F464936

General Info

Members Datasets Scaffolds Average Seq Length
571 264 1142 160

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10004897|Ga0105245_100048979
Length 173
Sequence MAATSGPVNDSGRQLLRHTVSTLAYRAGKTLRDAPDTFASFSTGEKGRTPAQILAHMGDLFDWALSIAQGKQAWRDSEPLPWPEEVKRFFRTLEAFDGYLASDAPLAASPEKLFQGPIADALTHTGQIAILRRMAGCPMRRENYYRAEIVAGCVGEEQAAPVGRSDQQAPRAS

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
98 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.25
Rhizosphere 93.87
Stem 0
Stem Tuber 0
Unclassified 34.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10004897 3300009098 Bacteria 11773
2 SwRhRL3b_contig_2779551 2162886006 Bacteria 902
3 SwRhRL3b_contig_4178110 2162886006 Bacteria 1699
4 JGI25406J46586_10083987 3300003203 Bacteria 971
5 rootH1_10252652 3300003323 Unclassified 1538
6 Ga0058863_10013587 3300004799 Unclassified 1206
7 Ga0065704_10112719 3300005289 Unclassified 1917
8 Ga0065712_10383174 3300005290 Bacteria 750
9 Ga0065707_10012500 3300005295 Bacteria 1697
10 Ga0070658_10326582 3300005327 Bacteria 1310
11 Ga0070676_10042342 3300005328 Bacteria 2643
12 Ga0070683_100015514 3300005329 Bacteria 6695
13 Ga0070683_100068498 3300005329 Unclassified 3307
14 Ga0070683_100075403 3300005329 Bacteria 3151
15 Ga0070683_100634850 3300005329 Bacteria 1022
16 Ga0070670_100162920 3300005331 Bacteria 1933
17 Ga0068869_100275106 3300005334 Unclassified 1352
18 Ga0068869_100381234 3300005334 Bacteria 1156
19 Ga0070666_10985885 3300005335 Unclassified 625
20 Ga0070680_100593510 3300005336 Unclassified 950
21 Ga0070682_100044294 3300005337 Bacteria 2754
22 Ga0070682_100252719 3300005337 Unclassified 1272
23 Ga0068868_100018233 3300005338 Bacteria 5244
24 Ga0070691_10020822 3300005341 Bacteria 3032
25 Ga0070661_100008470 3300005344 Bacteria 7114
26 Ga0070661_100073097 3300005344 Bacteria 2524
27 Ga0070661_100639310 3300005344 Bacteria 863
28 Ga0070668_100283482 3300005347 Unclassified 1384
29 Ga0070675_100111661 3300005354 Bacteria 2313
30 Ga0070673_100008961 3300005364 Bacteria 6691
31 Ga0070709_10201518 3300005434 Bacteria 1410
32 Ga0070709_11129612 3300005434 Unclassified 628
33 Ga0070714_100007726 3300005435 Bacteria 8376
34 Ga0070714_100052990 3300005435 Bacteria 3461
35 Ga0070714_100105576 3300005435 Bacteria 2487
36 Ga0070714_100267407 3300005435 Bacteria 1585
37 Ga0070713_100066976 3300005436 Bacteria 3022
38 Ga0070713_100108646 3300005436 Unclassified 2415
39 Ga0070713_100187238 3300005436 Bacteria 1863
40 Ga0070713_100392408 3300005436 Unclassified 1295
41 Ga0070713_100458190 3300005436 Bacteria 1199
42 Ga0070713_100605168 3300005436 Unclassified 1041
43 Ga0070713_100765451 3300005436 Bacteria 924
44 Ga0070713_100802595 3300005436 Unclassified 902
45 Ga0070710_10118591 3300005437 Unclassified 1598
46 Ga0070710_10325566 3300005437 Bacteria 1010
47 Ga0070710_10473375 3300005437 Unclassified 853
48 Ga0070710_10829245 3300005437 Unclassified 662
49 Ga0070711_100005541 3300005439 Bacteria 7560
50 Ga0070711_100227540 3300005439 Bacteria 1453
51 Ga0070711_100347595 3300005439 Bacteria 1192
52 Ga0070711_101499484 3300005439 Bacteria 588
53 Ga0070711_101832205 3300005439 Unclassified 533
54 Ga0070705_100000686 3300005440 Bacteria 19399
55 Ga0070700_101296392 3300005441 Unclassified 612
56 Ga0070694_100000317 3300005444 Bacteria 25971
57 Ga0070708_100000002 3300005445 Bacteria 195857
58 Ga0070663_100593534 3300005455 Bacteria 931
59 Ga0070678_100214333 3300005456 Bacteria 1597
60 Ga0070681_10232553 3300005458 Bacteria 1757
61 Ga0070681_10495743 3300005458 Unclassified 1134
62 Ga0070681_10619385 3300005458 Unclassified 997
63 Ga0070706_100008336 3300005467 Bacteria 9654
64 Ga0070706_100771771 3300005467 Bacteria 890
65 Ga0070707_100408915 3300005468 Bacteria 1317
66 Ga0070698_100006598 3300005471 Bacteria 12581
67 Ga0070698_100039870 3300005471 Bacteria 4829
68 Ga0070699_100000483 3300005518 Bacteria 37967
69 Ga0070699_101071784 3300005518 Bacteria 739
70 Ga0070679_100858085 3300005530 Unclassified 851
71 Ga0070684_100002219 3300005535 Bacteria 14329
72 Ga0070684_100051120 3300005535 Bacteria 3590
73 Ga0070684_100173565 3300005535 Bacteria 1958
74 Ga0070684_100271665 3300005535 Unclassified 1552
75 Ga0070684_100707427 3300005535 Unclassified 939
76 Ga0070697_100100307 3300005536 Unclassified 2404
77 Ga0070697_101457022 3300005536 Unclassified 612
78 Ga0068853_100024797 3300005539 Bacteria 5031
79 Ga0068853_100119048 3300005539 Bacteria 2353
80 Ga0068853_100161813 3300005539 Bacteria 2020
81 Ga0070672_100013140 3300005543 Bacteria 5837
82 Ga0070695_100000115 3300005545 Bacteria 35742
83 Ga0070696_100000303 3300005546 Bacteria 29759
84 Ga0070696_101385896 3300005546 Bacteria 599
85 Ga0070693_100024674 3300005547 Bacteria 3227
86 Ga0070693_100214091 3300005547 Unclassified 1259
87 Ga0070693_100477723 3300005547 Bacteria 880
88 Ga0068855_100002549 3300005563 Bacteria 22448
89 Ga0068855_100025864 3300005563 Bacteria 7019
90 Ga0068855_100033538 3300005563 Bacteria 6126
91 Ga0068855_100186640 3300005563 Unclassified 2341
92 Ga0068855_100398105 3300005563 Bacteria 1509
93 Ga0070664_100251654 3300005564 Unclassified 1588
94 Ga0070664_100815986 3300005564 Unclassified 873
95 Ga0070664_100912571 3300005564 Bacteria 824
96 Ga0068857_100080026 3300005577 Bacteria 2918
97 Ga0068857_100159055 3300005577 Bacteria 2049
98 Ga0068854_100027270 3300005578 Bacteria 3936
