F464899

General Info

Members Datasets Scaffolds Average Seq Length
571 308 1142 127

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10087161|JGI24751J29686_100871611
Length 153
Sequence MAGFDPASYHLTEEMHARVKPAHDQAGSIMARLRFDFGTLTLDAELLETPTGRAVAAALPVSSSALTWGEEVYFEVPVQVPAEADARAVVTPGEIAYWPEGHCIALGFGRTPISRGDETRLASPCNIFAKALGDVKALAAVRAGATVKVTRIG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.73
Nodule 0
Rhizoplane 10.16
Rhizosphere 83.54
Stem 0
Stem Tuber 0
Unclassified 15.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10087161 3300002459 Bacteria 648
2 JGI24743J22301_10048200 3300001991 Unclassified 865
3 JGI24748J21848_1049739 3300002074 Unclassified 546
4 JGI24738J21930_10076024 3300002075 Unclassified 700
5 JGI24744J21845_10009421 3300002077 Bacteria 2003
6 Ga0070658_11924675 3300005327 Unclassified 511
7 Ga0070676_10045904 3300005328 Bacteria 2546
8 Ga0070690_100058854 3300005330 Bacteria 2469
9 Ga0070690_100061136 3300005330 Bacteria 2426
10 Ga0070670_100025506 3300005331 Bacteria 5085
11 Ga0070670_101555776 3300005331 Unclassified 608
12 Ga0068869_100152948 3300005334 Bacteria 1790
13 Ga0070666_10770585 3300005335 Unclassified 708
14 Ga0070680_101219914 3300005336 Bacteria 651
15 Ga0068868_100003296 3300005338 Bacteria 11231
16 Ga0070660_100118912 3300005339 Bacteria 2107
17 Ga0070689_100086765 3300005340 Bacteria 2461
18 Ga0070689_100283123 3300005340 Bacteria 1376
19 Ga0070691_10085131 3300005341 Unclassified 1553
20 Ga0070687_100047546 3300005343 Bacteria 2201
21 Ga0070687_100084109 3300005343 Bacteria 1743
22 Ga0070661_100038753 3300005344 Unclassified 3470
23 Ga0070668_100228696 3300005347 Unclassified 1536
24 Ga0070668_100483184 3300005347 Bacteria 1070
25 Ga0070669_100218966 3300005353 Unclassified 1505
26 Ga0070675_100012824 3300005354 Bacteria 6576
27 Ga0070675_100358792 3300005354 Bacteria 1294
28 Ga0070675_100534670 3300005354 Unclassified 1059
29 Ga0070671_100249283 3300005355 Bacteria 1508
30 Ga0070671_100859462 3300005355 Bacteria 791
31 Ga0070674_100011906 3300005356 Bacteria 5317
32 Ga0070674_100274394 3300005356 Bacteria 1334
33 Ga0070673_100335000 3300005364 Bacteria 1339
34 Ga0070673_101170350 3300005364 Bacteria 720
35 Ga0070688_100175736 3300005365 Bacteria 1482
36 Ga0070659_100288910 3300005366 Bacteria 1365
37 Ga0070667_100236091 3300005367 Bacteria 1631
38 Ga0070667_100339340 3300005367 Bacteria 1358
39 Ga0070714_100642509 3300005435 Bacteria 1021
40 Ga0070713_100210518 3300005436 Bacteria 1760
41 Ga0070713_102274083 3300005436 Unclassified 525
42 Ga0070701_10053016 3300005438 Bacteria 2110
43 Ga0070700_100092736 3300005441 Bacteria 1974
44 Ga0070700_100138029 3300005441 Unclassified 1653
45 Ga0070694_100490073 3300005444 Bacteria 976
46 Ga0070663_100136158 3300005455 Unclassified 1870
47 Ga0070678_100090008 3300005456 Bacteria 2351
48 Ga0070678_101324281 3300005456 Bacteria 671
49 Ga0070662_100060243 3300005457 Bacteria 2767
50 Ga0070662_101856129 3300005457 Bacteria 521
51 Ga0070685_10043856 3300005466 Bacteria 2558
52 Ga0070685_10086201 3300005466 Bacteria 1893
53 Ga0070698_100254344 3300005471 Bacteria 1689
54 Ga0070679_100746074 3300005530 Bacteria 922
55 Ga0070684_100138950 3300005535 Bacteria 2196
56 Ga0068853_100682483 3300005539 Unclassified 979
57 Ga0070686_100134092 3300005544 Bacteria 1716
58 Ga0070695_101501674 3300005545 Bacteria 561
59 Ga0070665_100185432 3300005548 Bacteria 2081
60 Ga0070665_101768281 3300005548 Bacteria 625
61 Ga0070704_100260691 3300005549 Unclassified 1428
62 Ga0068855_101200074 3300005563 Bacteria 789
63 Ga0070664_100323572 3300005564 Bacteria 1398
64 Ga0070664_101803845 3300005564 Unclassified 580
65 Ga0068854_100634335 3300005578 Bacteria 916
66 Ga0068856_100012937 3300005614 Bacteria 8078
67 Ga0068856_100226681 3300005614 Bacteria 1884
68 Ga0070702_100004426 3300005615 Bacteria 6416
69 Ga0068852_100050860 3300005616 Bacteria 3553
70 Ga0068852_101242623 3300005616 Bacteria 766
71 Ga0068859_100199991 3300005617 Unclassified 2083
72 Ga0068859_100534768 3300005617 Bacteria 1267
73 Ga0068864_100007551 3300005618 Bacteria 8960
74 Ga0068864_100566890 3300005618 Unclassified 1099
75 Ga0068864_101134494 3300005618 Bacteria 779
76 Ga0068866_10780182 3300005718 Unclassified 662
77 Ga0068866_10888559 3300005718 Bacteria 626
78 Ga0068851_10222123 3300005834 Bacteria 1062
79 Ga0068870_10001245 3300005840 Bacteria 10214
80 Ga0068863_100003834 3300005841 Bacteria 14869
81 Ga0068863_101769027 3300005841 Bacteria 628
82 Ga0068858_101080424 3300005842 Unclassified 787
83 Ga0068858_101897136 3300005842 Unclassified 589
84 Ga0068860_100030341 3300005843 Bacteria 5200
85 Ga0068860_100319023 3300005843 Bacteria 1525
86 Ga0068860_100751466 3300005843 Bacteria 987
87 Ga0068862_100006928 3300005844 Bacteria 9402
88 Ga0068862_101043293 3300005844 Bacteria 810
89 Ga0081455_10008273 3300005937 Bacteria 10841
90 Ga0081455_10119894 3300005937 Bacteria 2074
91 Ga0081540_1027621 3300005983 Bacteria 3209
92 Ga0081540_1107868 3300005983 Bacteria 1184
93 Ga0070717_10058299 3300006028 Bacteria 3193
94 Ga0070717_10178718 3300006028 Bacteria 1849
95 Ga0075365_10017138 3300006038 Bacteria 4424
96 Ga0075365_10059464 3300006038 Bacteria 2547
97 Ga0075365_10090332 3300006038 Bacteria 2086
98 Ga0075365_10262197 3300006038 Unclassified 1215
99 Ga0075365_10806428 3300006038 Bacteria 662
100 Ga0075365_11349767 3300006038 Bacteria 501
101 Ga0075368_10505573 3300006042 Bacteria 540
102 Ga0075363_100187567 3300006048 Bacteria 1179
103 Ga0075363_100225458 3300006048 Unclassified 1075
104 Ga0075363_100319202 3300006048 Bacteria 904
105 Ga0075364_10117844 3300006051 Bacteria 1776
106 Ga0075364_10478654 3300006051 Bacteria 851
107 Ga0075432_10140075 3300006058 Unclassified 922
108 Ga0070715_10890988 3300006163 Unclassified 547
109 Ga0070716_101185234 3300006173 Bacteria 613
110 Ga0070712_100004180 3300006175 Bacteria 8882
111 Ga0070712_100315120 3300006175 Unclassified 1270
