| 1058 | Ga0495667_0486064 | |||
| 1059 | Ga0495635_0000050 | |||
| 1060 | Ga0495635_0230090 | |||
| 1061 | Ga0495635_0594289 | |||
| 1062 | Ga0495659_0076121 | |||
| 1063 | Ga0495588_0005099 | |||
| 1064 | Ga0495657_0000157 | |||
| 1065 | Ga0495657_0062956 | |||
| 1066 | Ga0495599_0001450 | |||
| 1067 | Ga0495599_0239687 | |||
| 1068 | Ga0495599_0773989 | |||
| 1069 | Ga0495623_0002250 | |||
| 1070 | Ga0495623_0084977 | |||
| 1071 | Ga0495646_0000225 | |||
| 1072 | Ga0495646_0311419 | |||
| 1073 | Ga0495647_0101322 | |||
| 1074 | Ga0495658_0007691 | |||
| 1075 | Ga0495658_0198932 | |||
| 1076 | Ga0495613_0003107 | |||
| 1077 | Ga0495613_0009617 | |||
| 1078 | Ga0495613_0026893 | |||
| 1079 | Ga0495613_0074345 | |||
| 1080 | Ga0495581_0005366 | |||
| 1081 | Ga0495604_0000207 | |||
| 1082 | Ga0495604_0705864 | |||
| 1083 | Ga0495674_0003516 | |||
| 1084 | Ga0495674_0059549 | |||
| 1085 | Ga0495676_0245510 | |||
| 1086 | Ga0495675_0000353 | |||
| 1087 | Ga0495675_0166770 | |||
| 1088 | Ga0495685_069268 | |||
| 1089 | Ga0495684_0000160 | |||
| 1090 | Ga0495684_0029995 | |||
| 1091 | Ga0495684_0155021 | |||
| 1092 | Ga0495593_0001372 | |||
| 1093 | Ga0495593_0088194 | |||
| 1094 | Ga0495593_0386326 | |||
| 1095 | Ga0495602_0001852 | |||
| 1096 | Ga0495602_0544237 | |||
| 1097 | Ga0495614_0002026 | |||
| 1098 | Ga0495614_0095031 | |||
| 1099 | Ga0496100_0029519 | |||
| 1100 | Ga0496100_0446177 | |||
| 1101 | Ga0496101_0158719 | |||
| 1102 | Ga0496102_0019733 | |||
| 1103 | Ga0496102_1854855 | |||
| 1104 | Ga0496103_0499433 | |||
| 1105 | Ga0496104_0011136 | |||
| 1106 | Ga0496104_0020528 | |||
| 1107 | Ga0496104_0080276 | |||
| 1108 | Ga0496104_1293363 | |||
| 1109 | Ga0496105_0001167 | |||
| 1110 | Ga0496105_0044122 | |||
| 1111 | Ga0496105_0243319 | |||
| 1112 | Ga0496105_0260378 | |||
| 1113 | Ga0496106_0068670 | |||
| 1114 | Ga0496106_0174140 | |||
| 1115 | Ga0496110_0394022 | |||
| 1116 | Ga0496110_0499063 | |||
| 1117 | Ga0496110_0574542 | |||
| 1118 | Ga0496110_1435503 | |||
| 1119 | Ga0496111_0708950 | |||
| 1120 | Ga0496112_0096782 | |||
| 1121 | Ga0496112_0107096 | |||
| 1122 | Ga0496113_0000557 | |||
| 1123 | Ga0496114_0055326 | |||
| 1124 | Ga0496114_0396847 | |||
| 1125 | Ga0496115_0062821 | |||
| 1126 | Ga0496115_0488901 | |||
| 1127 | Ga0496115_0613899 | |||
| 1128 | Ga0496115_0741963 | |||
| 1129 | Ga0501073_0127063 | |||
| 1130 | Ga0501079_0561633 | |||
| 1131 | Ga0501044_1511772 | |||
| 1132 | nmdc:mga05p37_461085_c1 | |||
| 1133 | nmdc:mga08y16_1895_c1 | |||
| 1134 | nmdc:mga0rr50_275934_c1 | |||
| 1135 | nmdc:mga08x19_1223_c1 | |||
| 1136 | nmdc:mga08x19_133429_c1 | |||
| 1137 | nmdc:mga08x19_792243_c1 | |||
| 1138 | Ga0495601_0060155 | |||
| 1139 | Ga0495612_0004132 | |||
| 1140 | Ga0495595_0199721 | |||
| 1141 | Ga0495619_0000932 | |||
| 1142 | Ga0501084_0666117 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8f5v-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ | 0.8096 | 3 | 126 |
| 3di5-assembly1.cif.gz_A | crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution | 0.8006 | 15 | 135 |
| 2hkv-assembly1.cif.gz_A-2 | crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution | 0.7978 | 1 | 128 |
| 8fx9-assembly1.cif.gz_A-2 | crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme | 0.7962 | 1 | 126 |
| 6iz2-assembly1.cif.gz_A | crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 | 0.7823 | 8 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53728_4_171_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8156 | 3 | 127 | 1.20.120.450 |
| 2hkvA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7894 | 1 | 128 | 1.20.120.450 |
| 3di5A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.76 | 14 | 135 | 1.20.120.450 |
| 5cogA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7459 | 5 | 125 | 1.20.120.450 |
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7342 | 1 | 126 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8SH48-F1-model_v4 | DinB-like domain-containing protein | 0.9956 | 4 | 158 |
|
| AF-A0A2V9YUY0-F1-model_v4 | DinB-like domain-containing protein | 0.9942 | 8 | 158 |
|
| AF-A0A1Q8BNA3-F1-model_v4 | DinB-like domain-containing protein | 0.993 | 2 | 158 |
|
| AF-A0A2V7V500-F1-model_v4 | DinB-like domain-containing protein | 0.9917 | 3 | 158 |
|
| AF-A0A537JVW4-F1-model_v4 | DinB family protein | 0.9879 | 1 | 120 |
|