99 Ga0068854_100114794 3300005578 Bacteria 2036
100 Ga0068854_101908380 3300005578 Unclassified 546
101 Ga0068856_100006613 3300005614 Bacteria 11356
102 Ga0068856_100009318 3300005614 Bacteria 9535
103 Ga0068856_100025597 3300005614 Bacteria 5754
104 Ga0068856_100078534 3300005614 Bacteria 3272
105 Ga0068856_100144230 3300005614 Bacteria 2389
106 Ga0068852_100001843 3300005616 Bacteria 14406
107 Ga0068852_100020336 3300005616 Bacteria 5278
108 Ga0068852_100603974 3300005616 Bacteria 1101
109 Ga0068852_101422290 3300005616 Unclassified 716
110 Ga0068864_100438033 3300005618 Unclassified 1248
111 Ga0068861_100388891 3300005719 Unclassified 1234
112 Ga0068851_10000736 3300005834 Bacteria 13995
113 Ga0068851_10012540 3300005834 Bacteria 3997
114 Ga0068851_10190635 3300005834 Unclassified 1140
115 Ga0068863_100072097 3300005841 Bacteria 3268
116 Ga0068863_100954421 3300005841 Unclassified 859
117 Ga0068858_100189495 3300005842 Unclassified 1943
118 Ga0068858_100405602 3300005842 Unclassified 1310
119 Ga0081539_10066233 3300005985 Unclassified 1958
120 Ga0070717_10075091 3300006028 Bacteria 2827
121 Ga0070717_10136240 3300006028 Bacteria 2115
122 Ga0070717_10208702 3300006028 Unclassified 1713
123 Ga0070717_10220828 3300006028 Unclassified 1665
124 Ga0070717_10268129 3300006028 Unclassified 1512
125 Ga0070715_10023807 3300006163 Unclassified 2403
126 Ga0070715_10222153 3300006163 Unclassified 972
127 Ga0070715_10314846 3300006163 Unclassified 842
128 Ga0070716_100041752 3300006173 Bacteria 2557
129 Ga0070716_100078516 3300006173 Bacteria 1963
130 Ga0070716_100547631 3300006173 Unclassified 862
131 Ga0070712_100012073 3300006175 Bacteria 5490
132 Ga0070712_100025539 3300006175 Unclassified 3928
133 Ga0070712_100244153 3300006175 Bacteria 1432
134 Ga0070712_100361955 3300006175 Unclassified 1190
135 Ga0070712_100451029 3300006175 Unclassified 1071
136 Ga0070712_100833417 3300006175 Unclassified 793
137 Ga0097621_100008852 3300006237 Bacteria 7277
138 Ga0097621_100522197 3300006237 Bacteria 1078
139 Ga0097621_101031654 3300006237 Bacteria 770
140 Ga0075428_100000525 3300006844 Bacteria 39005
141 Ga0068865_100053870 3300006881 Bacteria 2793
142 Ga0075436_100059842 3300006914 Bacteria 2631
143 Ga0075436_100104009 3300006914 Unclassified 1979
144 Ga0075436_100117141 3300006914 Bacteria 1862
145 Ga0097620_100215981 3300006931 Bacteria 2005
146 Ga0075435_100396140 3300007076 Unclassified 1187
147 Ga0075435_100671236 3300007076 Bacteria 900
148 Ga0099794_10116504 3300007265 Bacteria 1342
149 Ga0099795_10038816 3300007788 Bacteria 1683
150 Ga0099795_10160094 3300007788 Unclassified 928
151 Ga0105240_10005609 3300009093 Bacteria 18632
152 Ga0105240_10008420 3300009093 Bacteria 14757
153 Ga0105240_10012468 3300009093 Bacteria 11727
154 Ga0105240_10049138 3300009093 Bacteria 5327
155 Ga0105240_10056796 3300009093 Bacteria 4896
156 Ga0105240_10097985 3300009093 Bacteria 3572
157 Ga0105240_10553235 3300009093 Unclassified 1273
158 Ga0105240_10581317 3300009093 Bacteria 1236
159 Ga0111539_10004636 3300009094 Bacteria 17955
160 Ga0105245_10060927 3300009098 Bacteria 3400
161 Ga0114129_10141105 3300009147 Bacteria 3303
162 Ga0105243_10041557 3300009148 Unclassified 3596
163 Ga0105241_10002177 3300009174 Bacteria 14765
164 Ga0105241_10012499 3300009174 Bacteria 6225
165 Ga0105241_10026448 3300009174 Bacteria 4317
166 Ga0105241_10141301 3300009174 Unclassified 1961
167 Ga0105241_10163331 3300009174 Bacteria 1833
168 Ga0105241_11333352 3300009174 Bacteria 685
169 Ga0105241_11430642 3300009174 Bacteria 663
170 Ga0105242_10309286 3300009176 Bacteria 1445
171 Ga0105248_10036210 3300009177 Bacteria 5519
172 Ga0105248_10084174 3300009177 Bacteria 3578
173 Ga0105248_11447876 3300009177 Unclassified 777
174 Ga0105237_10005052 3300009545 Bacteria 15009
175 Ga0105237_10039685 3300009545 Bacteria 4752
176 Ga0105237_10607589 3300009545 Unclassified 1101
177 Ga0105238_10002314 3300009551 Bacteria 19163
178 Ga0105238_10005322 3300009551 Bacteria 12715
179 Ga0105238_10073878 3300009551 Bacteria 3403
180 Ga0105238_10088193 3300009551 Bacteria 3089
181 Ga0105238_10275050 3300009551 Unclassified 1665
182 Ga0105238_10401560 3300009551 Bacteria 1364
183 Ga0105238_10902892 3300009551 Unclassified 902
184 Ga0105238_11724076 3300009551 Unclassified 658
185 Ga0105239_10070267 3300010375 Unclassified 3846
186 Ga0105239_10214303 3300010375 Unclassified 2159
187 Ga0105239_10351620 3300010375 Bacteria 1664
188 Ga0105239_10536897 3300010375 Bacteria 1331
189 Ga0105239_12031306 3300010375 Unclassified 668
190 Ga0105246_10131601 3300011119 Unclassified 1869
191 Ga0105246_10751747 3300011119 Unclassified 860
192 Ga0105246_11435860 3300011119 Unclassified 645
193 Ga0157373_10141774 3300013100 Bacteria 1690
194 Ga0157373_10165181 3300013100 Bacteria 1558
195 Ga0157371_10177506 3300013102 Bacteria 1523
196 Ga0157370_10651838 3300013104 Unclassified 962
197 Ga0157369_10010048 3300013105 Bacteria 10808
198 Ga0157369_10020268 3300013105 Bacteria 7433
199 Ga0157369_10086408 3300013105 Bacteria 3350
200 Ga0157369_10261696 3300013105 Unclassified 1804
201 Ga0157369_10600323 3300013105 Bacteria 1136
202 Ga0157369_11063703 3300013105 Unclassified 828
203 Ga0157374_10137119 3300013296 Viruses 2373
204 Ga0157374_10433384 3300013296 Bacteria 1314
205 Ga0157374_10989266 3300013296 Unclassified 860
