F464908

General Info

Members Datasets Scaffolds Average Seq Length
571 224 1050 112

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_101550017|Ga0068869_1015500172
Length 114
Sequence MDTEAIQIIKLIASGLPYLAIVVALGVGGSLLSTWLKIKNGYPISSSWGIPMHPKGDREAAERIKLLTNENAKLRTEIKSVTDRLANVERIVTDQPSRLMRDIDALAIDKEGTR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
176 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
212 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
218 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
221 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
222 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
223 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
224 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.35
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0
Rhizoplane 3.15
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 7.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_101550017 3300005334 Bacteria 589
2 JGI24740J21852_10006386 3300001979 Bacteria 4887
3 JGI24740J21852_10055235 3300001979 Bacteria 1118
4 JGI24739J22299_10000378 3300001989 Bacteria 15359
5 JGI24739J22299_10023939 3300001989 Unclassified 2155
6 JGI24737J22298_10000438 3300001990 Bacteria 14246
7 JGI24737J22298_10001085 3300001990 Bacteria 9564
8 JGI24737J22298_10001931 3300001990 Bacteria 7414
9 JGI24737J22298_10003378 3300001990 Bacteria 5643
10 JGI24735J21928_10026590 3300002067 Bacteria 1738
11 JGI24750J21931_1086221 3300002070 Bacteria 527
12 JGI24738J21930_10003426 3300002075 Bacteria 4002
13 JGI24035J26624_1001446 3300002126 Bacteria 2244
14 Ga0065712_10096286 3300005290 Bacteria 2188
15 Ga0070658_10003538 3300005327 Bacteria 12823
16 Ga0070658_10104808 3300005327 Bacteria 2340
17 Ga0070658_10117065 3300005327 Bacteria 2212
18 Ga0070658_10155221 3300005327 Archaea 1918
19 Ga0070658_10230811 3300005327 Bacteria 1567
20 Ga0070658_10783061 3300005327 Bacteria 828
21 Ga0070658_11315729 3300005327 Bacteria 628
22 Ga0070658_11350954 3300005327 Bacteria 619
23 Ga0070658_11410158 3300005327 Unclassified 604
24 Ga0070676_10005815 3300005328 Bacteria 6575
25 Ga0070676_10132106 3300005328 Bacteria 1580
26 Ga0070683_100005945 3300005329 Bacteria 10211
27 Ga0070690_100057917 3300005330 Bacteria 2487
28 Ga0070690_100157438 3300005330 Bacteria 1554
29 Ga0070670_100002725 3300005331 Bacteria 14599
30 Ga0070670_100034717 3300005331 Bacteria 4340
31 Ga0070670_100065445 3300005331 Bacteria 3119
32 Ga0070670_100994455 3300005331 Bacteria 763
33 Ga0068869_100000728 3300005334 Bacteria 18720
34 Ga0070666_10000623 3300005335 Bacteria 21258
35 Ga0070666_10033780 3300005335 Bacteria 3387
36 Ga0070680_101712779 3300005336 Unclassified 545
37 Ga0070682_100012598 3300005337 Bacteria 4851
38 Ga0068868_100006361 3300005338 Bacteria 8354
39 Ga0068868_100645563 3300005338 Bacteria 942
40 Ga0070660_100000560 3300005339 Bacteria 24966
41 Ga0070660_100233247 3300005339 Unclassified 1497
42 Ga0070660_100298812 3300005339 Bacteria 1320
43 Ga0070660_100557161 3300005339 Bacteria 956
44 Ga0070660_100618015 3300005339 Unclassified 907
45 Ga0070660_101556080 3300005339 Bacteria 562
46 Ga0070660_101643002 3300005339 Bacteria 547
47 Ga0070660_101932395 3300005339 Unclassified 503
48 Ga0070689_100129460 3300005340 Bacteria 2023
49 Ga0070661_100000075 3300005344 Bacteria 79164
50 Ga0070661_100012615 3300005344 Bacteria 5913
51 Ga0070661_100053915 3300005344 Bacteria 2945
52 Ga0070661_100845167 3300005344 Bacteria 753
53 Ga0070661_100865048 3300005344 Bacteria 745
54 Ga0070692_10611819 3300005345 Bacteria 722
55 Ga0070668_100238951 3300005347 Unclassified 1504
56 Ga0070669_100000565 3300005353 Bacteria 27565
57 Ga0070669_100239061 3300005353 Bacteria 1442
58 Ga0070669_100573039 3300005353 Bacteria 943
59 Ga0070675_100043992 3300005354 Bacteria 3652
60 Ga0070675_100719424 3300005354 Unclassified 910
61 Ga0070675_101645997 3300005354 Unclassified 592
62 Ga0070671_100040800 3300005355 Bacteria 3856
63 Ga0070671_100062925 3300005355 Bacteria 3089
64 Ga0070671_101653758 3300005355 Bacteria 568
65 Ga0070674_100010817 3300005356 Bacteria 5533
66 Ga0070674_100542519 3300005356 Bacteria 974
67 Ga0070673_100010306 3300005364 Bacteria 6321
68 Ga0070673_101539176 3300005364 Bacteria 628
69 Ga0070659_100004211 3300005366 Bacteria 10269
70 Ga0070659_100004345 3300005366 Bacteria 10118
71 Ga0070659_100010071 3300005366 Bacteria 6960
72 Ga0070659_100068069 3300005366 Bacteria 2824
73 Ga0070659_100189959 3300005366 Bacteria 1688
74 Ga0070659_100321637 3300005366 Bacteria 1293
75 Ga0070659_100330303 3300005366 Unclassified 1276
76 Ga0070659_101215312 3300005366 Bacteria 667
77 Ga0070659_101485069 3300005366 Bacteria 604
78 Ga0070667_100002091 3300005367 Bacteria 17620
79 Ga0070667_100091190 3300005367 Bacteria 2620