112 Ga0075362_10180027 3300006177 Bacteria 1024
113 Ga0075362_10684804 3300006177 Bacteria 534
114 Ga0075367_10585710 3300006178 Bacteria 709
115 Ga0075367_10738200 3300006178 Bacteria 626
116 Ga0075369_10461520 3300006186 Bacteria 602
117 Ga0075366_10814163 3300006195 Unclassified 581
118 Ga0097621_100849954 3300006237 Unclassified 848
119 Ga0075370_10047423 3300006353 Bacteria 2433
120 Ga0068871_101054934 3300006358 Unclassified 759
121 Ga0075428_100101429 3300006844 Bacteria 3137
122 Ga0075428_100391626 3300006844 Bacteria 1489
123 Ga0075428_100610273 3300006844 Bacteria 1165
124 Ga0075428_100931894 3300006844 Bacteria 921
125 Ga0075430_100026224 3300006846 Bacteria 4959
126 Ga0075430_100530940 3300006846 Bacteria 971
127 Ga0075431_100051656 3300006847 Bacteria 4239
128 Ga0075431_101627687 3300006847 Unclassified 603
129 Ga0075431_101742147 3300006847 Bacteria 580
130 Ga0075434_100033945 3300006871 Bacteria 5037
131 Ga0075434_100092205 3300006871 Bacteria 3031
132 Ga0075429_100032668 3300006880 Bacteria 4523
133 Ga0068865_100237388 3300006881 Bacteria 1433
134 Ga0068865_100333658 3300006881 Bacteria 1223
135 Ga0075436_100255980 3300006914 Bacteria 1248
136 Ga0075436_100405048 3300006914 Bacteria 989
137 Ga0097620_100199992 3300006931 Unclassified 2083
138 Ga0097620_100534799 3300006931 Bacteria 1267
139 Ga0099795_10255617 3300007788 Bacteria 757
140 Ga0105250_10059745 3300009092 Unclassified 1531
141 Ga0111539_10077321 3300009094 Bacteria 3917
142 Ga0111539_10209973 3300009094 Bacteria 2269
143 Ga0111539_10558784 3300009094 Bacteria 1333
144 Ga0105245_10023603 3300009098 Bacteria 5399
145 Ga0105245_10821994 3300009098 Unclassified 968
146 Ga0105247_10005476 3300009101 Bacteria 7996
147 Ga0114129_10054788 3300009147 Bacteria 5590
148 Ga0114129_10067630 3300009147 Bacteria 4983
149 Ga0114129_11471427 3300009147 Bacteria 838
150 Ga0114129_12071943 3300009147 Bacteria 687
151 Ga0114129_12169009 3300009147 Bacteria 669
152 Ga0105243_10018635 3300009148 Bacteria 5259
153 Ga0105243_10121585 3300009148 Bacteria 2202
154 Ga0105243_10988550 3300009148 Bacteria 843
155 Ga0105241_10487003 3300009174 Unclassified 1097
156 Ga0105242_10417933 3300009176 Bacteria 1256
157 Ga0105242_11170889 3300009176 Bacteria 786
158 Ga0105248_10138544 3300009177 Bacteria 2745
159 Ga0105248_10435307 3300009177 Bacteria 1477
160 Ga0105237_10095616 3300009545 Bacteria 2960
161 Ga0105238_10232004 3300009551 Bacteria 1822
162 Ga0105238_11421323 3300009551 Unclassified 721
163 Ga0099796_10087181 3300010159 Bacteria 1155
164 Ga0099796_10475820 3300010159 Unclassified 558
165 Ga0105239_10042264 3300010375 Bacteria 4995
166 Ga0105239_10202841 3300010375 Bacteria 2222
167 Ga0105239_12520090 3300010375 Bacteria 599
168 Ga0105246_10129509 3300011119 Bacteria 1882
169 Ga0105246_11746262 3300011119 Unclassified 593
170 Ga0157378_10158205 3300013297 Bacteria 2117
171 Ga0157378_13065174 3300013297 Bacteria 519
172 Ga0163162_10376334 3300013306 Bacteria 1553
173 Ga0163162_10424643 3300013306 Bacteria 1461
174 Ga0163162_10428866 3300013306 Unclassified 1454
175 Ga0157372_11676574 3300013307 Unclassified 731
176 Ga0157375_10104067 3300013308 Bacteria 2927
177 Ga0157375_10371702 3300013308 Unclassified 1596
178 Ga0163163_10033799 3300014325 Bacteria 4949
179 Ga0157380_10041690 3300014326 Bacteria 3584
180 Ga0157380_10085600 3300014326 Bacteria 2587
181 Ga0157380_10087971 3300014326 Bacteria 2555
182 Ga0157380_10630131 3300014326 Bacteria 1066
183 Ga0157376_10133523 3300014969 Bacteria 2218
184 Ga0163161_10029392 3300017792 Bacteria 3908
185 Ga0213874_10103190 3300021377 Bacteria 951
186 Ga0213875_10314078 3300021388 Bacteria 742
187 Ga0207642_10060060 3300025899 Unclassified 1761
188 Ga0207642_10838198 3300025899 Bacteria 586
189 Ga0207710_10017891 3300025900 Bacteria 3009
190 Ga0207688_10002333 3300025901 Bacteria 10203
191 Ga0207688_10406332 3300025901 Bacteria 845
192 Ga0207680_10185739 3300025903 Bacteria 1408
193 Ga0207647_10071602 3300025904 Bacteria 2091
194 Ga0207685_10223490 3300025905 Unclassified 897
195 Ga0207685_10223929 3300025905 Bacteria 896
196 Ga0207643_10000918 3300025908 Bacteria 17637
197 Ga0207654_10556769 3300025911 Bacteria 815
198 Ga0207671_10153094 3300025914 Bacteria 1782
199 Ga0207693_10358974 3300025915 Bacteria 1140
200 Ga0207693_10556328 3300025915 Bacteria 894
201 Ga0207663_10184415 3300025916 Bacteria 1493
202 Ga0207662_10004184 3300025918 Bacteria 7562
203 Ga0207662_10005240 3300025918 Bacteria 6882
204 Ga0207657_10099817 3300025919 Bacteria 2411
205 Ga0207657_11032095 3300025919 Bacteria 630
206 Ga0207649_10140196 3300025920 Unclassified 1653
207 Ga0207681_10033821 3300025923 Bacteria 3356
208 Ga0207694_11583391 3300025924 Unclassified 552
209 Ga0207659_10097180 3300025926 Bacteria 2212
210 Ga0207659_10099805 3300025926 Bacteria 2186
211 Ga0207687_10039299 3300025927 Bacteria 3239
212 Ga0207700_10309274 3300025928 Bacteria 1367
213 Ga0207700_10417363 3300025928 Unclassified 1178
214 Ga0207644_10167600 3300025931 Bacteria 1712
215 Ga0207690_11205239 3300025932 Unclassified 632
216 Ga0207706_10008010 3300025933 Bacteria 9752
217 Ga0207686_10591647 3300025934 Bacteria 872
218 Ga0207686_10622588 3300025934 Bacteria 851
219 Ga0207709_11140729 3300025935 Bacteria 641
220 Ga0207709_11247179 3300025935 Unclassified 613
221 Ga0207670_10104153 3300025936 Bacteria 2032
222 Ga0207669_10027495 3300025937 Bacteria 3116
223 Ga0207665_10517705 3300025939 Bacteria 923
224 Ga0207691_10149220 3300025940 Bacteria 2056
225 Ga0207691_10334742 3300025940 Bacteria 1296
226 Ga0207711_10042260 3300025941 Bacteria 3884
227 Ga0207711_10437749 3300025941 Bacteria 1217
228 Ga0207711_11474920 3300025941 Unclassified 623
229 Ga0207689_10002512 3300025942 Bacteria 17049
230 Ga0207679_10488595 3300025945 Bacteria 1097
231 Ga0207679_11501860 3300025945 Unclassified 618
232 Ga0207667_10983617 3300025949 Unclassified 832