206 Ga0157378_10061341 3300013297 Bacteria 3355
207 Ga0157378_10159129 3300013297 Bacteria 2111
208 Ga0163162_10947275 3300013306 Unclassified 972
209 Ga0157372_10006091 3300013307 Bacteria 12812
210 Ga0157372_10006283 3300013307 Bacteria 12636
211 Ga0157372_10010207 3300013307 Bacteria 9972
212 Ga0157372_10065204 3300013307 Bacteria 4089
213 Ga0157372_10741487 3300013307 Unclassified 1142
214 Ga0157372_10914315 3300013307 Unclassified 1018
215 Ga0157372_10975130 3300013307 Unclassified 982
216 Ga0157375_10169127 3300013308 Bacteria 2332
217 Ga0163163_10285932 3300014325 Unclassified 1701
218 Ga0157380_10149186 3300014326 Unclassified 2019
219 Ga0157379_10160465 3300014968 Bacteria 2029
220 Ga0157376_10136799 3300014969 Bacteria 2193
221 Ga0157376_10152685 3300014969 Unclassified 2084
222 Ga0157376_10361239 3300014969 Bacteria 1393
223 Ga0157376_11260403 3300014969 Unclassified 769
224 Ga0163161_10016089 3300017792 Bacteria 5221
225 Ga0224712_10075945 3300022467 Bacteria 1375
226 Ga0228600_1004342 3300024123 Unclassified 1033
227 Ga0224572_1035591 3300024225 Unclassified 944
228 Ga0207656_10036122 3300025321 Bacteria 2073
229 Ga0207656_10071848 3300025321 Bacteria 1539
230 Ga0207656_10178191 3300025321 Unclassified 1019
231 Ga0207692_10399378 3300025898 Unclassified 857
232 Ga0207680_10155079 3300025903 Unclassified 1530
233 Ga0207685_10159137 3300025905 Unclassified 1029
234 Ga0207685_10409052 3300025905 Unclassified 697
235 Ga0207699_10021419 3300025906 Bacteria 3484
236 Ga0207699_10145715 3300025906 Bacteria 1561
237 Ga0207699_10438524 3300025906 Unclassified 935
238 Ga0207645_10057587 3300025907 Bacteria 2481
239 Ga0207705_11002375 3300025909 Unclassified 645
240 Ga0207684_10006638 3300025910 Bacteria 10516
241 Ga0207654_10000639 3300025911 Bacteria 19764
242 Ga0207654_10094488 3300025911 Bacteria 1830
243 Ga0207654_10131843 3300025911 Bacteria 1583
244 Ga0207707_10038366 3300025912 Bacteria 4186
245 Ga0207707_10187647 3300025912 Unclassified 1804
246 Ga0207707_10465576 3300025912 Unclassified 1081
247 Ga0207695_10007206 3300025913 Bacteria 14220
248 Ga0207695_10048020 3300025913 Bacteria 4511
249 Ga0207695_10057772 3300025913 Unclassified 4030
250 Ga0207695_10109749 3300025913 Bacteria 2740
251 Ga0207695_10214636 3300025913 Bacteria 1834
252 Ga0207695_10383923 3300025913 Bacteria 1290
253 Ga0207695_10543717 3300025913 Bacteria 1043
254 Ga0207695_11247543 3300025913 Unclassified 624
255 Ga0207671_10000388 3300025914 Bacteria 61765
256 Ga0207671_10282252 3300025914 Bacteria 1310
257 Ga0207671_10284445 3300025914 Bacteria 1305
258 Ga0207693_10003880 3300025915 Bacteria 12731
259 Ga0207693_10006076 3300025915 Bacteria 10001
260 Ga0207693_10009934 3300025915 Bacteria 7737
261 Ga0207693_10052056 3300025915 Bacteria 3211
262 Ga0207663_10003536 3300025916 Bacteria 7666
263 Ga0207663_10131321 3300025916 Unclassified 1731
264 Ga0207663_10238334 3300025916 Bacteria 1333
265 Ga0207663_10897956 3300025916 Unclassified 708
266 Ga0207663_10938915 3300025916 Unclassified 693
267 Ga0207660_10124793 3300025917 Bacteria 1954
268 Ga0207649_10028600 3300025920 Bacteria 3283
269 Ga0207649_10089907 3300025920 Bacteria 2008
270 Ga0207652_10766569 3300025921 Unclassified 858
271 Ga0207646_10208000 3300025922 Unclassified 1767
272 Ga0207681_10436098 3300025923 Unclassified 1064
273 Ga0207694_10001625 3300025924 Bacteria 18894
274 Ga0207694_10182728 3300025924 Unclassified 1701
275 Ga0207694_10491408 3300025924 Bacteria 1027
276 Ga0207659_10239698 3300025926 Bacteria 1466
277 Ga0207687_10002392 3300025927 Bacteria 12713
278 Ga0207687_10112716 3300025927 Bacteria 2022
279 Ga0207700_10034377 3300025928 Bacteria 3638
280 Ga0207700_10071551 3300025928 Bacteria 2671
281 Ga0207700_10125864 3300025928 Bacteria 2085
282 Ga0207700_10226142 3300025928 Bacteria 1589
283 Ga0207700_10251409 3300025928 Bacteria 1510
284 Ga0207700_10699827 3300025928 Unclassified 905
285 Ga0207700_10855217 3300025928 Unclassified 814
286 Ga0207700_11495325 3300025928 Unclassified 599
287 Ga0207664_10145404 3300025929 Unclassified 2010
288 Ga0207664_10445033 3300025929 Unclassified 1156
289 Ga0207664_10484779 3300025929 Unclassified 1106
290 Ga0207664_10549385 3300025929 Bacteria 1036
291 Ga0207644_10752244 3300025931 Unclassified 814
292 Ga0207706_10004319 3300025933 Bacteria 13353
293 Ga0207686_10269700 3300025934 Unclassified 1251
294 Ga0207709_10011049 3300025935 Bacteria 4979
295 Ga0207665_10000103 3300025939 Bacteria 55197
296 Ga0207665_10011247 3300025939 Bacteria 5872
297 Ga0207665_10046269 3300025939 Bacteria 2916
298 Ga0207665_10069614 3300025939 Bacteria 2400
299 Ga0207665_10070254 3300025939 Bacteria 2389
300 Ga0207691_10006018 3300025940 Bacteria 11714
301 Ga0207711_10198601 3300025941 Bacteria 1830
302 Ga0207661_10010401 3300025944 Bacteria 6697
303 Ga0207661_10088795 3300025944 Unclassified 2570
304 Ga0207679_10133735 3300025945 Bacteria 1994
305 Ga0207679_11002035 3300025945 Bacteria 766
306 Ga0207667_10010737 3300025949 Bacteria 10682
307 Ga0207667_10017875 3300025949 Bacteria 7970
308 Ga0207667_10027010 3300025949 Bacteria 6261
309 Ga0207667_10511984 3300025949 Unclassified 1216
310 Ga0207668_10749160 3300025972 Unclassified 862
311 Ga0207640_10013029 3300025981 Bacteria 4755
312 Ga0207640_10319535 3300025981 Bacteria 1235
313 Ga0207640_10325067 3300025981 Unclassified 1226
314 Ga0207640_10392087 3300025981 Unclassified 1128