80 Ga0070667_100114429 3300005367 Bacteria 2342
81 Ga0070714_100455907 3300005435 Bacteria 1215
82 Ga0070714_101970003 3300005435 Bacteria 570
83 Ga0070701_11141507 3300005438 Bacteria 550
84 Ga0070700_101026994 3300005441 Bacteria 679
85 Ga0070663_100004025 3300005455 Bacteria 8576
86 Ga0070663_100049278 3300005455 Bacteria 2990
87 Ga0070663_100096689 3300005455 Bacteria 2197
88 Ga0070678_101060444 3300005456 Bacteria 747
89 Ga0070662_100003155 3300005457 Bacteria 10241
90 Ga0070662_100003479 3300005457 Bacteria 9817
91 Ga0070662_100017276 3300005457 Bacteria 4861
92 Ga0070662_100188363 3300005457 Unclassified 1630
93 Ga0068867_100008041 3300005459 Bacteria 7453
94 Ga0068867_100122997 3300005459 Bacteria 2007
95 Ga0070685_10237222 3300005466 Unclassified 1202
96 Ga0070684_100097876 3300005535 Bacteria 2617
97 Ga0068853_100006609 3300005539 Bacteria 9230
98 Ga0068853_100032999 3300005539 Bacteria 4389
99 Ga0068853_101291893 3300005539 Bacteria 705
100 Ga0070672_100061279 3300005543 Bacteria 2965
101 Ga0070672_100089143 3300005543 Bacteria 2485
102 Ga0070693_100019899 3300005547 Bacteria 3530
103 Ga0070665_100005836 3300005548 Bacteria 12629
104 Ga0070665_100027367 3300005548 Bacteria 5744
105 Ga0070665_100382244 3300005548 Bacteria 1415
106 Ga0070665_100925679 3300005548 Bacteria 884
107 Ga0068855_100002720 3300005563 Bacteria 21788
108 Ga0068855_100054360 3300005563 Bacteria 4706
109 Ga0068855_100294384 3300005563 Bacteria 1799
110 Ga0068855_101005715 3300005563 Bacteria 876
111 Ga0068855_102382175 3300005563 Bacteria 528
112 Ga0070664_100004841 3300005564 Bacteria 10784
113 Ga0070664_100148690 3300005564 Bacteria 2067
114 Ga0070664_100809911 3300005564 Bacteria 876
115 Ga0070664_101197154 3300005564 Bacteria 717
116 Ga0070664_101991089 3300005564 Unclassified 551
117 Ga0068857_100002337 3300005577 Bacteria 15430
118 Ga0068857_100011311 3300005577 Bacteria 7764
119 Ga0068857_101287420 3300005577 Bacteria 709
120 Ga0068854_100028696 3300005578 Bacteria 3847
121 Ga0068854_100116632 3300005578 Unclassified 2021
122 Ga0068854_100225714 3300005578 Bacteria 1484
123 Ga0068854_100237794 3300005578 Bacteria 1449
124 Ga0068856_100000538 3300005614 Bacteria 41802
125 Ga0068856_100112232 3300005614 Bacteria 2723
126 Ga0068856_100230506 3300005614 Bacteria 1867
127 Ga0068856_100246487 3300005614 Bacteria 1802
128 Ga0068856_101258322 3300005614 Bacteria 756
129 Ga0070702_100177155 3300005615 Bacteria 1392
130 Ga0068852_100001259 3300005616 Bacteria 16883
131 Ga0068852_100053492 3300005616 Bacteria 3475
132 Ga0068852_100260972 3300005616 Bacteria 1663
133 Ga0068852_100706425 3300005616 Bacteria 1018
134 Ga0068859_100060129 3300005617 Bacteria 3829
135 Ga0068859_102924392 3300005617 Unclassified 523
136 Ga0068864_100001241 3300005618 Bacteria 21225
137 Ga0068864_100010872 3300005618 Bacteria 7524
138 Ga0068864_100080885 3300005618 Bacteria 2847
139 Ga0068866_10055233 3300005718 Bacteria 2039
140 Ga0068861_100717386 3300005719 Bacteria 931
141 Ga0068851_10009861 3300005834 Bacteria 4448
142 Ga0068870_10674752 3300005840 Bacteria 710
143 Ga0068863_100008879 3300005841 Bacteria 9813
144 Ga0068863_100293271 3300005841 Bacteria 1577
145 Ga0068858_100050928 3300005842 Bacteria 3832
146 Ga0068858_100181733 3300005842 Bacteria 1986
147 Ga0068858_101875986 3300005842 Unclassified 592
148 Ga0068860_100070910 3300005843 Bacteria 3312
149 Ga0068860_100243529 3300005843 Bacteria 1749
150 Ga0068860_100548700 3300005843 Bacteria 1158
151 Ga0068860_101104620 3300005843 Bacteria 812
152 Ga0068860_101317612 3300005843 Unclassified 743
153 Ga0068862_101414856 3300005844 Bacteria 699
154 Ga0075362_10185252 3300006177 Unclassified 1010
155 Ga0075366_10064254 3300006195 Bacteria 2183
156 Ga0075366_10156186 3300006195 Bacteria 1382
157 Ga0097621_100501650 3300006237 Bacteria 1099
158 Ga0075370_10374496 3300006353 Bacteria 852
159 Ga0068871_100314255 3300006358 Bacteria 1378
160 Ga0068871_100770893 3300006358 Unclassified 885
161 Ga0068865_100005554 3300006881 Bacteria 7648
162 Ga0097620_100060129 3300006931 Bacteria 3829
163 Ga0097620_102923561 3300006931 Unclassified 523
164 Ga0105240_10251421 3300009093 Unclassified 2044
165 Ga0105245_10000782 3300009098 Bacteria 28837
166 Ga0105243_10128177 3300009148 Bacteria 2149
167 Ga0105241_10060615 3300009174 Bacteria 2911
168 Ga0105241_10384031 3300009174 Bacteria 1228
169 Ga0105242_10208097 3300009176 Bacteria 1741
170 Ga0105248_10000443 3300009177 Bacteria 47083
171 Ga0105248_10003845 3300009177 Bacteria 16630
172 Ga0105248_10101834 3300009177 Bacteria 3237
173 Ga0105248_10681596 3300009177 Bacteria 1160
174 Ga0105248_12025696 3300009177 Bacteria 654
175 Ga0105238_10079835 3300009551 Bacteria 3261
176 Ga0105239_10020946 3300010375 Bacteria 7213
177 Ga0105246_10007706 3300011119 Bacteria 6605