233 Ga0207651_10629929 3300025960 Bacteria 940
234 Ga0207651_11734397 3300025960 Bacteria 562
235 Ga0207712_11020954 3300025961 Bacteria 734
236 Ga0207668_10634299 3300025972 Bacteria 934
237 Ga0207668_11128084 3300025972 Unclassified 703
238 Ga0207658_10163003 3300025986 Bacteria 1829
239 Ga0207658_11002988 3300025986 Unclassified 762
240 Ga0207658_12194732 3300025986 Unclassified 501
241 Ga0207677_10350917 3300026023 Unclassified 1236
242 Ga0207703_10016999 3300026035 Bacteria 5673
243 Ga0207678_10047940 3300026067 Bacteria 3694
244 Ga0207708_10001462 3300026075 Bacteria 17660
245 Ga0207708_10495269 3300026075 Bacteria 1023
246 Ga0207641_10031406 3300026088 Bacteria 4405
247 Ga0207641_11377585 3300026088 Bacteria 706
248 Ga0207648_10012291 3300026089 Bacteria 8016
249 Ga0207676_10032403 3300026095 Bacteria 3937
250 Ga0207676_12590321 3300026095 Bacteria 503
251 Ga0207675_100001087 3300026118 Bacteria 26918
252 Ga0207683_10016911 3300026121 Bacteria 6207
253 Ga0207683_10019801 3300026121 Bacteria 5748
254 Ga0207683_10119762 3300026121 Bacteria 2362
255 Ga0207683_10453042 3300026121 Bacteria 1183
256 Ga0207698_10163423 3300026142 Unclassified 1950
257 Ga0209179_1018958 3300027512 Unclassified 1320
258 Ga0207428_10048077 3300027907 Bacteria 3424
259 Ga0268266_10257121 3300028379 Unclassified 1617
260 Ga0268266_10854284 3300028379 Bacteria 880
261 Ga0268265_10079179 3300028380 Bacteria 2587
262 Ga0268265_11293826 3300028380 Bacteria 729
263 Ga0268264_10074186 3300028381 Bacteria 2889
264 Ga0268264_11363006 3300028381 Unclassified 720
265 Ga0265763_1030166 3300030763 Bacteria 613
266 Ga0265325_10008446 3300031241 Bacteria 6076
267 Ga0265340_10034123 3300031247 Bacteria 2531
268 Ga0307408_100139718 3300031548 Bacteria 1900
269 Ga0307408_100708218 3300031548 Bacteria 906
270 Ga0307413_11327578 3300031824 Bacteria 630
271 Ga0307410_12072141 3300031852 Bacteria 508
272 Ga0307412_11024115 3300031911 Bacteria 731
273 Ga0373938_0185582 3300034957 Bacteria 570
274 Ga0373926_0284227 3300035083 Bacteria 644
275 Ga0373952_0147773 3300035092 Bacteria 657
276 Ga0373923_0377535 3300035111 Bacteria 680
277 Ga0373932_0034630 3300035112 Bacteria 1424
278 Ga0373936_0043593 3300035113 Bacteria 1804
279 Ga0373936_0548697 3300035113 Bacteria 540
280 Ga0373939_0128868 3300035114 Bacteria 901
281 Ga0373941_0088239 3300035115 Bacteria 1059
282 Ga0373945_0537686 3300035116 Unclassified 523
283 Ga0373943_0083668 3300035170 Unclassified 1640
284 Ga0373943_0131043 3300035170 Bacteria 1342
285 Ga0373943_0190808 3300035170 Bacteria 1130
286 Ga0373946_0035968 3300035171 Unclassified 2005
287 Ga0373955_0094228 3300035172 Bacteria 1711
288 Ga0373955_0515174 3300035172 Bacteria 731
289 Ga0373955_0857006 3300035172 Unclassified 559
290 Ga0373942_0068648 3300035207 Bacteria 1030
291 Ga0373961_0147637 3300035241 Bacteria 799
292 Ga0373962_0080752 3300035242 Unclassified 987
293 Ga0373924_0033105 3300035410 Bacteria 2085
294 Ga0373924_0382879 3300035410 Bacteria 628
295 Ga0373931_0063125 3300035691 Bacteria 2001
296 Ga0373931_0227288 3300035691 Unclassified 1126
297 Ga0373931_0291112 3300035691 Bacteria 1006
298 Ga0373931_0377854 3300035691 Bacteria 892
299 Ga0373935_0175630 3300035692 Bacteria 1468
300 Ga0373935_0244954 3300035692 Bacteria 1253
301 Ga0373935_0250976 3300035692 Bacteria 1238
302 Ga0373935_0257683 3300035692 Bacteria 1222
303 Ga0373927_0011437 3300035695 Bacteria 5911
304 Ga0373927_0172840 3300035695 Bacteria 1416
305 Ga0373927_0219719 3300035695 Bacteria 1248
306 Ga0373933_0268539 3300035724 Bacteria 1101
307 Ga0373947_0004686 3300035725 Bacteria 8016
308 Ga0373947_0029105 3300035725 Bacteria 3239
309 Ga0373947_0190012 3300035725 Bacteria 1340
310 Ga0373947_0429769 3300035725 Bacteria 893
311 Ga0373947_0712395 3300035725 Bacteria 685
312 Ga0373937_0656017 3300036401 Unclassified 995
313 Ga0373925_0050347 3300037068 Bacteria 3106
314 Ga0373925_0082851 3300037068 Bacteria 2442
315 Ga0373925_0180450 3300037068 Bacteria 1671
316 Ga0373925_0221204 3300037068 Bacteria 1511
317 Ga0373925_0471423 3300037068 Bacteria 1029
318 Ga0373925_0789566 3300037068 Bacteria 783
319 Ga0436364_0771775 3300037853 Bacteria 1036
320 Ga0436364_1321283 3300037853 Bacteria 19477
321 Ga0436364_1485977 3300037853 Bacteria 1971
322 Ga0436365_0705741 3300039437 Unclassified 572
323 Ga0436365_1537293 3300039437 Bacteria 2157
324 Ga0436360_1141264 3300039438 Bacteria 532
325 Ga0436360_1242010 3300039438 Bacteria 534
326 Ga0436360_1375856 3300039438 Bacteria 904
327 Ga0451853_1864114 3300041512 Bacteria 539
328 Ga0466966_0569119 3300044684 Bacteria 682
329 Ga0466959_0573784 3300045049 Bacteria 760
330 Ga0466967_1354349 3300045976 Bacteria 709
331 Ga0495603_0018061 3300046455 Bacteria 4266
332 Ga0495603_0400300 3300046455 Unclassified 787
333 Ga0495603_0498138 3300046455 Bacteria 698
334 Ga0495590_0204864 3300046457 Bacteria 726
335 Ga0495629_0103927 3300046459 Bacteria 1981
336 Ga0495629_0312946 3300046459 Bacteria 1074
337 Ga0495638_0342258 3300046460 Unclassified 792
338 Ga0495653_0212447 3300046463 Bacteria 1306
339 Ga0495580_0261697 3300046472 Unclassified 1183
340 Ga0495582_0082093 3300046473 Bacteria 1791
341 Ga0495582_0190695 3300046473 Bacteria 1169
342 Ga0495582_0213239 3300046473 Bacteria 1104
343 Ga0495639_0176089 3300046475 Bacteria 1040
344 Ga0495639_0291952 3300046475 Unclassified 812
345 Ga0495662_0199418 3300046476 Unclassified 987
346 Ga0495584_0008739 3300046491 Bacteria 5238
347 Ga0495584_0434128 3300046491 Bacteria 668
348 Ga0495585_0364153 3300046492 Bacteria 701
349 Ga0495585_0490483 3300046492 Unclassified 585
350 Ga0495607_0379109 3300046501 Bacteria 647
351 Ga0495616_0058876 3300046513 Bacteria 1891
352 Ga0495618_0229839 3300046514 Bacteria 1168
353 Ga0495618_0643259 3300046514 Unclassified 628
354 Ga0495620_0047730 3300046515 Bacteria 1841
355 Ga0495628_0093954 3300046516 Bacteria 2319
356 Ga0495628_1048891 3300046516 Unclassified 559