315 Ga0207677_10060843 3300026023 Viruses 2612
316 Ga0207677_10127895 3300026023 Bacteria 1923
317 Ga0207639_10000064 3300026041 Bacteria 99860
318 Ga0207639_10044826 3300026041 Bacteria 3328
319 Ga0207639_10223648 3300026041 Bacteria 1627
320 Ga0207678_10359351 3300026067 Bacteria 1257
321 Ga0207708_11047197 3300026075 Unclassified 710
322 Ga0207702_10015298 3300026078 Bacteria 6360
323 Ga0207702_10022455 3300026078 Bacteria 5231
324 Ga0207702_11122711 3300026078 Unclassified 780
325 Ga0207641_10139122 3300026088 Bacteria 2188
326 Ga0207641_11095776 3300026088 Unclassified 795
327 Ga0207676_11071442 3300026095 Unclassified 796
328 Ga0207674_10096411 3300026116 Bacteria 2943
329 Ga0207674_10657725 3300026116 Unclassified 1012
330 Ga0207675_100518785 3300026118 Unclassified 1188
331 Ga0207683_10000490 3300026121 Bacteria 36567
332 Ga0207698_10001305 3300026142 Bacteria 14519
333 Ga0207698_10052450 3300026142 Bacteria 3125
334 Ga0207698_10148396 3300026142 Unclassified 2031
335 Ga0207698_10672602 3300026142 Bacteria 1028
336 Ga0207698_10699137 3300026142 Unclassified 1009
337 Ga0207698_11484255 3300026142 Unclassified 693
338 Ga0209588_1036683 3300027671 Bacteria 1578
339 Ga0207428_10055006 3300027907 Unclassified 3166
340 Ga0268266_10240062 3300028379 Bacteria 1672
341 Ga0265323_10000163 3300028653 Bacteria 39972
342 Ga0265338_10139557 3300028800 Bacteria 1901
343 Ga0265338_10420583 3300028800 Bacteria 950
344 Ga0265762_1000240 3300030760 Bacteria 8904
345 Ga0265760_10057661 3300031090 Bacteria 1176
346 Ga0265760_10084172 3300031090 Unclassified 988
347 Ga0265330_10028575 3300031235 Bacteria 2512
348 Ga0265330_10061969 3300031235 Bacteria 1627
349 Ga0265330_10067307 3300031235 Bacteria 1552
350 Ga0265330_10246900 3300031235 Bacteria 752
351 Ga0265332_10129780 3300031238 Unclassified 1057
352 Ga0265328_10247657 3300031239 Unclassified 682
353 Ga0265325_10145736 3300031241 Bacteria 1123
354 Ga0265325_10239529 3300031241 Unclassified 825
355 Ga0265339_10012622 3300031249 Bacteria 5148
356 Ga0265339_10112939 3300031249 Unclassified 1404
357 Ga0265331_10135982 3300031250 Unclassified 1119
358 Ga0265331_10332670 3300031250 Unclassified 680
359 Ga0265316_10006547 3300031344 Bacteria 11110
360 Ga0265316_10504591 3300031344 Bacteria 864
361 Ga0265314_10027735 3300031711 Unclassified 4237
362 Ga0265342_10040785 3300031712 Bacteria 2814
363 Ga0265342_10062056 3300031712 Unclassified 2201
364 Ga0265342_10106382 3300031712 Bacteria 1592
365 Ga0316215_1018454 3300033544 Unclassified 705
366 Ga0373926_0000846 3300035083 Bacteria 8715
367 Ga0373926_0003233 3300035083 Bacteria 5234
368 Ga0373934_0001080 3300035086 Bacteria 9872
369 Ga0373944_0014214 3300035089 Bacteria 2220
370 Ga0373944_0036748 3300035089 Bacteria 1497
371 Ga0373923_0011965 3300035111 Bacteria 3196
372 Ga0373923_0020519 3300035111 Unclassified 2568
373 Ga0373923_0057652 3300035111 Unclassified 1643
374 Ga0373936_0003804 3300035113 Bacteria 5685
375 Ga0373936_0020060 3300035113 Unclassified 2594
376 Ga0373945_0037425 3300035116 Bacteria 1741
377 Ga0373954_0108888 3300035118 Bacteria 1339
378 Ga0373954_0323450 3300035118 Unclassified 761
379 Ga0373956_0007699 3300035119 Bacteria 4342
380 Ga0373956_0088026 3300035119 Bacteria 1430
381 Ga0373956_0334637 3300035119 Unclassified 721
382 Ga0373957_0003808 3300035120 Unclassified 4521
383 Ga0373957_0101802 3300035120 Unclassified 1151
384 Ga0373943_0002365 3300035170 Bacteria 8555
385 Ga0373943_0280518 3300035170 Bacteria 942
386 Ga0373946_0003548 3300035171 Bacteria 5538
387 Ga0373946_0015880 3300035171 Unclassified 2862
388 Ga0373946_0037436 3300035171 Bacteria 1971
389 Ga0373946_0446778 3300035171 Unclassified 658
390 Ga0373955_0000379 3300035172 Bacteria 18767
391 Ga0373955_0611565 3300035172 Unclassified 668
392 Ga0373955_0670463 3300035172 Unclassified 636
393 Ga0373924_0000669 3300035410 Bacteria 10668
394 Ga0373924_0000695 3300035410 Bacteria 10470
395 Ga0373924_0017614 3300035410 Bacteria 2743
396 Ga0373924_0061865 3300035410 Bacteria 1567
397 Ga0373931_0121968 3300035691 Bacteria 1491
398 Ga0373935_0005912 3300035692 Bacteria 7251
399 Ga0373935_0012581 3300035692 Bacteria 5092
400 Ga0373935_0161628 3300035692 Bacteria 1527
401 Ga0373927_0000220 3300035695 Bacteria 45246
402 Ga0373927_0129886 3300035695 Bacteria 1645
403 Ga0373933_0000317 3300035724 Bacteria 31226
404 Ga0373933_0034218 3300035724 Bacteria 2960
405 Ga0373933_0956143 3300035724 Unclassified 564
406 Ga0373947_0003779 3300035725 Bacteria 8927
407 Ga0373947_0003925 3300035725 Bacteria 8746
408 Ga0373947_0364060 3300035725 Unclassified 971
409 Ga0373937_0000711 3300036401 Bacteria 29037
410 Ga0373937_0008085 3300036401 Bacteria 9130
411 Ga0373937_0015905 3300036401 Bacteria 6673
412 Ga0373937_0107274 3300036401 Bacteria 2597
413 Ga0373937_0195248 3300036401 Bacteria 1902
414 Ga0373937_0541190 3300036401 Unclassified 1106
415 Ga0373937_1150255 3300036401 Bacteria 725
416 Ga0373925_0004535 3300037068 Bacteria 10495
417 Ga0373925_0010701 3300037068 Bacteria 6652
418 Ga0373925_0058449 3300037068 Unclassified 2891
419 Ga0395898_0910824 3300037466 Unclassified 817
420 Ga0395905_0116963 3300037471 Bacteria 2505
421 Ga0395905_0160196 3300037471 Bacteria 2115
422 Ga0436363_0064800 3300039450 Unclassified 931
423 Ga0451853_3857372 3300041512 Bacteria 539
424 Ga0451577_0295231 3300042876 Bacteria 1469