178 Ga0105246_10097921 3300011119 Bacteria 2130
179 Ga0157373_10042025 3300013100 Bacteria 3268
180 Ga0157373_10050093 3300013100 Bacteria 2975
181 Ga0157373_10060575 3300013100 Bacteria 2681
182 Ga0157373_10973855 3300013100 Unclassified 632
183 Ga0157371_10005198 3300013102 Bacteria 11066
184 Ga0157371_10008659 3300013102 Bacteria 8083
185 Ga0157371_10058334 3300013102 Bacteria 2738
186 Ga0157371_10402067 3300013102 Unclassified 1002
187 Ga0157371_10741771 3300013102 Bacteria 737
188 Ga0157371_11004210 3300013102 Bacteria 637
189 Ga0157371_11226065 3300013102 Bacteria 579
190 Ga0157370_10176867 3300013104 Bacteria 1983
191 Ga0157370_10990875 3300013104 Bacteria 761
192 Ga0157369_10151556 3300013105 Bacteria 2450
193 Ga0157369_10313943 3300013105 Bacteria 1630
194 Ga0157369_11743629 3300013105 Unclassified 633
195 Ga0157374_10104177 3300013296 Bacteria 2723
196 Ga0157374_10121425 3300013296 Bacteria 2522
197 Ga0157374_11081040 3300013296 Bacteria 822
198 Ga0157374_11704982 3300013296 Bacteria 655
199 Ga0157378_10022210 3300013297 Bacteria 5584
200 Ga0157378_11453793 3300013297 Bacteria 729
201 Ga0163162_10160585 3300013306 Bacteria 2369
202 Ga0163162_11555214 3300013306 Bacteria 754
203 Ga0157372_10197417 3300013307 Unclassified 2331
204 Ga0157372_10204285 3300013307 Bacteria 2289
205 Ga0157372_10599810 3300013307 Bacteria 1284
206 Ga0157372_10636881 3300013307 Bacteria 1242
207 Ga0157372_11213320 3300013307 Bacteria 871
208 Ga0157375_10115316 3300013308 Bacteria 2789
209 Ga0157375_12973265 3300013308 Unclassified 566
210 Ga0163163_10000058 3300014325 Bacteria 123478
211 Ga0163163_10177794 3300014325 Bacteria 2175
212 Ga0157380_11839815 3300014326 Bacteria 665
213 Ga0157377_10063203 3300014745 Bacteria 2120
214 Ga0157377_10171874 3300014745 Unclassified 1356
215 Ga0157379_10012614 3300014968 Bacteria 7382
216 Ga0157379_10147537 3300014968 Bacteria 2121
217 Ga0206350_11096168 3300020080 Bacteria 561
218 Ga0209257_1005674 3300025304 Bacteria 8604
219 Ga0207697_10003187 3300025315 Bacteria 8160
220 Ga0207656_10004042 3300025321 Bacteria 5090
221 Ga0207656_10145172 3300025321 Bacteria 1121
222 Ga0207642_10493520 3300025899 Bacteria 748
223 Ga0207688_10203916 3300025901 Bacteria 1187
224 Ga0207680_10012374 3300025903 Bacteria 4343
225 Ga0207680_10035996 3300025903 Bacteria 2848
226 Ga0207647_10013604 3300025904 Bacteria 5634
227 Ga0207647_10016767 3300025904 Bacteria 4991
228 Ga0207647_10047835 3300025904 Bacteria 2658
229 Ga0207647_10067163 3300025904 Bacteria 2174
230 Ga0207647_10085108 3300025904 Bacteria 1891
231 Ga0207645_10015526 3300025907 Bacteria 5057
232 Ga0207643_10125879 3300025908 Bacteria 1521
233 Ga0207705_10002347 3300025909 Bacteria 14636
234 Ga0207705_10089556 3300025909 Bacteria 2252
235 Ga0207705_10103475 3300025909 Bacteria 2097
236 Ga0207705_10174512 3300025909 Bacteria 1620
237 Ga0207705_10299218 3300025909 Bacteria 1234
238 Ga0207705_10496941 3300025909 Unclassified 947
239 Ga0207705_10865480 3300025909 Bacteria 701
240 Ga0207705_10914860 3300025909 Bacteria 679
241 Ga0207705_10973361 3300025909 Unclassified 656
242 Ga0207705_11323001 3300025909 Unclassified 550
243 Ga0207654_10069321 3300025911 Unclassified 2089
244 Ga0207654_10082082 3300025911 Bacteria 1943
245 Ga0207695_10038233 3300025913 Bacteria 5169
246 Ga0207695_10600691 3300025913 Bacteria 981
247 Ga0207660_11230233 3300025917 Bacteria 609
248 Ga0207657_10000126 3300025919 Bacteria 76430
249 Ga0207657_10009347 3300025919 Bacteria 9867
250 Ga0207657_10128352 3300025919 Bacteria 2080
251 Ga0207657_10435724 3300025919 Bacteria 1029
252 Ga0207657_10436475 3300025919 Bacteria 1028
253 Ga0207657_11279539 3300025919 Unclassified 555
254 Ga0207649_10000937 3300025920 Bacteria 18258
255 Ga0207649_10004887 3300025920 Bacteria 7249
256 Ga0207649_10650346 3300025920 Bacteria 814
257 Ga0207652_10405992 3300025921 Bacteria 1229
258 Ga0207652_10706333 3300025921 Bacteria 899
259 Ga0207681_10010000 3300025923 Bacteria 5806
260 Ga0207681_10325184 3300025923 Bacteria 1224
261 Ga0207681_10353964 3300025923 Bacteria 1176
262 Ga0207694_10200517 3300025924 Bacteria 1623
263 Ga0207650_10003655 3300025925 Bacteria 10522
264 Ga0207650_10011665 3300025925 Bacteria 6054
265 Ga0207650_10032491 3300025925 Bacteria 3775
266 Ga0207659_10469907 3300025926 Bacteria 1061
267 Ga0207659_11659972 3300025926 Unclassified 545
268 Ga0207687_10013795 3300025927 Bacteria 5278
269 Ga0207644_10012689 3300025931 Bacteria 5601
270 Ga0207644_10068554 3300025931 Bacteria 2588
271 Ga0207690_10000106 3300025932 Bacteria 67786
272 Ga0207690_10006739 3300025932 Bacteria 6808
273 Ga0207690_10021928 3300025932 Bacteria 3967
274 Ga0207690_10069367 3300025932 Bacteria 2425
275 Ga0207690_10752391 3300025932 Bacteria 803
276 Ga0207690_10773564 3300025932 Bacteria 792