357 Ga0495630_0984417 3300046517 Bacteria 641
358 Ga0495630_1250943 3300046517 Bacteria 560
359 Ga0495644_0217167 3300046523 Unclassified 739
360 Ga0495663_0116161 3300046525 Bacteria 893
361 Ga0495666_0206768 3300046526 Bacteria 901
362 Ga0495665_0193885 3300046531 Bacteria 1054
363 Ga0495598_0036997 3300046537 Bacteria 1406
364 Ga0495667_0115698 3300046559 Bacteria 1733
365 Ga0495667_0327489 3300046559 Bacteria 969
366 Ga0495656_0053850 3300046615 Bacteria 1730
367 Ga0495656_0119074 3300046615 Bacteria 1244
368 Ga0495656_0651329 3300046615 Bacteria 565
369 Ga0495634_0529569 3300046642 Bacteria 689
370 Ga0495635_0243130 3300046663 Bacteria 1214
371 Ga0495661_0436117 3300046665 Unclassified 632
372 Ga0495588_0032647 3300046674 Bacteria 2625
373 Ga0495647_0170516 3300046681 Bacteria 942
374 Ga0495658_0039114 3300046683 Bacteria 2630
375 Ga0495658_0266096 3300046683 Bacteria 1080
376 Ga0495613_0718260 3300046689 Bacteria 657
377 Ga0495624_0017679 3300046690 Bacteria 4781
378 Ga0495670_0320347 3300046691 Bacteria 832
379 Ga0495649_0137484 3300046694 Bacteria 1287
380 Ga0495589_0259340 3300046794 Unclassified 811
381 Ga0495600_0402273 3300046809 Unclassified 852
382 Ga0495660_0335209 3300046810 Bacteria 676
383 Ga0495581_0704879 3300047315 Bacteria 582
384 Ga0495604_0263666 3300047317 Bacteria 1170
385 Ga0495674_0153403 3300047319 Bacteria 1931
386 Ga0495674_0286007 3300047319 Bacteria 1350
387 Ga0495674_0858104 3300047319 Unclassified 703
388 Ga0495676_0087007 3300047321 Bacteria 2349
389 Ga0495676_0204791 3300047321 Bacteria 1369
390 Ga0495683_0138548 3300047323 Bacteria 1142
391 Ga0495602_0282846 3300048088 Bacteria 1221
392 Ga0496100_0008364 3300048903 Bacteria 5767
393 Ga0496100_0138274 3300048903 Bacteria 1723
394 Ga0496100_0213208 3300048903 Bacteria 1413
395 Ga0496100_0227356 3300048903 Bacteria 1371
396 Ga0496100_0233442 3300048903 Bacteria 1354
397 Ga0496100_0332337 3300048903 Bacteria 1144
398 Ga0496100_0718265 3300048903 Bacteria 780
399 Ga0496100_0974296 3300048903 Viruses 667
400 Ga0496101_0040008 3300048904 Bacteria 3338
401 Ga0496101_0221353 3300048904 Bacteria 1469
402 Ga0496101_0926551 3300048904 Bacteria 686
403 Ga0496102_0115760 3300048905 Bacteria 2501
404 Ga0496102_0293540 3300048905 Bacteria 1532
405 Ga0496102_0430107 3300048905 Bacteria 1239
406 Ga0496102_0845818 3300048905 Unclassified 837
407 Ga0496103_0108471 3300048906 Bacteria 1762
408 Ga0496103_0234571 3300048906 Unclassified 1180
409 Ga0496104_0001213 3300048907 Bacteria 22181
410 Ga0496104_0014222 3300048907 Bacteria 7182
411 Ga0496104_0040969 3300048907 Bacteria 4342
412 Ga0496104_0130058 3300048907 Bacteria 2418
413 Ga0496104_0288024 3300048907 Bacteria 1555
414 Ga0496105_0000541 3300048908 Bacteria 24931
415 Ga0496105_0024581 3300048908 Bacteria 4896
416 Ga0496105_0050969 3300048908 Bacteria 3420
417 Ga0496105_0067901 3300048908 Bacteria 2944
418 Ga0496106_0006452 3300048909 Bacteria 8685
419 Ga0496106_0096635 3300048909 Bacteria 2286
420 Ga0496106_0204189 3300048909 Bacteria 1573
421 Ga0496106_0252005 3300048909 Unclassified 1411
422 Ga0496107_0007732 3300048910 Bacteria 7425
423 Ga0496107_0316892 3300048910 Unclassified 1161
424 Ga0496107_0383353 3300048910 Bacteria 1046
425 Ga0496108_0000318 3300048911 Bacteria 40889
426 Ga0496108_0011772 3300048911 Bacteria 7114
427 Ga0496108_0129158 3300048911 Bacteria 2172
428 Ga0496108_0321771 3300048911 Bacteria 1348
429 Ga0496109_0006745 3300048912 Bacteria 9667
430 Ga0496109_0013554 3300048912 Bacteria 7077
431 Ga0496109_0090385 3300048912 Bacteria 2832
432 Ga0496109_0170879 3300048912 Bacteria 2039
433 Ga0496110_0004141 3300048913 Bacteria 11210
434 Ga0496110_0164510 3300048913 Bacteria 2011
435 Ga0496110_0305128 3300048913 Bacteria 1450
436 Ga0496111_0056682 3300048914 Bacteria 2835
437 Ga0496112_0009717 3300048915 Bacteria 8683
438 Ga0496112_0021727 3300048915 Bacteria 6105
439 Ga0496112_0071708 3300048915 Bacteria 3423
440 Ga0496113_0005001 3300048916 Bacteria 8217
441 Ga0496114_0036628 3300048917 Bacteria 4055
442 Ga0496114_0210149 3300048917 Bacteria 1706
443 Ga0496114_0252657 3300048917 Bacteria 1551
444 Ga0496114_0337480 3300048917 Bacteria 1332
445 Ga0496115_0003899 3300048918 Bacteria 10747
446 Ga0496115_0010005 3300048918 Bacteria 7067
447 Ga0496115_0014735 3300048918 Bacteria 5924
448 Ga0496115_0899027 3300048918 Bacteria 683
449 Ga0496115_1182497 3300048918 Viruses 575
450 Ga0496126_0241784 3300048929 Bacteria 1508
451 Ga0501032_0011386 3300049569 Bacteria 6390
452 Ga0501032_0107018 3300049569 Bacteria 1852
453 Ga0501033_0254481 3300049570 Bacteria 1244
454 Ga0501033_0786569 3300049570 Bacteria 644
455 Ga0501034_0000032 3300049571 Bacteria 243763
456 Ga0501034_0004997 3300049571 Bacteria 14594
457 Ga0501034_0125705 3300049571 Bacteria 2550
458 Ga0501034_0303951 3300049571 Bacteria 1531
459 Ga0501034_0373589 3300049571 Bacteria 1351
460 Ga0501034_0444187 3300049571 Bacteria 1215
461 Ga0501034_0697450 3300049571 Bacteria 914
462 Ga0501036_0000609 3300049572 Bacteria 25966
463 Ga0501036_0016787 3300049572 Bacteria 6115
464 Ga0501037_0023928 3300049573 Bacteria 4517
465 Ga0501037_0064483 3300049573 Bacteria 2669
466 Ga0501037_0789193 3300049573 Bacteria 628
467 Ga0501038_0020959 3300049574 Bacteria 5873
468 Ga0501038_0145612 3300049574 Bacteria 1934
469 Ga0501038_0204731 3300049574 Bacteria 1582
470 Ga0501039_0022514 3300049575 Bacteria 4837
471 Ga0501039_0404037 3300049575 Bacteria 1073
472 Ga0501040_0692104 3300049576 Bacteria 737
473 Ga0501042_0019094 3300049578 Bacteria 4757
474 Ga0501043_0005411 3300049579 Bacteria 10318
475 Ga0501043_0105136 3300049579 Bacteria 2218
476 Ga0501043_0245014 3300049579 Bacteria 1381
477 Ga0501043_0435482 3300049579 Bacteria 987
478 Ga0501043_0499014 3300049579 Bacteria 909
479 Ga0501046_0027303 3300049580 Bacteria 4658
480 Ga0501046_0077550 3300049580 Bacteria 2572
481 Ga0501047_0000228 3300049581 Bacteria 66588
