F464839

General Info

Members Datasets Scaffolds Average Seq Length
570 265 1140 239

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10014015|Ga0265318_100140153
Length 264
Sequence MSDSAASPPPGGSEHPTVEDATAKEVLGHGDLKPILPGPGGSDYERYLLTDELLQLQKTPEQMVHRDELLFQTVHQSSELWLKLAVFETDEAIARMAEDDLVLAVRLLGRAHHCVILVTDALHVLERLSPWEYHVVRTALGHGSGFDSPGWKELRRQAAPLWDAFTGVLARRDLVLSDAYVRERQHPSVYDLAEGLIELDERIAIWRSVHVKMVQRVIGGGAVGTQGTPVAVLAGMTTKELFPQLWAVRNRLTEIAAGPDAGPR

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
265 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 1.23
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 12.63
Rhizosphere 86.32
Stem 0
Stem Tuber 0
Unclassified 10.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10014015 3300028577 Bacteria 3370
2 JGI25406J46586_10080291 3300003203 Bacteria 1002
3 JGI25407J50210_10014442 3300003373 Bacteria 2034
4 Ga0070658_10016451 3300005327 Bacteria 5920
5 Ga0070658_10040928 3300005327 Bacteria 3738
6 Ga0070658_10049017 3300005327 Bacteria 3421
7 Ga0070658_10092206 3300005327 Bacteria 2498
8 Ga0070658_10387276 3300005327 Unclassified 1200
9 Ga0070683_100061095 3300005329 Bacteria 3503
10 Ga0070683_100066728 3300005329 Bacteria 3352
11 Ga0070683_100110188 3300005329 Bacteria 2597
12 Ga0070683_100770465 3300005329 Bacteria 922
13 Ga0070690_100085767 3300005330 Bacteria 2066
14 Ga0070670_100025990 3300005331 Bacteria 5039
15 Ga0070666_10177948 3300005335 Bacteria 1491
16 Ga0070680_100003049 3300005336 Bacteria 12438
17 Ga0070680_100010216 3300005336 Bacteria 7237
18 Ga0070680_100033936 3300005336 Bacteria 4115
19 Ga0070660_100001274 3300005339 Bacteria 17185
20 Ga0070660_100006046 3300005339 Bacteria 8369
21 Ga0070660_100008306 3300005339 Bacteria 7258
22 Ga0070660_100080032 3300005339 Bacteria 2563
23 Ga0070660_100271023 3300005339 Bacteria 1387
24 Ga0070660_100288991 3300005339 Bacteria 1342
25 Ga0070687_100059109 3300005343 Bacteria 2017
26 Ga0070687_100143275 3300005343 Unclassified 1394
27 Ga0070661_100471004 3300005344 Bacteria 1002
28 Ga0070668_100404752 3300005347 Bacteria 1166
29 Ga0070668_100662561 3300005347 Bacteria 918
30 Ga0070669_100367634 3300005353 Bacteria 1171
31 Ga0070671_100451631 3300005355 Bacteria 1103
32 Ga0070674_100315940 3300005356 Bacteria 1251
33 Ga0070673_100478308 3300005364 Bacteria 1124
34 Ga0070688_100283294 3300005365 Unclassified 1192
35 Ga0070688_100396806 3300005365 Bacteria 1020
36 Ga0070659_100042532 3300005366 Bacteria 3552
37 Ga0070659_100145899 3300005366 Bacteria 1928
38 Ga0070659_100440456 3300005366 Unclassified 1104
39 Ga0070714_100020134 3300005435 Bacteria 5445
40 Ga0070714_100098418 3300005435 Bacteria 2573
41 Ga0070714_100168048 3300005435 Bacteria 1989
42 Ga0070713_100079436 3300005436 Bacteria 2794
43 Ga0070710_10003636 3300005437 Bacteria 7298
44 Ga0070710_10030562 3300005437 Bacteria 2899
45 Ga0070711_100099829 3300005439 Bacteria 2110
46 Ga0070705_100030507 3300005440 Bacteria 2977
47 Ga0070700_100227345 3300005441 Bacteria 1326
48 Ga0070678_100003977 3300005456 Bacteria 8312
49 Ga0070678_100571544 3300005456 Bacteria 1006
50 Ga0070681_10027877 3300005458 Bacteria 5678
51 Ga0070681_10052265 3300005458 Bacteria 4075
52 Ga0070681_10059704 3300005458 Bacteria 3793
53 Ga0070681_10061412 3300005458 Bacteria 3732
54 Ga0070681_10107228 3300005458 Unclassified 2734