277 Ga0207690_10825599 3300025932 Unclassified 767
278 Ga0207690_10880787 3300025932 Bacteria 742
279 Ga0207706_10000151 3300025933 Bacteria 76455
280 Ga0207706_10005896 3300025933 Bacteria 11395
281 Ga0207706_10029147 3300025933 Bacteria 4928
282 Ga0207670_10113380 3300025936 Bacteria 1958
283 Ga0207669_10009539 3300025937 Bacteria 4631
284 Ga0207669_10094289 3300025937 Bacteria 1958
285 Ga0207704_10006757 3300025938 Bacteria 5376
286 Ga0207691_10007770 3300025940 Bacteria 10327
287 Ga0207691_10134197 3300025940 Bacteria 2185
288 Ga0207711_10001912 3300025941 Bacteria 18916
289 Ga0207711_10004040 3300025941 Bacteria 12594
290 Ga0207711_10020785 3300025941 Bacteria 5477
291 Ga0207711_10279823 3300025941 Bacteria 1536
292 Ga0207689_10000167 3300025942 Bacteria 57116
293 Ga0207689_11567860 3300025942 Bacteria 549
294 Ga0207661_10006497 3300025944 Bacteria 8265
295 Ga0207661_11169757 3300025944 Bacteria 708
296 Ga0207679_10002382 3300025945 Bacteria 11568
297 Ga0207679_10475078 3300025945 Bacteria 1112
298 Ga0207667_10002108 3300025949 Bacteria 24944
299 Ga0207667_10042138 3300025949 Bacteria 4854
300 Ga0207667_10284484 3300025949 Bacteria 1690
301 Ga0207651_10009127 3300025960 Bacteria 5402
302 Ga0207668_10071748 3300025972 Bacteria 2475
303 Ga0207640_10025143 3300025981 Bacteria 3601
304 Ga0207640_10035980 3300025981 Bacteria 3104
305 Ga0207640_10077650 3300025981 Bacteria 2258
306 Ga0207640_10249811 3300025981 Bacteria 1376
307 Ga0207658_10002624 3300025986 Bacteria 13051
308 Ga0207658_10029117 3300025986 Bacteria 3896
309 Ga0207677_10043649 3300026023 Bacteria 2982
310 Ga0207703_10115143 3300026035 Bacteria 2300
311 Ga0207703_10156311 3300026035 Bacteria 1993
312 Ga0207639_10000573 3300026041 Bacteria 25324
313 Ga0207639_10002893 3300026041 Bacteria 11542
314 Ga0207639_11025388 3300026041 Bacteria 773
315 Ga0207678_10006756 3300026067 Bacteria 10174
316 Ga0207678_10010888 3300026067 Bacteria 7992
317 Ga0207678_10040488 3300026067 Bacteria 4041
318 Ga0207678_10044567 3300026067 Bacteria 3837
319 Ga0207678_10570384 3300026067 Bacteria 991
320 Ga0207702_10001045 3300026078 Bacteria 28350
321 Ga0207702_10092718 3300026078 Bacteria 2648
322 Ga0207702_10226895 3300026078 Bacteria 1743
323 Ga0207702_10647226 3300026078 Bacteria 1039
324 Ga0207702_11381153 3300026078 Bacteria 698
325 Ga0207641_10006636 3300026088 Bacteria 9715
326 Ga0207641_12604265 3300026088 Bacteria 504
327 Ga0207648_10001222 3300026089 Bacteria 28812
328 Ga0207648_10016014 3300026089 Bacteria 6869
329 Ga0207676_10007892 3300026095 Bacteria 7571
330 Ga0207676_10016650 3300026095 Bacteria 5325
331 Ga0207676_10031648 3300026095 Bacteria 3980
332 Ga0207676_10107859 3300026095 Bacteria 2323
333 Ga0207676_10251030 3300026095 Bacteria 1592
334 Ga0207676_11417808 3300026095 Bacteria 691
335 Ga0207674_10002073 3300026116 Bacteria 25416
336 Ga0207674_10003779 3300026116 Bacteria 18470
337 Ga0207674_10635407 3300026116 Bacteria 1031
338 Ga0207675_100045075 3300026118 Bacteria 4120
339 Ga0207698_10002899 3300026142 Bacteria 10260
340 Ga0207698_10026332 3300026142 Bacteria 4113
341 Ga0207698_10049615 3300026142 Bacteria 3196
342 Ga0207698_10530824 3300026142 Bacteria 1150
343 Ga0268266_10000950 3300028379 Bacteria 36937
344 Ga0268266_10017332 3300028379 Bacteria 6147
345 Ga0268266_10828334 3300028379 Bacteria 894
346 Ga0307515_10359232 3300028794 Bacteria 1099
347 Ga0307408_100081935 3300031548 Bacteria 2414
348 Ga0307405_10115273 3300031731 Bacteria 1828
349 Ga0307413_10033984 3300031824 Bacteria 2909
350 Ga0307413_11081818 3300031824 Bacteria 691
351 Ga0307413_11253256 3300031824 Bacteria 647
352 Ga0307410_10015921 3300031852 Bacteria 4470
353 Ga0307410_10426408 3300031852 Bacteria 1077
354 Ga0307407_10979547 3300031903 Bacteria 652
355 Ga0307412_10269777 3300031911 Bacteria 1331
356 Ga0307409_100007295 3300031995 Bacteria 6600
357 Ga0307409_101047440 3300031995 Bacteria 835
358 Ga0307416_100011123 3300032002 Bacteria 5985
359 Ga0307416_102897196 3300032002 Bacteria 574
360 Ga0307414_10019348 3300032004 Bacteria 4217
361 Ga0307414_10276570 3300032004 Bacteria 1409
362 Ga0307411_10006880 3300032005 Bacteria 5733
363 Ga0307411_10196236 3300032005 Bacteria 1546
364 Ga0307411_10647321 3300032005 Bacteria 914
365 Ga0307415_100001290 3300032126 Bacteria 11817
366 Ga0307415_100049467 3300032126 Bacteria 2843
367 Ga0373951_0141259 3300035091 Bacteria 669
368 Ga0373939_0027810 3300035114 Bacteria 1605
369 Ga0373943_0007352 3300035170 Bacteria 4945
370 Ga0373946_0016959 3300035171 Bacteria 2781
371 Ga0373942_0126811 3300035207 Bacteria 802
372 Ga0373962_0048664 3300035242 Bacteria 1216
373 Ga0373931_0308469 3300035691 Bacteria 979
374 Ga0373935_0420357 3300035692 Bacteria 962
375 Ga0373927_0057767 3300035695 Bacteria 2509
376 Ga0373925_0033179 3300037068 Bacteria 3805