425 Ga0466969_0261696 3300044656 Bacteria 784
426 Ga0466963_0535518 3300044694 Unclassified 827
427 Ga0466957_0000039 3300044842 Bacteria 47226
428 Ga0466957_0957362 3300044842 Unclassified 613
429 Ga0466959_0090816 3300045049 Bacteria 2193
430 Ga0451576_0089464 3300045051 Bacteria 3202
431 Ga0451576_0142510 3300045051 Unclassified 2499
432 Ga0466958_0515433 3300045836 Bacteria 776
433 Ga0466967_0233321 3300045976 Bacteria 1753
434 Ga0466967_0248492 3300045976 Bacteria 1699
435 Ga0495592_0002329 3300046454 Bacteria 13417
436 Ga0495603_0001244 3300046455 Bacteria 14878
437 Ga0495629_0017241 3300046459 Bacteria 5180
438 Ga0495629_0022912 3300046459 Unclassified 4451
439 Ga0495629_0158309 3300046459 Unclassified 1573
440 Ga0495629_0197129 3300046459 Unclassified 1393
441 Ga0495629_0325840 3300046459 Bacteria 1050
442 Ga0495641_0233757 3300046461 Bacteria 825
443 Ga0495651_0001100 3300046462 Bacteria 20855
444 Ga0495651_0405845 3300046462 Bacteria 889
445 Ga0495653_0000346 3300046463 Bacteria 37819
446 Ga0495580_0013848 3300046472 Bacteria 6141
447 Ga0495580_0072373 3300046472 Bacteria 2407
448 Ga0495580_0125434 3300046472 Bacteria 1782
449 Ga0495580_0472083 3300046472 Unclassified 840
450 Ga0495580_0508660 3300046472 Unclassified 803
451 Ga0495582_0038193 3300046473 Bacteria 2642
452 Ga0495582_0062528 3300046473 Bacteria 2056
453 Ga0495582_0124576 3300046473 Unclassified 1453
454 Ga0495639_0001645 3300046475 Bacteria 9949
455 Ga0495639_0045551 3300046475 Bacteria 1984
456 Ga0495664_0150888 3300046477 Bacteria 1409
457 Ga0495594_0411424 3300046499 Bacteria 769
458 Ga0495608_0000130 3300046511 Bacteria 53676
459 Ga0495608_0123890 3300046511 Bacteria 1656
460 Ga0495608_0137479 3300046511 Bacteria 1561
461 Ga0495618_0159173 3300046514 Bacteria 1440
462 Ga0495618_0303459 3300046514 Bacteria 992
463 Ga0495628_0001724 3300046516 Bacteria 19899
464 Ga0495630_0009665 3300046517 Bacteria 6936
465 Ga0495630_0022743 3300046517 Bacteria 4630
466 Ga0495630_0040716 3300046517 Bacteria 3472
467 Ga0495630_0104640 3300046517 Unclassified 2142
468 Ga0495663_0009900 3300046525 Bacteria 2647
469 Ga0495666_0355977 3300046526 Bacteria 659
470 Ga0495642_0031962 3300046528 Bacteria 2110
471 Ga0495652_0000260 3300046529 Bacteria 62378
472 Ga0495652_0713859 3300046529 Unclassified 674
473 Ga0495665_0091478 3300046531 Bacteria 1598
474 Ga0495665_0153704 3300046531 Bacteria 1200
475 Ga0495665_0222672 3300046531 Unclassified 975
476 Ga0495640_0140647 3300046533 Unclassified 1556
477 Ga0495640_0494140 3300046533 Unclassified 745
478 Ga0495586_0056253 3300046535 Bacteria 2133
479 Ga0495587_0000132 3300046536 Bacteria 56457
480 Ga0495587_0145918 3300046536 Unclassified 1349
481 Ga0495645_0002791 3300046543 Bacteria 11849
482 Ga0495645_0017616 3300046543 Bacteria 5119
483 Ga0495645_0091174 3300046543 Bacteria 2177
484 Ga0495645_0329641 3300046543 Unclassified 989
485 Ga0495667_0000330 3300046559 Bacteria 29916
486 Ga0495667_0116575 3300046559 Unclassified 1725
487 Ga0495667_0486064 3300046559 Unclassified 774
488 Ga0495635_0000050 3300046663 Bacteria 76087
489 Ga0495635_0230090 3300046663 Bacteria 1252
490 Ga0495635_0594289 3300046663 Unclassified 723
491 Ga0495659_0076121 3300046664 Bacteria 1265
492 Ga0495588_0005099 3300046674 Bacteria 5838
493 Ga0495657_0000157 3300046675 Bacteria 61489
494 Ga0495657_0062956 3300046675 Bacteria 2449
495 Ga0495599_0001450 3300046678 Bacteria 13606
496 Ga0495599_0239687 3300046678 Unclassified 1106
497 Ga0495599_0773989 3300046678 Unclassified 549
498 Ga0495623_0002250 3300046679 Bacteria 12842
499 Ga0495623_0084977 3300046679 Bacteria 1952
500 Ga0495646_0000225 3300046680 Bacteria 28086
501 Ga0495646_0311419 3300046680 Unclassified 831
502 Ga0495647_0101322 3300046681 Bacteria 1193
503 Ga0495658_0007691 3300046683 Bacteria 5340
504 Ga0495658_0198932 3300046683 Bacteria 1248
505 Ga0495613_0003107 3300046689 Bacteria 12426
506 Ga0495613_0009617 3300046689 Bacteria 7182
507 Ga0495613_0026893 3300046689 Bacteria 4283
508 Ga0495613_0074345 3300046689 Bacteria 2475
509 Ga0495581_0005366 3300047315 Bacteria 7417
510 Ga0495604_0000207 3300047317 Bacteria 53831
511 Ga0495604_0705864 3300047317 Unclassified 640
512 Ga0495674_0003516 3300047319 Bacteria 15259
513 Ga0495674_0059549 3300047319 Bacteria 3335
514 Ga0495676_0245510 3300047321 Unclassified 1224
515 Ga0495675_0000353 3300047444 Bacteria 32273
516 Ga0495675_0166770 3300047444 Bacteria 1354
517 Ga0495685_069268 3300047447 Bacteria 1183
518 Ga0495684_0000160 3300047471 Bacteria 50298
519 Ga0495684_0029995 3300047471 Bacteria 4176
520 Ga0495684_0155021 3300047471 Bacteria 1711
521 Ga0495593_0001372 3300047673 Bacteria 14240
522 Ga0495593_0088194 3300047673 Bacteria 1599
523 Ga0495593_0386326 3300047673 Unclassified 700
524 Ga0495602_0001852 3300048088 Bacteria 21171
525 Ga0495602_0544237 3300048088 Unclassified 805
526 Ga0495614_0002026 3300048089 Bacteria 8907
527 Ga0495614_0095031 3300048089 Bacteria 1299
528 Ga0496100_0029519 3300048903 Bacteria 3393
529 Ga0496100_0446177 3300048903 Unclassified 991
530 Ga0496101_0158719 3300048904 Bacteria 1734
531 Ga0496102_0019733 3300048905 Bacteria 5942
532 Ga0496102_1854855 3300048905 Unclassified 520
533 Ga0496103_0499433 3300048906 Unclassified 778
534 Ga0496104_0011136 3300048907 Bacteria 8047
535 Ga0496104_0020528 3300048907 Bacteria 6057