482 Ga0501047_0049346 3300049581 Bacteria 4064
483 Ga0501047_0052228 3300049581 Bacteria 3950
484 Ga0501047_0114510 3300049581 Bacteria 2579
485 Ga0501047_0751902 3300049581 Bacteria 791
486 Ga0501048_0000331 3300049582 Bacteria 32529
487 Ga0501048_0024570 3300049582 Bacteria 4397
488 Ga0501067_0001841 3300049583 Bacteria 11668
489 Ga0501068_0038784 3300049584 Bacteria 2854
490 Ga0501068_0775592 3300049584 Bacteria 628
491 Ga0501069_0032018 3300049585 Bacteria 2894
492 Ga0501069_0111689 3300049585 Bacteria 1557
493 Ga0501070_0043220 3300049586 Bacteria 3750
494 Ga0501070_0069980 3300049586 Bacteria 2905
495 Ga0501070_0400810 3300049586 Bacteria 1109
496 Ga0501070_0518706 3300049586 Bacteria 956
497 Ga0501070_0861324 3300049586 Bacteria 708
498 Ga0501070_0896991 3300049586 Bacteria 692
499 Ga0501071_0350607 3300049587 Bacteria 1123
500 Ga0501072_0184215 3300049588 Bacteria 1666
501 Ga0501072_0315141 3300049588 Bacteria 1243
502 Ga0501072_0417723 3300049588 Bacteria 1063
503 Ga0501072_0768120 3300049588 Bacteria 756
504 Ga0501073_0010782 3300049589 Bacteria 6693
505 Ga0501074_0018558 3300049590 Bacteria 5052
506 Ga0501074_0031882 3300049590 Bacteria 3819
507 Ga0501076_0163834 3300049592 Bacteria 1812
508 Ga0501076_0433184 3300049592 Bacteria 1082
509 Ga0501076_1482982 3300049592 Unclassified 557
510 Ga0501077_0148557 3300049593 Bacteria 1487
511 Ga0501077_0968200 3300049593 Bacteria 547
512 Ga0501079_0049757 3300049741 Bacteria 3235
513 Ga0501079_0199040 3300049741 Bacteria 1564
514 Ga0501080_0001137 3300049742 Bacteria 21908
515 Ga0501080_0074137 3300049742 Bacteria 3166
516 Ga0501080_1004043 3300049742 Bacteria 724
517 Ga0501083_0002769 3300049744 Bacteria 12109
518 Ga0501083_0038360 3300049744 Bacteria 3258
519 Ga0501083_0178281 3300049744 Bacteria 1388
520 Ga0501083_0860625 3300049744 Bacteria 590
521 Ga0501035_0112591 3300049822 Bacteria 2384
522 Ga0501035_0180174 3300049822 Bacteria 1820
523 Ga0501035_0673271 3300049822 Unclassified 837
524 Ga0501035_0913195 3300049822 Bacteria 695
525 Ga0501044_0000782 3300049823 Bacteria 38567
526 Ga0501044_0018377 3300049823 Bacteria 7491
527 Ga0501044_0059259 3300049823 Bacteria 3923
528 Ga0501044_0203079 3300049823 Bacteria 1939
529 Ga0501044_1013970 3300049823 Bacteria 701
530 Ga0501045_0003187 3300049824 Bacteria 11223
531 Ga0501045_0070136 3300049824 Bacteria 2578
532 Ga0501045_0407144 3300049824 Bacteria 1012
533 nmdc:mga03683_590826_c1 3300050489 Bacteria 543
534 nmdc:mga00v17_597715_c1 3300050491 Bacteria 711
535 nmdc:mga0yw44_1212101_c1 3300050492 Bacteria 509
536 nmdc:mga0yw44_153362_c1 3300050492 Bacteria 1504
537 nmdc:mga0yw44_42685_c1 3300050492 Bacteria 2705
538 nmdc:mga0k408_728160_c1 3300050493 Unclassified 580
539 nmdc:mga06z11_261592_c1 3300050494 Bacteria 1021
540 nmdc:mga06z11_877434_c1 3300050494 Bacteria 547
541 nmdc:mga05p37_262792_c1 3300050507 Bacteria 2065
542 nmdc:mga05p37_264939_c1 3300050507 Bacteria 2055
543 nmdc:mga09592_128978_c1 3300050508 Bacteria 2175
544 nmdc:mga06r32_283464_c1 3300050510 Bacteria 1644
545 nmdc:mga06r32_556107_c1 3300050510 Bacteria 1121
546 nmdc:mga08y16_1290748_c1 3300050511 Bacteria 697
547 nmdc:mga08y16_169420_c1 3300050511 Bacteria 2268
548 nmdc:mga08y16_521125_c1 3300050511 Bacteria 1205
549 nmdc:mga0n895_111662_c1 3300050512 Bacteria 2750
550 nmdc:mga0n895_1870673_c1 3300050512 Bacteria 560
551 nmdc:mga0n895_210066_c1 3300050512 Bacteria 1977
552 nmdc:mga0n895_511824_c1 3300050512 Bacteria 1208
553 nmdc:mga0rr50_490234_c1 3300050513 Bacteria 1044
554 nmdc:mga08x19_145463_c1 3300050514 Bacteria 1603
555 nmdc:mga0a205_131420_c1 3300050515 Bacteria 2404
556 Ga0495601_0039408 3300053077 Bacteria 2959
557 Ga0495612_0161761 3300053078 Unclassified 978
558 Ga0495612_0444440 3300053078 Bacteria 592
559 Ga0495655_0043554 3300053083 Unclassified 1157
560 Ga0495595_0110746 3300053084 Bacteria 1331
561 Ga0495595_0140510 3300053084 Bacteria 1185
562 Ga0495619_0050556 3300053085 Bacteria 2744
563 Ga0495619_0166015 3300053085 Bacteria 1526
564 Ga0495619_0552514 3300053085 Bacteria 790
565 Ga0501084_0072200 3300054114 Bacteria 2890
566 Ga0501084_0102459 3300054114 Bacteria 2404
567 Ga0501084_0620307 3300054114 Bacteria 913
568 Ga0501082_0007071 3300060353 Bacteria 9685
569 Ga0501082_0221014 3300060353 Bacteria 1648
570 Ga0501082_0237531 3300060353 Bacteria 1586
571 Ga0530510_0671069 3300061734 Bacteria 789
572 JGI24751J29686_10087161
573 JGI24743J22301_10048200
574 JGI24748J21848_1049739
575 JGI24738J21930_10076024
576 JGI24744J21845_10009421
577 Ga0070658_11924675
578 Ga0070676_10045904
579 Ga0070690_100058854
580 Ga0070690_100061136
581 Ga0070670_100025506
582 Ga0070670_101555776
583 Ga0068869_100152948
584 Ga0070666_10770585
585 Ga0070680_101219914
586 Ga0068868_100003296
587 Ga0070660_100118912
588 Ga0070689_100086765
589 Ga0070689_100283123
590 Ga0070691_10085131
591 Ga0070687_100047546
592 Ga0070687_100084109
593 Ga0070661_100038753
594 Ga0070668_100228696
595 Ga0070668_100483184
596 Ga0070669_100218966
597 Ga0070675_100012824
598 Ga0070675_100358792
599 Ga0070675_100534670
600 Ga0070671_100249283
601 Ga0070671_100859462
602 Ga0070674_100011906
603 Ga0070674_100274394
604 Ga0070673_100335000
605 Ga0070673_101170350
606 Ga0070688_100175736
607 Ga0070659_100288910
608 Ga0070667_100236091
609 Ga0070667_100339340
610 Ga0070714_100642509
611 Ga0070713_100210518
612 Ga0070713_102274083
613 Ga0070701_10053016
614 Ga0070700_100092736
615 Ga0070700_100138029
616 Ga0070694_100490073
617 Ga0070663_100136158
618 Ga0070678_100090008
619 Ga0070678_101324281
620 Ga0070662_100060243
621 Ga0070662_101856129
622 Ga0070685_10043856
623 Ga0070685_10086201
624 Ga0070698_100254344
625 Ga0070679_100746074
626 Ga0070684_100138950
627 Ga0068853_100682483
628 Ga0070686_100134092
629 Ga0070695_101501674
630 Ga0070665_100185432
631 Ga0070665_101768281
632 Ga0070704_100260691
633 Ga0068855_101200074