377 Ga0395899_0025167 3300037312 Bacteria 4495
378 Ga0395899_0030099 3300037312 Bacteria 4084
379 Ga0395899_0054789 3300037312 Bacteria 2950
380 Ga0395899_0089925 3300037312 Bacteria 2226
381 Ga0395899_0410681 3300037312 Bacteria 894
382 Ga0395899_0476198 3300037312 Bacteria 814
383 Ga0395900_0007724 3300037418 Bacteria 11091
384 Ga0395900_0022607 3300037418 Bacteria 6435
385 Ga0395900_0027275 3300037418 Bacteria 5848
386 Ga0395900_0033836 3300037418 Bacteria 5259
387 Ga0395900_0073120 3300037418 Bacteria 3524
388 Ga0395900_0085076 3300037418 Bacteria 3250
389 Ga0395900_0108524 3300037418 Bacteria 2851
390 Ga0395900_0131992 3300037418 Bacteria 2559
391 Ga0395900_0196244 3300037418 Bacteria 2045
392 Ga0395900_0206376 3300037418 Bacteria 1986
393 Ga0395900_0273050 3300037418 Bacteria 1685
394 Ga0395900_0401685 3300037418 Bacteria 1334
395 Ga0395900_0408822 3300037418 Bacteria 1320
396 Ga0395900_0458836 3300037418 Bacteria 1229
397 Ga0395900_0922985 3300037418 Bacteria 795
398 Ga0395900_1326620 3300037418 Bacteria 633
399 Ga0395900_1812479 3300037418 Bacteria 521
400 Ga0395898_0008927 3300037466 Bacteria 10558
401 Ga0395898_0016010 3300037466 Bacteria 7680
402 Ga0395898_0055058 3300037466 Bacteria 3880
403 Ga0395898_0199573 3300037466 Bacteria 1910
404 Ga0395898_0251225 3300037466 Bacteria 1686
405 Ga0395898_0300269 3300037466 Bacteria 1532
406 Ga0395898_0588861 3300037466 Bacteria 1055
407 Ga0395898_0932874 3300037466 Bacteria 805
408 Ga0395898_1733103 3300037466 Bacteria 547
409 Ga0395905_0009247 3300037471 Bacteria 9646
410 Ga0395905_0010012 3300037471 Bacteria 9241
411 Ga0395905_0014735 3300037471 Bacteria 7455
412 Ga0395905_0040657 3300037471 Bacteria 4362
413 Ga0395905_0058199 3300037471 Bacteria 3614
414 Ga0395905_0102517 3300037471 Bacteria 2686
415 Ga0395905_0113152 3300037471 Bacteria 2549
416 Ga0395905_0123225 3300037471 Bacteria 2437
417 Ga0395905_0219643 3300037471 Bacteria 1779
418 Ga0395905_0254464 3300037471 Bacteria 1640
419 Ga0395905_0592483 3300037471 Bacteria 1010
420 Ga0395905_1035231 3300037471 Bacteria 724
421 Ga0395905_1147405 3300037471 Bacteria 680
422 Ga0436364_0219673 3300037853 Bacteria 931
423 Ga0436364_0755345 3300037853 Bacteria 36897
424 Ga0395901_0006189 3300038443 Bacteria 12126
425 Ga0395901_0007713 3300038443 Bacteria 10854
426 Ga0395901_0023864 3300038443 Bacteria 6273
427 Ga0395901_0025512 3300038443 Bacteria 6068
428 Ga0395901_0035010 3300038443 Bacteria 5188
429 Ga0395901_0043349 3300038443 Bacteria 4668
430 Ga0395901_0044592 3300038443 Bacteria 4599
431 Ga0395901_0048833 3300038443 Bacteria 4395
432 Ga0395901_0167363 3300038443 Bacteria 2307
433 Ga0395901_0284858 3300038443 Bacteria 1716
434 Ga0395901_0428250 3300038443 Unclassified 1356
435 Ga0395901_0582015 3300038443 Bacteria 1131
436 Ga0395901_1213635 3300038443 Bacteria 719
437 Ga0451798_1147024 3300041458 Bacteria 751
438 Ga0439445_0020157 3300042004 Bacteria 1667
439 Ga0439448_0004253 3300042005 Bacteria 4035
440 Ga0439432_044624 3300042006 Bacteria 1396
441 Ga0439449_0047741 3300042007 Bacteria 1585
442 Ga0439455_0151325 3300042012 Bacteria 660
443 Ga0439457_062596 3300042014 Bacteria 844
444 Ga0450923_016796 3300042125 Bacteria 1383
445 Ga0450923_196282 3300042125 Bacteria 501
446 Ga0450898_089057 3300042134 Bacteria 635
447 Ga0439458_0000154 3300042157 Bacteria 15118
448 Ga0439458_0000268 3300042157 Bacteria 12769
449 Ga0466969_0342983 3300044656 Bacteria 676
450 Ga0466972_0086811 3300044658 Bacteria 1487
451 Ga0466965_0698772 3300044683 Bacteria 582
452 Ga0466965_0823072 3300044683 Unclassified 538
453 Ga0466966_0102477 3300044684 Bacteria 1769
454 Ga0466963_0011810 3300044694 Bacteria 5328
455 Ga0466963_0016999 3300044694 Bacteria 4531
456 Ga0466963_0874574 3300044694 Bacteria 633
457 Ga0466963_1228140 3300044694 Unclassified 526
458 Ga0466964_0478975 3300044706 Bacteria 665
459 Ga0466970_0038621 3300044765 Bacteria 2533
460 Ga0466970_0062943 3300044765 Bacteria 1989
461 Ga0466957_0062554 3300044842 Bacteria 2286
462 Ga0466957_0103080 3300044842 Bacteria 1801
463 Ga0466957_0239652 3300044842 Bacteria 1203
464 Ga0466957_0339745 3300044842 Bacteria 1017
465 Ga0466957_0363780 3300044842 Bacteria 984
466 Ga0466957_0915841 3300044842 Bacteria 627
467 Ga0466959_0206105 3300045049 Bacteria 1368
468 Ga0466967_0007211 3300045976 Bacteria 7988
469 Ga0466967_0034787 3300045976 Bacteria 4281
470 Ga0466967_0186458 3300045976 Bacteria 1959
471 Ga0466967_0210844 3300045976 Bacteria 1842
472 Ga0466967_0308512 3300045976 Bacteria 1524
473 Ga0466967_0371621 3300045976 Bacteria 1387
474 Ga0466967_0584268 3300045976 Bacteria 1101
475 Ga0466967_0718956 3300045976 Bacteria 990
476 Ga0466967_1650810 3300045976 Bacteria 638
477 Ga0495597_0016597 3300046542 Bacteria 3477
478 Ga0495668_0209510 3300046616 Bacteria 1067