536 Ga0496104_0080276 3300048907 Bacteria 3110
537 Ga0496104_1293363 3300048907 Unclassified 632
538 Ga0496105_0001167 3300048908 Bacteria 18283
539 Ga0496105_0044122 3300048908 Bacteria 3676
540 Ga0496105_0243319 3300048908 Bacteria 1459
541 Ga0496105_0260378 3300048908 Bacteria 1403
542 Ga0496106_0068670 3300048909 Unclassified 2704
543 Ga0496106_0174140 3300048909 Unclassified 1707
544 Ga0496110_0394022 3300048913 Bacteria 1262
545 Ga0496110_0499063 3300048913 Unclassified 1108
546 Ga0496110_0574542 3300048913 Unclassified 1024
547 Ga0496110_1435503 3300048913 Unclassified 600
548 Ga0496111_0708950 3300048914 Unclassified 732
549 Ga0496112_0096782 3300048915 Bacteria 2922
550 Ga0496112_0107096 3300048915 Bacteria 2765
551 Ga0496113_0000557 3300048916 Bacteria 18513
552 Ga0496114_0055326 3300048917 Unclassified 3309
553 Ga0496114_0396847 3300048917 Bacteria 1222
554 Ga0496115_0062821 3300048918 Unclassified 2996
555 Ga0496115_0488901 3300048918 Unclassified 990
556 Ga0496115_0613899 3300048918 Eukaryota 863
557 Ga0496115_0741963 3300048918 Unclassified 768
558 Ga0501073_0127063 3300049589 Unclassified 1767
559 Ga0501079_0561633 3300049741 Unclassified 898
560 Ga0501044_1511772 3300049823 Bacteria 536
561 nmdc:mga05p37_461085_c1 3300050507 Bacteria 1468
562 nmdc:mga08y16_1895_c1 3300050511 Bacteria 21305
563 nmdc:mga0rr50_275934_c1 3300050513 Unclassified 1402
564 nmdc:mga08x19_1223_c1 3300050514 Bacteria 15980
565 nmdc:mga08x19_133429_c1 3300050514 Bacteria 1672
566 nmdc:mga08x19_792243_c1 3300050514 Unclassified 673
567 Ga0495601_0060155 3300053077 Bacteria 2410
568 Ga0495612_0004132 3300053078 Bacteria 6012
569 Ga0495595_0199721 3300053084 Unclassified 995
570 Ga0495619_0000932 3300053085 Bacteria 19215
571 Ga0501084_0666117 3300054114 Unclassified 878
572 Ga0105245_10004897
573 SwRhRL3b_contig_2779551
574 SwRhRL3b_contig_4178110
575 JGI25406J46586_10083987
576 rootH1_10252652
577 Ga0058863_10013587
578 Ga0065704_10112719
579 Ga0065712_10383174
580 Ga0065707_10012500
581 Ga0070658_10326582
582 Ga0070676_10042342
583 Ga0070683_100015514
584 Ga0070683_100068498
585 Ga0070683_100075403
586 Ga0070683_100634850
587 Ga0070670_100162920
588 Ga0068869_100275106
589 Ga0068869_100381234
590 Ga0070666_10985885
591 Ga0070680_100593510
592 Ga0070682_100044294
593 Ga0070682_100252719
594 Ga0068868_100018233
595 Ga0070691_10020822
596 Ga0070661_100008470
597 Ga0070661_100073097
598 Ga0070661_100639310
599 Ga0070668_100283482
600 Ga0070675_100111661
601 Ga0070673_100008961
602 Ga0070709_10201518
603 Ga0070709_11129612
604 Ga0070714_100007726
605 Ga0070714_100052990
606 Ga0070714_100105576
607 Ga0070714_100267407
608 Ga0070713_100066976
609 Ga0070713_100108646
610 Ga0070713_100187238
611 Ga0070713_100392408
612 Ga0070713_100458190
613 Ga0070713_100605168
614 Ga0070713_100765451
615 Ga0070713_100802595
616 Ga0070710_10118591
617 Ga0070710_10325566
618 Ga0070710_10473375
619 Ga0070710_10829245
620 Ga0070711_100005541
621 Ga0070711_100227540
622 Ga0070711_100347595
623 Ga0070711_101499484
624 Ga0070711_101832205
625 Ga0070705_100000686
626 Ga0070700_101296392
627 Ga0070694_100000317
628 Ga0070708_100000002
629 Ga0070663_100593534
630 Ga0070678_100214333
631 Ga0070681_10232553
632 Ga0070681_10495743
633 Ga0070681_10619385
634 Ga0070706_100008336
635 Ga0070706_100771771
636 Ga0070707_100408915
637 Ga0070698_100006598
638 Ga0070698_100039870
639 Ga0070699_100000483
640 Ga0070699_101071784
641 Ga0070679_100858085
642 Ga0070684_100002219
643 Ga0070684_100051120
644 Ga0070684_100173565
645 Ga0070684_100271665
646 Ga0070684_100707427
647 Ga0070697_100100307
648 Ga0070697_101457022
649 Ga0068853_100024797
650 Ga0068853_100119048
651 Ga0068853_100161813
652 Ga0070672_100013140
653 Ga0070695_100000115
654 Ga0070696_100000303
655 Ga0070696_101385896
656 Ga0070693_100024674
657 Ga0070693_100214091
658 Ga0070693_100477723
659 Ga0068855_100002549
660 Ga0068855_100025864
661 Ga0068855_100033538
662 Ga0068855_100186640
663 Ga0068855_100398105
664 Ga0070664_100251654
665 Ga0070664_100815986
666 Ga0070664_100912571
667 Ga0068857_100080026
668 Ga0068857_100159055
669 Ga0068854_100027270
670 Ga0068854_100114794
671 Ga0068854_101908380
672 Ga0068856_100006613
673 Ga0068856_100009318
674 Ga0068856_100025597
675 Ga0068856_100078534
676 Ga0068856_100144230
677 Ga0068852_100001843
678 Ga0068852_100020336
679 Ga0068852_100603974
680 Ga0068852_101422290
681 Ga0068864_100438033
682 Ga0068861_100388891
683 Ga0068851_10000736
684 Ga0068851_10012540
685 Ga0068851_10190635
686 Ga0068863_100072097
687 Ga0068863_100954421
688 Ga0068858_100189495
689 Ga0068858_100405602
690 Ga0081539_10066233
691 Ga0070717_10075091
692 Ga0070717_10136240
693 Ga0070717_10208702
694 Ga0070717_10220828
695 Ga0070717_10268129
696 Ga0070715_10023807
697 Ga0070715_10222153
698 Ga0070715_10314846
699 Ga0070716_100041752
700 Ga0070716_100078516
701 Ga0070716_100547631
702 Ga0070712_100012073
703 Ga0070712_100025539
704 Ga0070712_100244153
705 Ga0070712_100361955
706 Ga0070712_100451029
707 Ga0070712_100833417
708 Ga0097621_100008852
709 Ga0097621_100522197
710 Ga0097621_101031654
711 Ga0075428_100000525
712 Ga0068865_100053870
713 Ga0075436_100059842
714 Ga0075436_100104009
715 Ga0075436_100117141
716 Ga0097620_100215981
717 Ga0075435_100396140
718 Ga0075435_100671236
719 Ga0099794_10116504
720 Ga0099795_10038816
721 Ga0099795_10160094