634 Ga0070664_100323572
635 Ga0070664_101803845
636 Ga0068854_100634335
637 Ga0068856_100012937
638 Ga0068856_100226681
639 Ga0070702_100004426
640 Ga0068852_100050860
641 Ga0068852_101242623
642 Ga0068859_100199991
643 Ga0068859_100534768
644 Ga0068864_100007551
645 Ga0068864_100566890
646 Ga0068864_101134494
647 Ga0068866_10780182
648 Ga0068866_10888559
649 Ga0068851_10222123
650 Ga0068870_10001245
651 Ga0068863_100003834
652 Ga0068863_101769027
653 Ga0068858_101080424
654 Ga0068858_101897136
655 Ga0068860_100030341
656 Ga0068860_100319023
657 Ga0068860_100751466
658 Ga0068862_100006928
659 Ga0068862_101043293
660 Ga0081455_10008273
661 Ga0081455_10119894
662 Ga0081540_1027621
663 Ga0081540_1107868
664 Ga0070717_10058299
665 Ga0070717_10178718
666 Ga0075365_10017138
667 Ga0075365_10059464
668 Ga0075365_10090332
669 Ga0075365_10262197
670 Ga0075365_10806428
671 Ga0075365_11349767
672 Ga0075368_10505573
673 Ga0075363_100187567
674 Ga0075363_100225458
675 Ga0075363_100319202
676 Ga0075364_10117844
677 Ga0075364_10478654
678 Ga0075432_10140075
679 Ga0070715_10890988
680 Ga0070716_101185234
681 Ga0070712_100004180
682 Ga0070712_100315120
683 Ga0075362_10180027
684 Ga0075362_10684804
685 Ga0075367_10585710
686 Ga0075367_10738200
687 Ga0075369_10461520
688 Ga0075366_10814163
689 Ga0097621_100849954
690 Ga0075370_10047423
691 Ga0068871_101054934
692 Ga0075428_100101429
693 Ga0075428_100391626
694 Ga0075428_100610273
695 Ga0075428_100931894
696 Ga0075430_100026224
697 Ga0075430_100530940
698 Ga0075431_100051656
699 Ga0075431_101627687
700 Ga0075431_101742147
701 Ga0075434_100033945
702 Ga0075434_100092205
703 Ga0075429_100032668
704 Ga0068865_100237388
705 Ga0068865_100333658
706 Ga0075436_100255980
707 Ga0075436_100405048
708 Ga0097620_100199992
709 Ga0097620_100534799
710 Ga0099795_10255617
711 Ga0105250_10059745
712 Ga0111539_10077321
713 Ga0111539_10209973
714 Ga0111539_10558784
715 Ga0105245_10023603
716 Ga0105245_10821994
717 Ga0105247_10005476
718 Ga0114129_10054788
719 Ga0114129_10067630
720 Ga0114129_11471427
721 Ga0114129_12071943
722 Ga0114129_12169009
723 Ga0105243_10018635
724 Ga0105243_10121585
725 Ga0105243_10988550
726 Ga0105241_10487003
727 Ga0105242_10417933
728 Ga0105242_11170889
729 Ga0105248_10138544
730 Ga0105248_10435307
731 Ga0105237_10095616
732 Ga0105238_10232004
733 Ga0105238_11421323
734 Ga0099796_10087181
735 Ga0099796_10475820
736 Ga0105239_10042264
737 Ga0105239_10202841
738 Ga0105239_12520090
739 Ga0105246_10129509
740 Ga0105246_11746262
741 Ga0157378_10158205
742 Ga0157378_13065174
743 Ga0163162_10376334
744 Ga0163162_10424643
745 Ga0163162_10428866
746 Ga0157372_11676574
747 Ga0157375_10104067
748 Ga0157375_10371702
749 Ga0163163_10033799
750 Ga0157380_10041690
751 Ga0157380_10085600
752 Ga0157380_10087971
753 Ga0157380_10630131
754 Ga0157376_10133523
755 Ga0163161_10029392
756 Ga0213874_10103190
757 Ga0213875_10314078
758 Ga0207642_10060060
759 Ga0207642_10838198
760 Ga0207710_10017891
761 Ga0207688_10002333
762 Ga0207688_10406332
763 Ga0207680_10185739
764 Ga0207647_10071602
765 Ga0207685_10223490
766 Ga0207685_10223929
767 Ga0207643_10000918
768 Ga0207654_10556769
769 Ga0207671_10153094
770 Ga0207693_10358974
771 Ga0207693_10556328
772 Ga0207663_10184415
773 Ga0207662_10004184
774 Ga0207662_10005240
775 Ga0207657_10099817
776 Ga0207657_11032095
777 Ga0207649_10140196
778 Ga0207681_10033821
779 Ga0207694_11583391
780 Ga0207659_10097180
781 Ga0207659_10099805
782 Ga0207687_10039299
783 Ga0207700_10309274
784 Ga0207700_10417363
785 Ga0207644_10167600
786 Ga0207690_11205239
787 Ga0207706_10008010
788 Ga0207686_10591647
789 Ga0207686_10622588
790 Ga0207709_11140729
791 Ga0207709_11247179
792 Ga0207670_10104153
793 Ga0207669_10027495
794 Ga0207665_10517705
795 Ga0207691_10149220
796 Ga0207691_10334742
797 Ga0207711_10042260
798 Ga0207711_10437749
799 Ga0207711_11474920
800 Ga0207689_10002512
801 Ga0207679_10488595
802 Ga0207679_11501860
803 Ga0207667_10983617
804 Ga0207651_10629929
805 Ga0207651_11734397
806 Ga0207712_11020954
807 Ga0207668_10634299
808 Ga0207668_11128084
809 Ga0207658_10163003
810 Ga0207658_11002988
811 Ga0207658_12194732
812 Ga0207677_10350917
813 Ga0207703_10016999
814 Ga0207678_10047940
815 Ga0207708_10001462
816 Ga0207708_10495269
817 Ga0207641_10031406
818 Ga0207641_11377585
819 Ga0207648_10012291
820 Ga0207676_10032403
821 Ga0207676_12590321
822 Ga0207675_100001087
823 Ga0207683_10016911
824 Ga0207683_10019801
825 Ga0207683_10119762
826 Ga0207683_10453042
827 Ga0207698_10163423
828 Ga0209179_1018958
829 Ga0207428_10048077
830 Ga0268266_10257121
831 Ga0268266_10854284
832 Ga0268265_10079179
833 Ga0268265_11293826
834 Ga0268264_10074186
835 Ga0268264_11363006
836 Ga0265763_1030166
837 Ga0265325_10008446
838 Ga0265340_10034123
839 Ga0307408_100139718
840 Ga0307408_100708218
841 Ga0307413_11327578
842 Ga0307410_12072141
843 Ga0307412_11024115
844 Ga0373938_0185582
845 Ga0373926_0284227
846 Ga0373952_0147773
847 Ga0373923_0377535
848 Ga0373932_0034630
849 Ga0373936_0043593
850 Ga0373936_0548697
851 Ga0373939_0128868
852 Ga0373941_0088239
853 Ga0373945_0537686
854 Ga0373943_0083668
855 Ga0373943_0131043
856 Ga0373943_0190808
857 Ga0373946_0035968
858 Ga0373955_0094228
859 Ga0373955_0515174
860 Ga0373955_0857006
861 Ga0373942_0068648
862 Ga0373961_0147637
863 Ga0373962_0080752
864 Ga0373924_0033105
865 Ga0373924_0382879
866 Ga0373931_0063125
867 Ga0373931_0227288
868 Ga0373931_0291112
869 Ga0373931_0377854
870 Ga0373935_0175630
871 Ga0373935_0244954
872 Ga0373935_0250976
873 Ga0373935_0257683
874 Ga0373927_0011437
875 Ga0373927_0172840
876 Ga0373927_0219719
877 Ga0373933_0268539
878 Ga0373947_0004686
879 Ga0373947_0029105
880 Ga0373947_0190012
881 Ga0373947_0429769
882 Ga0373947_0712395
883 Ga0373937_0656017
884 Ga0373925_0050347
885 Ga0373925_0082851
886 Ga0373925_0180450
887 Ga0373925_0221204
888 Ga0373925_0471423
889 Ga0373925_0789566
890 Ga0436364_0771775