479 Ga0495668_0564200 3300046616 Bacteria 628
480 Ga0495625_0042984 3300046660 Bacteria 3280
481 Ga0495669_0085688 3300046684 Bacteria 1450
482 Ga0495670_0000066 3300046691 Bacteria 46500
483 Ga0496101_0318541 3300048904 Bacteria 1220
484 Ga0496106_1246089 3300048909 Bacteria 579
485 Ga0496107_0186800 3300048910 Bacteria 1539
486 Ga0496107_0721599 3300048910 Bacteria 732
487 Ga0496108_0145985 3300048911 Bacteria 2040
488 Ga0496109_0191881 3300048912 Bacteria 1920
489 Ga0496109_0692541 3300048912 Bacteria 956
490 Ga0496109_1665466 3300048912 Bacteria 572
491 Ga0496109_1856184 3300048912 Bacteria 535
492 Ga0496110_0061180 3300048913 Bacteria 3323
493 Ga0496110_0102725 3300048913 Bacteria 2564
494 Ga0496110_0644424 3300048913 Bacteria 959
495 Ga0496110_1649394 3300048913 Bacteria 551
496 Ga0496111_0158133 3300048914 Bacteria 1682
497 Ga0496111_0362500 3300048914 Bacteria 1073
498 Ga0496111_0487054 3300048914 Bacteria 908
499 Ga0496112_0475772 3300048915 Unclassified 1186
500 Ga0501295_183902 3300049518 Bacteria 525
501 Ga0501225_0058248 3300049705 Bacteria 1084
502 Ga0501269_052849 3300049766 Bacteria 562
503 nmdc:mga03683_185133_c1 3300050489 Unclassified 951
504 nmdc:mga0k408_159862_c1 3300050493 Bacteria 1342
505 nmdc:mga0k408_226820_c1 3300050493 Bacteria 1115
506 nmdc:mga07m45_122327_c1 3300050496 Bacteria 1503
507 Ga0500643_006643 3300053087 Bacteria 4804
508 Ga0500566_0000560 3300053094 Bacteria 20897
509 Ga0500650_0107524 3300053098 Bacteria 1303
510 Ga0500556_0000014 3300053104 Bacteria 232989
511 Ga0500557_113302 3300053105 Bacteria 900
512 Ga0500562_012077 3300053108 Bacteria 2194
513 Ga0500562_067615 3300053108 Bacteria 963
514 Ga0500642_0000001 3300053130 Bacteria 1468402
515 Ga0500652_231109 3300053131 Bacteria 740
516 Ga0500627_0147707 3300053158 Bacteria 1062
517 Ga0500645_006494 3300053730 Bacteria 4162
518 Ga0500596_058333 3300053735 Bacteria 642
519 Ga0587084_045075 3300059477 Bacteria 763
520 Ga0466962_0059360 3300061719 Bacteria 1826
521 2809065342 2808606401 Bacteria 4586670
522 2809081266 2808606404 Bacteria 4652788
523 2809085631 2808606405 Bacteria 4586632
524 2848297393 2848297114 Bacteria 3608511
525 2880520814 2880518877 Bacteria 5012590
526 Ga0068869_101550017
527 JGI24740J21852_10006386
528 JGI24740J21852_10055235
529 JGI24739J22299_10000378
530 JGI24739J22299_10023939
531 JGI24737J22298_10000438
532 JGI24737J22298_10001085
533 JGI24737J22298_10001931
534 JGI24737J22298_10003378
535 JGI24735J21928_10026590
536 JGI24750J21931_1086221
537 JGI24738J21930_10003426
538 JGI24035J26624_1001446
539 Ga0065712_10096286
540 Ga0070658_10003538
541 Ga0070658_10104808
542 Ga0070658_10117065
543 Ga0070658_10155221
544 Ga0070658_10230811
545 Ga0070658_10783061
546 Ga0070658_11315729
547 Ga0070658_11350954
548 Ga0070658_11410158
549 Ga0070676_10005815
550 Ga0070676_10132106
551 Ga0070683_100005945
552 Ga0070690_100057917
553 Ga0070690_100157438
554 Ga0070670_100002725
555 Ga0070670_100034717
556 Ga0070670_100065445
557 Ga0070670_100994455
558 Ga0068869_100000728
559 Ga0070666_10000623
560 Ga0070666_10033780
561 Ga0070680_101712779
562 Ga0070682_100012598
563 Ga0068868_100006361
564 Ga0068868_100645563
565 Ga0070660_100000560
566 Ga0070660_100233247
567 Ga0070660_100298812
568 Ga0070660_100557161
569 Ga0070660_100618015
570 Ga0070660_101556080
571 Ga0070660_101643002
572 Ga0070660_101932395
573 Ga0070689_100129460
574 Ga0070661_100000075
575 Ga0070661_100012615
576 Ga0070661_100053915
577 Ga0070661_100845167
578 Ga0070661_100865048
579 Ga0070692_10611819
580 Ga0070668_100238951
581 Ga0070669_100000565
582 Ga0070669_100239061
583 Ga0070669_100573039
584 Ga0070675_100043992
585 Ga0070675_100719424
586 Ga0070675_101645997
587 Ga0070671_100040800
588 Ga0070671_100062925
589 Ga0070671_101653758
590 Ga0070674_100010817
591 Ga0070674_100542519
592 Ga0070673_100010306
593 Ga0070673_101539176
594 Ga0070659_100004211
595 Ga0070659_100004345
596 Ga0070659_100010071
597 Ga0070659_100068069
598 Ga0070659_100189959
599 Ga0070659_100321637
600 Ga0070659_100330303
601 Ga0070659_101215312
602 Ga0070659_101485069
603 Ga0070667_100002091
604 Ga0070667_100091190
605 Ga0070667_100114429
606 Ga0070714_100455907
607 Ga0070714_101970003
608 Ga0070701_11141507
609 Ga0070700_101026994
610 Ga0070663_100004025
611 Ga0070663_100049278
612 Ga0070663_100096689
613 Ga0070678_101060444
614 Ga0070662_100003155
615 Ga0070662_100003479
616 Ga0070662_100017276
617 Ga0070662_100188363
618 Ga0068867_100008041
619 Ga0068867_100122997
620 Ga0070685_10237222
621 Ga0070684_100097876
622 Ga0068853_100006609
623 Ga0068853_100032999
624 Ga0068853_101291893
625 Ga0070672_100061279
626 Ga0070672_100089143
627 Ga0070693_100019899
628 Ga0070665_100005836
629 Ga0070665_100027367
630 Ga0070665_100382244
631 Ga0070665_100925679
632 Ga0068855_100002720