722 Ga0105240_10005609
723 Ga0105240_10008420
724 Ga0105240_10012468
725 Ga0105240_10049138
726 Ga0105240_10056796
727 Ga0105240_10097985
728 Ga0105240_10553235
729 Ga0105240_10581317
730 Ga0111539_10004636
731 Ga0105245_10060927
732 Ga0114129_10141105
733 Ga0105243_10041557
734 Ga0105241_10002177
735 Ga0105241_10012499
736 Ga0105241_10026448
737 Ga0105241_10141301
738 Ga0105241_10163331
739 Ga0105241_11333352
740 Ga0105241_11430642
741 Ga0105242_10309286
742 Ga0105248_10036210
743 Ga0105248_10084174
744 Ga0105248_11447876
745 Ga0105237_10005052
746 Ga0105237_10039685
747 Ga0105237_10607589
748 Ga0105238_10002314
749 Ga0105238_10005322
750 Ga0105238_10073878
751 Ga0105238_10088193
752 Ga0105238_10275050
753 Ga0105238_10401560
754 Ga0105238_10902892
755 Ga0105238_11724076
756 Ga0105239_10070267
757 Ga0105239_10214303
758 Ga0105239_10351620
759 Ga0105239_10536897
760 Ga0105239_12031306
761 Ga0105246_10131601
762 Ga0105246_10751747
763 Ga0105246_11435860
764 Ga0157373_10141774
765 Ga0157373_10165181
766 Ga0157371_10177506
767 Ga0157370_10651838
768 Ga0157369_10010048
769 Ga0157369_10020268
770 Ga0157369_10086408
771 Ga0157369_10261696
772 Ga0157369_10600323
773 Ga0157369_11063703
774 Ga0157374_10137119
775 Ga0157374_10433384
776 Ga0157374_10989266
777 Ga0157378_10061341
778 Ga0157378_10159129
779 Ga0163162_10947275
780 Ga0157372_10006091
781 Ga0157372_10006283
782 Ga0157372_10010207
783 Ga0157372_10065204
784 Ga0157372_10741487
785 Ga0157372_10914315
786 Ga0157372_10975130
787 Ga0157375_10169127
788 Ga0163163_10285932
789 Ga0157380_10149186
790 Ga0157379_10160465
791 Ga0157376_10136799
792 Ga0157376_10152685
793 Ga0157376_10361239
794 Ga0157376_11260403
795 Ga0163161_10016089
796 Ga0224712_10075945
797 Ga0228600_1004342
798 Ga0224572_1035591
799 Ga0207656_10036122
800 Ga0207656_10071848
801 Ga0207656_10178191
802 Ga0207692_10399378
803 Ga0207680_10155079
804 Ga0207685_10159137
805 Ga0207685_10409052
806 Ga0207699_10021419
807 Ga0207699_10145715
808 Ga0207699_10438524
809 Ga0207645_10057587
810 Ga0207705_11002375
811 Ga0207684_10006638
812 Ga0207654_10000639
813 Ga0207654_10094488
814 Ga0207654_10131843
815 Ga0207707_10038366
816 Ga0207707_10187647
817 Ga0207707_10465576
818 Ga0207695_10007206
819 Ga0207695_10048020
820 Ga0207695_10057772
821 Ga0207695_10109749
822 Ga0207695_10214636
823 Ga0207695_10383923
824 Ga0207695_10543717
825 Ga0207695_11247543
826 Ga0207671_10000388
827 Ga0207671_10282252
828 Ga0207671_10284445
829 Ga0207693_10003880
830 Ga0207693_10006076
831 Ga0207693_10009934
832 Ga0207693_10052056
833 Ga0207663_10003536
834 Ga0207663_10131321
835 Ga0207663_10238334
836 Ga0207663_10897956
837 Ga0207663_10938915
838 Ga0207660_10124793
839 Ga0207649_10028600
840 Ga0207649_10089907
841 Ga0207652_10766569
842 Ga0207646_10208000
843 Ga0207681_10436098
844 Ga0207694_10001625
845 Ga0207694_10182728
846 Ga0207694_10491408
847 Ga0207659_10239698
848 Ga0207687_10002392
849 Ga0207687_10112716
850 Ga0207700_10034377
851 Ga0207700_10071551
852 Ga0207700_10125864
853 Ga0207700_10226142
854 Ga0207700_10251409
855 Ga0207700_10699827
856 Ga0207700_10855217
857 Ga0207700_11495325
858 Ga0207664_10145404
859 Ga0207664_10445033
860 Ga0207664_10484779
861 Ga0207664_10549385
862 Ga0207644_10752244
863 Ga0207706_10004319
864 Ga0207686_10269700
865 Ga0207709_10011049
866 Ga0207665_10000103
867 Ga0207665_10011247
868 Ga0207665_10046269
869 Ga0207665_10069614
870 Ga0207665_10070254
871 Ga0207691_10006018
872 Ga0207711_10198601
873 Ga0207661_10010401
874 Ga0207661_10088795
875 Ga0207679_10133735
876 Ga0207679_11002035
877 Ga0207667_10010737
878 Ga0207667_10017875
879 Ga0207667_10027010
880 Ga0207667_10511984
881 Ga0207668_10749160
882 Ga0207640_10013029
883 Ga0207640_10319535
884 Ga0207640_10325067
885 Ga0207640_10392087
886 Ga0207677_10060843
887 Ga0207677_10127895
888 Ga0207639_10000064
889 Ga0207639_10044826
890 Ga0207639_10223648
891 Ga0207678_10359351
892 Ga0207708_11047197
893 Ga0207702_10015298
894 Ga0207702_10022455
895 Ga0207702_11122711
896 Ga0207641_10139122
897 Ga0207641_11095776
898 Ga0207676_11071442
899 Ga0207674_10096411
900 Ga0207674_10657725
901 Ga0207675_100518785
902 Ga0207683_10000490
903 Ga0207698_10001305
904 Ga0207698_10052450
905 Ga0207698_10148396
906 Ga0207698_10672602
907 Ga0207698_10699137
908 Ga0207698_11484255
909 Ga0209588_1036683
910 Ga0207428_10055006
911 Ga0268266_10240062
912 Ga0265323_10000163
913 Ga0265338_10139557
914 Ga0265338_10420583
915 Ga0265762_1000240
916 Ga0265760_10057661
917 Ga0265760_10084172
918 Ga0265330_10028575
919 Ga0265330_10061969
920 Ga0265330_10067307
921 Ga0265330_10246900
922 Ga0265332_10129780
923 Ga0265328_10247657
924 Ga0265325_10145736
925 Ga0265325_10239529
926 Ga0265339_10012622
927 Ga0265339_10112939
928 Ga0265331_10135982
929 Ga0265331_10332670
930 Ga0265316_10006547
931 Ga0265316_10504591
932 Ga0265314_10027735
933 Ga0265342_10040785
934 Ga0265342_10062056
935 Ga0265342_10106382
936 Ga0316215_1018454
937 Ga0373926_0000846
938 Ga0373926_0003233
939 Ga0373934_0001080
940 Ga0373944_0014214
941 Ga0373944_0036748
942 Ga0373923_0011965
943 Ga0373923_0020519
944 Ga0373923_0057652
945 Ga0373936_0003804
946 Ga0373936_0020060
947 Ga0373945_0037425
948 Ga0373954_0108888
949 Ga0373954_0323450
950 Ga0373956_0007699
951 Ga0373956_0088026
952 Ga0373956_0334637
953 Ga0373957_0003808
954 Ga0373957_0101802