891 Ga0436364_1321283
892 Ga0436364_1485977
893 Ga0436365_0705741
894 Ga0436365_1537293
895 Ga0436360_1141264
896 Ga0436360_1242010
897 Ga0436360_1375856
898 Ga0451853_1864114
899 Ga0466966_0569119
900 Ga0466959_0573784
901 Ga0466967_1354349
902 Ga0495603_0018061
903 Ga0495603_0400300
904 Ga0495603_0498138
905 Ga0495590_0204864
906 Ga0495629_0103927
907 Ga0495629_0312946
908 Ga0495638_0342258
909 Ga0495653_0212447
910 Ga0495580_0261697
911 Ga0495582_0082093
912 Ga0495582_0190695
913 Ga0495582_0213239
914 Ga0495639_0176089
915 Ga0495639_0291952
916 Ga0495662_0199418
917 Ga0495584_0008739
918 Ga0495584_0434128
919 Ga0495585_0364153
920 Ga0495585_0490483
921 Ga0495607_0379109
922 Ga0495616_0058876
923 Ga0495618_0229839
924 Ga0495618_0643259
925 Ga0495620_0047730
926 Ga0495628_0093954
927 Ga0495628_1048891
928 Ga0495630_0984417
929 Ga0495630_1250943
930 Ga0495644_0217167
931 Ga0495663_0116161
932 Ga0495666_0206768
933 Ga0495665_0193885
934 Ga0495598_0036997
935 Ga0495667_0115698
936 Ga0495667_0327489
937 Ga0495656_0053850
938 Ga0495656_0119074
939 Ga0495656_0651329
940 Ga0495634_0529569
941 Ga0495635_0243130
942 Ga0495661_0436117
943 Ga0495588_0032647
944 Ga0495647_0170516
945 Ga0495658_0039114
946 Ga0495658_0266096
947 Ga0495613_0718260
948 Ga0495624_0017679
949 Ga0495670_0320347
950 Ga0495649_0137484
951 Ga0495589_0259340
952 Ga0495600_0402273
953 Ga0495660_0335209
954 Ga0495581_0704879
955 Ga0495604_0263666
956 Ga0495674_0153403
957 Ga0495674_0286007
958 Ga0495674_0858104
959 Ga0495676_0087007
960 Ga0495676_0204791
961 Ga0495683_0138548
962 Ga0495602_0282846
963 Ga0496100_0008364
964 Ga0496100_0138274
965 Ga0496100_0213208
966 Ga0496100_0227356
967 Ga0496100_0233442
968 Ga0496100_0332337
969 Ga0496100_0718265
970 Ga0496100_0974296
971 Ga0496101_0040008
972 Ga0496101_0221353
973 Ga0496101_0926551
974 Ga0496102_0115760
975 Ga0496102_0293540
976 Ga0496102_0430107
977 Ga0496102_0845818
978 Ga0496103_0108471
979 Ga0496103_0234571
980 Ga0496104_0001213
981 Ga0496104_0014222
982 Ga0496104_0040969
983 Ga0496104_0130058
984 Ga0496104_0288024
985 Ga0496105_0000541
986 Ga0496105_0024581
987 Ga0496105_0050969
988 Ga0496105_0067901
989 Ga0496106_0006452
990 Ga0496106_0096635
991 Ga0496106_0204189
992 Ga0496106_0252005
993 Ga0496107_0007732
994 Ga0496107_0316892
995 Ga0496107_0383353
996 Ga0496108_0000318
997 Ga0496108_0011772
998 Ga0496108_0129158
999 Ga0496108_0321771
1000 Ga0496109_0006745
1001 Ga0496109_0013554
1002 Ga0496109_0090385
1003 Ga0496109_0170879
1004 Ga0496110_0004141
1005 Ga0496110_0164510
1006 Ga0496110_0305128
1007 Ga0496111_0056682
1008 Ga0496112_0009717
1009 Ga0496112_0021727
1010 Ga0496112_0071708
1011 Ga0496113_0005001
1012 Ga0496114_0036628
1013 Ga0496114_0210149
1014 Ga0496114_0252657
1015 Ga0496114_0337480
1016 Ga0496115_0003899
1017 Ga0496115_0010005
1018 Ga0496115_0014735
1019 Ga0496115_0899027
1020 Ga0496115_1182497
1021 Ga0496126_0241784
1022 Ga0501032_0011386
1023 Ga0501032_0107018
1024 Ga0501033_0254481
1025 Ga0501033_0786569
1026 Ga0501034_0000032
1027 Ga0501034_0004997
1028 Ga0501034_0125705
1029 Ga0501034_0303951
1030 Ga0501034_0373589
1031 Ga0501034_0444187
1032 Ga0501034_0697450
1033 Ga0501036_0000609
1034 Ga0501036_0016787
1035 Ga0501037_0023928
1036 Ga0501037_0064483
1037 Ga0501037_0789193
1038 Ga0501038_0020959
1039 Ga0501038_0145612
1040 Ga0501038_0204731
1041 Ga0501039_0022514
1042 Ga0501039_0404037
1043 Ga0501040_0692104
1044 Ga0501042_0019094
1045 Ga0501043_0005411
1046 Ga0501043_0105136
1047 Ga0501043_0245014
1048 Ga0501043_0435482
1049 Ga0501043_0499014
1050 Ga0501046_0027303
1051 Ga0501046_0077550
1052 Ga0501047_0000228
1053 Ga0501047_0049346
1054 Ga0501047_0052228
1055 Ga0501047_0114510
1056 Ga0501047_0751902
1057 Ga0501048_0000331
1058 Ga0501048_0024570
1059 Ga0501067_0001841
1060 Ga0501068_0038784
1061 Ga0501068_0775592
1062 Ga0501069_0032018
1063 Ga0501069_0111689
1064 Ga0501070_0043220
1065 Ga0501070_0069980
1066 Ga0501070_0400810
1067 Ga0501070_0518706
1068 Ga0501070_0861324
1069 Ga0501070_0896991
1070 Ga0501071_0350607
1071 Ga0501072_0184215
1072 Ga0501072_0315141
1073 Ga0501072_0417723
1074 Ga0501072_0768120
1075 Ga0501073_0010782
1076 Ga0501074_0018558
1077 Ga0501074_0031882
1078 Ga0501076_0163834
1079 Ga0501076_0433184
1080 Ga0501076_1482982
1081 Ga0501077_0148557
1082 Ga0501077_0968200
1083 Ga0501079_0049757
1084 Ga0501079_0199040
1085 Ga0501080_0001137
1086 Ga0501080_0074137
1087 Ga0501080_1004043
1088 Ga0501083_0002769
1089 Ga0501083_0038360
1090 Ga0501083_0178281
1091 Ga0501083_0860625
1092 Ga0501035_0112591
1093 Ga0501035_0180174
1094 Ga0501035_0673271
1095 Ga0501035_0913195
1096 Ga0501044_0000782
1097 Ga0501044_0018377
1098 Ga0501044_0059259
1099 Ga0501044_0203079
1100 Ga0501044_1013970
1101 Ga0501045_0003187
1102 Ga0501045_0070136
1103 Ga0501045_0407144
1104 nmdc:mga03683_590826_c1
1105 nmdc:mga00v17_597715_c1
1106 nmdc:mga0yw44_1212101_c1
1107 nmdc:mga0yw44_153362_c1
1108 nmdc:mga0yw44_42685_c1
1109 nmdc:mga0k408_728160_c1
1110 nmdc:mga06z11_261592_c1
1111 nmdc:mga06z11_877434_c1
1112 nmdc:mga05p37_262792_c1
1113 nmdc:mga05p37_264939_c1
1114 nmdc:mga09592_128978_c1
1115 nmdc:mga06r32_283464_c1
1116 nmdc:mga06r32_556107_c1
1117 nmdc:mga08y16_1290748_c1
1118 nmdc:mga08y16_169420_c1
1119 nmdc:mga08y16_521125_c1
1120 nmdc:mga0n895_111662_c1
1121 nmdc:mga0n895_1870673_c1
1122 nmdc:mga0n895_210066_c1
1123 nmdc:mga0n895_511824_c1
1124 nmdc:mga0rr50_490234_c1
1125 nmdc:mga08x19_145463_c1
1126 nmdc:mga0a205_131420_c1
1127 Ga0495601_0039408
1128 Ga0495612_0161761
1129 Ga0495612_0444440
1130 Ga0495655_0043554
1131 Ga0495595_0110746
1132 Ga0495595_0140510
1133 Ga0495619_0050556
1134 Ga0495619_0166015
1135 Ga0495619_0552514
1136 Ga0501084_0072200
1137 Ga0501084_0102459
1138 Ga0501084_0620307
1139 Ga0501082_0007071
1140 Ga0501082_0221014
1141 Ga0501082_0237531
1142 Ga0530510_0671069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04126