633 Ga0068855_100054360
634 Ga0068855_100294384
635 Ga0068855_101005715
636 Ga0068855_102382175
637 Ga0070664_100004841
638 Ga0070664_100148690
639 Ga0070664_100809911
640 Ga0070664_101197154
641 Ga0070664_101991089
642 Ga0068857_100002337
643 Ga0068857_100011311
644 Ga0068857_101287420
645 Ga0068854_100028696
646 Ga0068854_100116632
647 Ga0068854_100225714
648 Ga0068854_100237794
649 Ga0068856_100000538
650 Ga0068856_100112232
651 Ga0068856_100230506
652 Ga0068856_100246487
653 Ga0068856_101258322
654 Ga0070702_100177155
655 Ga0068852_100001259
656 Ga0068852_100053492
657 Ga0068852_100260972
658 Ga0068852_100706425
659 Ga0068859_100060129
660 Ga0068859_102924392
661 Ga0068864_100001241
662 Ga0068864_100010872
663 Ga0068864_100080885
664 Ga0068866_10055233
665 Ga0068861_100717386
666 Ga0068851_10009861
667 Ga0068870_10674752
668 Ga0068863_100008879
669 Ga0068863_100293271
670 Ga0068858_100050928
671 Ga0068858_100181733
672 Ga0068858_101875986
673 Ga0068860_100070910
674 Ga0068860_100243529
675 Ga0068860_100548700
676 Ga0068860_101104620
677 Ga0068860_101317612
678 Ga0068862_101414856
679 Ga0075362_10185252
680 Ga0075366_10064254
681 Ga0075366_10156186
682 Ga0097621_100501650
683 Ga0075370_10374496
684 Ga0068871_100314255
685 Ga0068871_100770893
686 Ga0068865_100005554
687 Ga0097620_100060129
688 Ga0097620_102923561
689 Ga0105240_10251421
690 Ga0105245_10000782
691 Ga0105243_10128177
692 Ga0105241_10060615
693 Ga0105241_10384031
694 Ga0105242_10208097
695 Ga0105248_10000443
696 Ga0105248_10003845
697 Ga0105248_10101834
698 Ga0105248_10681596
699 Ga0105248_12025696
700 Ga0105238_10079835
701 Ga0105239_10020946
702 Ga0105246_10007706
703 Ga0105246_10097921
704 Ga0157373_10042025
705 Ga0157373_10050093
706 Ga0157373_10060575
707 Ga0157373_10973855
708 Ga0157371_10005198
709 Ga0157371_10008659
710 Ga0157371_10058334
711 Ga0157371_10402067
712 Ga0157371_10741771
713 Ga0157371_11004210
714 Ga0157371_11226065
715 Ga0157370_10176867
716 Ga0157370_10990875
717 Ga0157369_10151556
718 Ga0157369_10313943
719 Ga0157369_11743629
720 Ga0157374_10104177
721 Ga0157374_10121425
722 Ga0157374_11081040
723 Ga0157374_11704982
724 Ga0157378_10022210
725 Ga0157378_11453793
726 Ga0163162_10160585
727 Ga0163162_11555214
728 Ga0157372_10197417
729 Ga0157372_10204285
730 Ga0157372_10599810
731 Ga0157372_10636881
732 Ga0157372_11213320
733 Ga0157375_10115316
734 Ga0157375_12973265
735 Ga0163163_10000058
736 Ga0163163_10177794
737 Ga0157380_11839815
738 Ga0157377_10063203
739 Ga0157377_10171874
740 Ga0157379_10012614
741 Ga0157379_10147537
742 Ga0206350_11096168
743 Ga0209257_1005674
744 Ga0207697_10003187
745 Ga0207656_10004042
746 Ga0207656_10145172
747 Ga0207642_10493520
748 Ga0207688_10203916
749 Ga0207680_10012374
750 Ga0207680_10035996
751 Ga0207647_10013604
752 Ga0207647_10016767
753 Ga0207647_10047835
754 Ga0207647_10067163
755 Ga0207647_10085108
756 Ga0207645_10015526
757 Ga0207643_10125879
758 Ga0207705_10002347
759 Ga0207705_10089556
760 Ga0207705_10103475
761 Ga0207705_10174512
762 Ga0207705_10299218
763 Ga0207705_10496941
764 Ga0207705_10865480
765 Ga0207705_10914860
766 Ga0207705_10973361
767 Ga0207705_11323001
768 Ga0207654_10069321
769 Ga0207654_10082082
770 Ga0207695_10038233
771 Ga0207695_10600691
772 Ga0207660_11230233
773 Ga0207657_10000126
774 Ga0207657_10009347
775 Ga0207657_10128352
776 Ga0207657_10435724
777 Ga0207657_10436475
778 Ga0207657_11279539
779 Ga0207649_10000937
780 Ga0207649_10004887
781 Ga0207649_10650346
782 Ga0207652_10405992
783 Ga0207652_10706333
784 Ga0207681_10010000
785 Ga0207681_10325184
786 Ga0207681_10353964
787 Ga0207694_10200517
788 Ga0207650_10003655
789 Ga0207650_10011665
790 Ga0207650_10032491
791 Ga0207659_10469907
792 Ga0207659_11659972
793 Ga0207687_10013795
794 Ga0207644_10012689
795 Ga0207644_10068554
796 Ga0207690_10000106
797 Ga0207690_10006739
798 Ga0207690_10021928
799 Ga0207690_10069367
800 Ga0207690_10752391
801 Ga0207690_10773564
802 Ga0207690_10825599
803 Ga0207690_10880787
804 Ga0207706_10000151
805 Ga0207706_10005896
806 Ga0207706_10029147
807 Ga0207670_10113380
808 Ga0207669_10009539
809 Ga0207669_10094289
810 Ga0207704_10006757
811 Ga0207691_10007770
812 Ga0207691_10134197
813 Ga0207711_10001912
814 Ga0207711_10004040
815 Ga0207711_10020785
816 Ga0207711_10279823
817 Ga0207689_10000167
818 Ga0207689_11567860
819 Ga0207661_10006497
820 Ga0207661_11169757
821 Ga0207679_10002382
822 Ga0207679_10475078
823 Ga0207667_10002108
824 Ga0207667_10042138
825 Ga0207667_10284484
826 Ga0207651_10009127
827 Ga0207668_10071748
828 Ga0207640_10025143
829 Ga0207640_10035980
830 Ga0207640_10077650
831 Ga0207640_10249811
832 Ga0207658_10002624
833 Ga0207658_10029117
834 Ga0207677_10043649
835 Ga0207703_10115143
836 Ga0207703_10156311
837 Ga0207639_10000573
838 Ga0207639_10002893
839 Ga0207639_11025388