955 Ga0373943_0002365
956 Ga0373943_0280518
957 Ga0373946_0003548
958 Ga0373946_0015880
959 Ga0373946_0037436
960 Ga0373946_0446778
961 Ga0373955_0000379
962 Ga0373955_0611565
963 Ga0373955_0670463
964 Ga0373924_0000669
965 Ga0373924_0000695
966 Ga0373924_0017614
967 Ga0373924_0061865
968 Ga0373931_0121968
969 Ga0373935_0005912
970 Ga0373935_0012581
971 Ga0373935_0161628
972 Ga0373927_0000220
973 Ga0373927_0129886
974 Ga0373933_0000317
975 Ga0373933_0034218
976 Ga0373933_0956143
977 Ga0373947_0003779
978 Ga0373947_0003925
979 Ga0373947_0364060
980 Ga0373937_0000711
981 Ga0373937_0008085
982 Ga0373937_0015905
983 Ga0373937_0107274
984 Ga0373937_0195248
985 Ga0373937_0541190
986 Ga0373937_1150255
987 Ga0373925_0004535
988 Ga0373925_0010701
989 Ga0373925_0058449
990 Ga0395898_0910824
991 Ga0395905_0116963
992 Ga0395905_0160196
993 Ga0436363_0064800
994 Ga0451853_3857372
995 Ga0451577_0295231
996 Ga0466969_0261696
997 Ga0466963_0535518
998 Ga0466957_0000039
999 Ga0466957_0957362
1000 Ga0466959_0090816
1001 Ga0451576_0089464
1002 Ga0451576_0142510
1003 Ga0466958_0515433
1004 Ga0466967_0233321
1005 Ga0466967_0248492
1006 Ga0495592_0002329
1007 Ga0495603_0001244
1008 Ga0495629_0017241
1009 Ga0495629_0022912
1010 Ga0495629_0158309
1011 Ga0495629_0197129
1012 Ga0495629_0325840
1013 Ga0495641_0233757
1014 Ga0495651_0001100
1015 Ga0495651_0405845
1016 Ga0495653_0000346
1017 Ga0495580_0013848
1018 Ga0495580_0072373
1019 Ga0495580_0125434
1020 Ga0495580_0472083
1021 Ga0495580_0508660
1022 Ga0495582_0038193
1023 Ga0495582_0062528
1024 Ga0495582_0124576
1025 Ga0495639_0001645
1026 Ga0495639_0045551
1027 Ga0495664_0150888
1028 Ga0495594_0411424
1029 Ga0495608_0000130
1030 Ga0495608_0123890
1031 Ga0495608_0137479
1032 Ga0495618_0159173
1033 Ga0495618_0303459
1034 Ga0495628_0001724
1035 Ga0495630_0009665
1036 Ga0495630_0022743
1037 Ga0495630_0040716
1038 Ga0495630_0104640
1039 Ga0495663_0009900
1040 Ga0495666_0355977
1041 Ga0495642_0031962
1042 Ga0495652_0000260
1043 Ga0495652_0713859
1044 Ga0495665_0091478
1045 Ga0495665_0153704
1046 Ga0495665_0222672
1047 Ga0495640_0140647
1048 Ga0495640_0494140
1049 Ga0495586_0056253
1050 Ga0495587_0000132
1051 Ga0495587_0145918
1052 Ga0495645_0002791
1053 Ga0495645_0017616
1054 Ga0495645_0091174
1055 Ga0495645_0329641
1056 Ga0495667_0000330
1057 Ga0495667_0116575
1058 Ga0495667_0486064
1059 Ga0495635_0000050
1060 Ga0495635_0230090
1061 Ga0495635_0594289
1062 Ga0495659_0076121
1063 Ga0495588_0005099
1064 Ga0495657_0000157
1065 Ga0495657_0062956
1066 Ga0495599_0001450
1067 Ga0495599_0239687
1068 Ga0495599_0773989
1069 Ga0495623_0002250
1070 Ga0495623_0084977
1071 Ga0495646_0000225
1072 Ga0495646_0311419
1073 Ga0495647_0101322
1074 Ga0495658_0007691
1075 Ga0495658_0198932
1076 Ga0495613_0003107
1077 Ga0495613_0009617
1078 Ga0495613_0026893
1079 Ga0495613_0074345
1080 Ga0495581_0005366
1081 Ga0495604_0000207
1082 Ga0495604_0705864
1083 Ga0495674_0003516
1084 Ga0495674_0059549
1085 Ga0495676_0245510
1086 Ga0495675_0000353
1087 Ga0495675_0166770
1088 Ga0495685_069268
1089 Ga0495684_0000160
1090 Ga0495684_0029995
1091 Ga0495684_0155021
1092 Ga0495593_0001372
1093 Ga0495593_0088194
1094 Ga0495593_0386326
1095 Ga0495602_0001852
1096 Ga0495602_0544237
1097 Ga0495614_0002026
1098 Ga0495614_0095031
1099 Ga0496100_0029519
1100 Ga0496100_0446177
1101 Ga0496101_0158719
1102 Ga0496102_0019733
1103 Ga0496102_1854855
1104 Ga0496103_0499433
1105 Ga0496104_0011136
1106 Ga0496104_0020528
1107 Ga0496104_0080276
1108 Ga0496104_1293363
1109 Ga0496105_0001167
1110 Ga0496105_0044122
1111 Ga0496105_0243319
1112 Ga0496105_0260378
1113 Ga0496106_0068670
1114 Ga0496106_0174140
1115 Ga0496110_0394022
1116 Ga0496110_0499063
1117 Ga0496110_0574542
1118 Ga0496110_1435503
1119 Ga0496111_0708950
1120 Ga0496112_0096782
1121 Ga0496112_0107096
1122 Ga0496113_0000557
1123 Ga0496114_0055326
1124 Ga0496114_0396847
1125 Ga0496115_0062821
1126 Ga0496115_0488901
1127 Ga0496115_0613899
1128 Ga0496115_0741963
1129 Ga0501073_0127063
1130 Ga0501079_0561633
1131 Ga0501044_1511772
1132 nmdc:mga05p37_461085_c1
1133 nmdc:mga08y16_1895_c1
1134 nmdc:mga0rr50_275934_c1
1135 nmdc:mga08x19_1223_c1
1136 nmdc:mga08x19_133429_c1
1137 nmdc:mga08x19_792243_c1
1138 Ga0495601_0060155
1139 Ga0495612_0004132
1140 Ga0495595_0199721
1141 Ga0495619_0000932
1142 Ga0501084_0666117

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.8096 3 126
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8006 15 135
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.7978 1 128
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.7962 1 126
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7823 8 131
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8156 3 127 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7894 1 128 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.76 14 135 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7459 5 125 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7342 1 126 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V8SH48-F1-model_v4 DinB-like domain-containing protein 0.9956 4 158
AF-A0A2V9YUY0-F1-model_v4 DinB-like domain-containing protein 0.9942 8 158
AF-A0A1Q8BNA3-F1-model_v4 DinB-like domain-containing protein 0.993 2 158
AF-A0A2V7V500-F1-model_v4 DinB-like domain-containing protein 0.9917 3 158
AF-A0A537JVW4-F1-model_v4 DinB family protein 0.9879 1 120

Map