Cyclophil_like

Cyclophilin-like

31

150

0.98

PF18050

Cyclophil_like2

Cyclophilin-like family

35

149

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ka0-assembly1.cif.gz_A nmr structure of the protein tm1367 0.9132 3 121
2nnz-assembly1.cif.gz_A solution structure of the hypothetical protein af2241 from archaeoglobus fulgidus 0.8641 2 123
2nnz-assembly1.cif.gz_A solution structure of the hypothetical protein af2241 from archaeoglobus fulgidus 0.8454 2 123
2p0o-assembly1.cif.gz_A crystal structure of a conserved protein from locus ef_2437 in enterococcus faecalis with an unknown function 0.6342 16 117
2mc9-assembly1.cif.gz_A cat r 1 0.5969 2 124
ID Description Score Start End Superfamily
2ka0A00 Mainly Beta;Beta Barrel;Cyclophilin; 0.9132 3 121 2.40.100.20
3x27B01 Mainly Beta;Beta Barrel;Cyclophilin; 0.6725 1 124 2.40.100.20
3x27B01 Mainly Beta;Beta Barrel;Cyclophilin; 0.6676 1 124 2.40.100.20
af_Q4DG41_146_315_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.64 2 124 2.40.100.10
af_Q4DG41_146_315_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.6315 2 124 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A363TY41-F1-model_v4 Cyclophilin TM1367-like domain-containing protein 1.003 3 124
AF-V5SFT1-F1-model_v4 Cyclophilin TM1367-like domain-containing protein 0.9956 2 124
AF-A0A0S8A895-F1-model_v4 Cyclophilin TM1367-like domain-containing protein 0.9951 1 124
AF-N0B2W9-F1-model_v4 Cyclophilin TM1367-like domain-containing protein 0.9934 1 124
AF-A0A522M565-F1-model_v4 Cyclophilin TM1367-like domain-containing protein 0.9932 1 123

Map