840 Ga0207678_10006756
841 Ga0207678_10010888
842 Ga0207678_10040488
843 Ga0207678_10044567
844 Ga0207678_10570384
845 Ga0207702_10001045
846 Ga0207702_10092718
847 Ga0207702_10226895
848 Ga0207702_10647226
849 Ga0207702_11381153
850 Ga0207641_10006636
851 Ga0207641_12604265
852 Ga0207648_10001222
853 Ga0207648_10016014
854 Ga0207676_10007892
855 Ga0207676_10016650
856 Ga0207676_10031648
857 Ga0207676_10107859
858 Ga0207676_10251030
859 Ga0207676_11417808
860 Ga0207674_10002073
861 Ga0207674_10003779
862 Ga0207674_10635407
863 Ga0207675_100045075
864 Ga0207698_10002899
865 Ga0207698_10026332
866 Ga0207698_10049615
867 Ga0207698_10530824
868 Ga0268266_10000950
869 Ga0268266_10017332
870 Ga0268266_10828334
871 Ga0307515_10359232
872 Ga0307408_100081935
873 Ga0307405_10115273
874 Ga0307413_10033984
875 Ga0307413_11081818
876 Ga0307413_11253256
877 Ga0307410_10015921
878 Ga0307410_10426408
879 Ga0307407_10979547
880 Ga0307412_10269777
881 Ga0307409_100007295
882 Ga0307409_101047440
883 Ga0307416_100011123
884 Ga0307416_102897196
885 Ga0307414_10019348
886 Ga0307414_10276570
887 Ga0307411_10006880
888 Ga0307411_10196236
889 Ga0307411_10647321
890 Ga0307415_100001290
891 Ga0307415_100049467
892 Ga0373951_0141259
893 Ga0373939_0027810
894 Ga0373943_0007352
895 Ga0373946_0016959
896 Ga0373942_0126811
897 Ga0373962_0048664
898 Ga0373931_0308469
899 Ga0373935_0420357
900 Ga0373927_0057767
901 Ga0373925_0033179
902 Ga0395899_0025167
903 Ga0395899_0030099
904 Ga0395899_0054789
905 Ga0395899_0089925
906 Ga0395899_0410681
907 Ga0395899_0476198
908 Ga0395900_0007724
909 Ga0395900_0022607
910 Ga0395900_0027275
911 Ga0395900_0033836
912 Ga0395900_0073120
913 Ga0395900_0085076
914 Ga0395900_0108524
915 Ga0395900_0131992
916 Ga0395900_0196244
917 Ga0395900_0206376
918 Ga0395900_0273050
919 Ga0395900_0401685
920 Ga0395900_0408822
921 Ga0395900_0458836
922 Ga0395900_0922985
923 Ga0395900_1326620
924 Ga0395900_1812479
925 Ga0395898_0008927
926 Ga0395898_0016010
927 Ga0395898_0055058
928 Ga0395898_0199573
929 Ga0395898_0251225
930 Ga0395898_0300269
931 Ga0395898_0588861
932 Ga0395898_0932874
933 Ga0395898_1733103
934 Ga0395905_0009247
935 Ga0395905_0010012
936 Ga0395905_0014735
937 Ga0395905_0040657
938 Ga0395905_0058199
939 Ga0395905_0102517
940 Ga0395905_0113152
941 Ga0395905_0123225
942 Ga0395905_0219643
943 Ga0395905_0254464
944 Ga0395905_0592483
945 Ga0395905_1035231
946 Ga0395905_1147405
947 Ga0436364_0219673
948 Ga0436364_0755345
949 Ga0395901_0006189
950 Ga0395901_0007713
951 Ga0395901_0023864
952 Ga0395901_0025512
953 Ga0395901_0035010
954 Ga0395901_0043349
955 Ga0395901_0044592
956 Ga0395901_0048833
957 Ga0395901_0167363
958 Ga0395901_0284858
959 Ga0395901_0428250
960 Ga0395901_0582015
961 Ga0395901_1213635
962 Ga0451798_1147024
963 Ga0439445_0020157
964 Ga0439448_0004253
965 Ga0439432_044624
966 Ga0439449_0047741
967 Ga0439455_0151325
968 Ga0439457_062596
969 Ga0450923_016796
970 Ga0450923_196282
971 Ga0450898_089057
972 Ga0439458_0000154
973 Ga0439458_0000268
974 Ga0466969_0342983
975 Ga0466972_0086811
976 Ga0466965_0698772
977 Ga0466965_0823072
978 Ga0466966_0102477
979 Ga0466963_0011810
980 Ga0466963_0016999
981 Ga0466963_0874574
982 Ga0466963_1228140
983 Ga0466964_0478975
984 Ga0466970_0038621
985 Ga0466970_0062943
986 Ga0466957_0062554
987 Ga0466957_0103080
988 Ga0466957_0239652
989 Ga0466957_0339745
990 Ga0466957_0363780
991 Ga0466957_0915841
992 Ga0466959_0206105
993 Ga0466967_0007211
994 Ga0466967_0034787
995 Ga0466967_0186458
996 Ga0466967_0210844
997 Ga0466967_0308512
998 Ga0466967_0371621
999 Ga0466967_0584268
1000 Ga0466967_0718956
1001 Ga0466967_1650810
1002 Ga0495597_0016597
1003 Ga0495668_0209510
1004 Ga0495668_0564200
1005 Ga0495625_0042984
1006 Ga0495669_0085688
1007 Ga0495670_0000066
1008 Ga0496101_0318541
1009 Ga0496106_1246089
1010 Ga0496107_0186800
1011 Ga0496107_0721599
1012 Ga0496108_0145985
1013 Ga0496109_0191881
1014 Ga0496109_0692541
1015 Ga0496109_1665466
1016 Ga0496109_1856184
1017 Ga0496110_0061180
1018 Ga0496110_0102725
1019 Ga0496110_0644424
1020 Ga0496110_1649394
1021 Ga0496111_0158133
1022 Ga0496111_0362500
1023 Ga0496111_0487054
1024 Ga0496112_0475772
1025 Ga0501295_183902
1026 Ga0501225_0058248
1027 Ga0501269_052849
1028 nmdc:mga03683_185133_c1
1029 nmdc:mga0k408_159862_c1
1030 nmdc:mga0k408_226820_c1
1031 nmdc:mga07m45_122327_c1
1032 Ga0500643_006643
1033 Ga0500566_0000560
1034 Ga0500650_0107524
1035 Ga0500556_0000014
1036 Ga0500557_113302
1037 Ga0500562_012077
1038 Ga0500562_067615
1039 Ga0500642_0000001
1040 Ga0500652_231109
1041 Ga0500627_0147707
1042 Ga0500645_006494
1043 Ga0500596_058333
1044 Ga0587084_045075
1045 Ga0466962_0059360
1046 2809065342
1047 2809081266
1048 2809085631
1049 2848297393
1050 2880520814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map