55 Ga0070681_10252219 3300005458 Bacteria 1677
56 Ga0068867_100188937 3300005459 Bacteria 1642
57 Ga0070707_100000564 3300005468 Bacteria 37210
58 Ga0070707_100002679 3300005468 Bacteria 16930
59 Ga0070707_100070572 3300005468 Unclassified 3365
60 Ga0070707_100107049 3300005468 Unclassified 2712
61 Ga0070707_100474983 3300005468 Bacteria 1212
62 Ga0070698_100077255 3300005471 Bacteria 3330
63 Ga0070698_100298506 3300005471 Bacteria 1542
64 Ga0070698_100342691 3300005471 Unclassified 1426
65 Ga0070699_100014051 3300005518 Bacteria 6888
66 Ga0070699_100060390 3300005518 Bacteria 3285
67 Ga0070679_100050939 3300005530 Bacteria 4124
68 Ga0070679_100066780 3300005530 Unclassified 3586
69 Ga0070679_100086395 3300005530 Bacteria 3123
70 Ga0070679_100261540 3300005530 Bacteria 1686
71 Ga0070684_100029809 3300005535 Bacteria 4628
72 Ga0070684_100116170 3300005535 Unclassified 2403
73 Ga0070684_100135651 3300005535 Bacteria 2223
74 Ga0070684_100148894 3300005535 Bacteria 2120
75 Ga0070697_100695291 3300005536 Bacteria 897
76 Ga0070686_100018433 3300005544 Bacteria 4096
77 Ga0070693_100052527 3300005547 Bacteria 2337
78 Ga0068855_100039010 3300005563 Bacteria 5639
79 Ga0068855_100098184 3300005563 Bacteria 3374
80 Ga0068855_100133454 3300005563 Bacteria 2834
81 Ga0068855_100477473 3300005563 Unclassified 1357
82 Ga0070664_100133090 3300005564 Bacteria 2185
83 Ga0070664_100224139 3300005564 Bacteria 1683
84 Ga0068856_100035578 3300005614 Bacteria 4881
85 Ga0068856_100157678 3300005614 Bacteria 2280
86 Ga0070702_100001634 3300005615 Bacteria 9284
87 Ga0070702_100269721 3300005615 Bacteria 1163
88 Ga0068852_100161058 3300005616 Bacteria 2095
89 Ga0068859_100357187 3300005617 Bacteria 1556
90 Ga0068859_100628937 3300005617 Unclassified 1166
91 Ga0068864_100344323 3300005618 Bacteria 1405
92 Ga0068863_100559333 3300005841 Bacteria 1130
93 Ga0068858_100145326 3300005842 Bacteria 2227
94 Ga0068860_100066540 3300005843 Bacteria 3423
95 Ga0068862_100389015 3300005844 Unclassified 1302
96 Ga0081538_10012525 3300005981 Bacteria 6793
97 Ga0081538_10032379 3300005981 Bacteria 3504
98 Ga0081539_10007824 3300005985 Bacteria 9556
99 Ga0070717_10028788 3300006028 Bacteria 4451
100 Ga0070717_10052779 3300006028 Archaea 3350
101 Ga0070717_10062457 3300006028 Bacteria 3088
102 Ga0070717_10357924 3300006028 Unclassified 1306
103 Ga0075364_10458396 3300006051 Bacteria 871
104 Ga0070715_10001308 3300006163 Bacteria 7164
105 Ga0070716_100076432 3300006173 Bacteria 1984
106 Ga0070716_100321127 3300006173 Bacteria 1085
107 Ga0070712_100016545 3300006175 Bacteria 4764
108 Ga0070712_100160763 3300006175 Bacteria 1734
109 Ga0075366_10013952 3300006195 Bacteria 4582
110 Ga0097621_100012081 3300006237 Bacteria 6391
111 Ga0097621_100804290 3300006237 Bacteria 871
112 Ga0068871_100013798 3300006358 Bacteria 6006
113 Ga0068871_100452888 3300006358 Bacteria 1151
114 Ga0075428_100032148 3300006844 Bacteria 5796
115 Ga0075428_100754063 3300006844 Bacteria 1036
116 Ga0075431_100116771 3300006847 Bacteria 2754
117 Ga0075433_10289865 3300006852 Unclassified 1450
118 Ga0075433_10589192 3300006852 Unclassified 976
119 Ga0075434_100045175 3300006871 Bacteria 4369
120 Ga0075434_100348617 3300006871 Bacteria 1502
121 Ga0068865_100033811 3300006881 Bacteria 3425
122 Ga0097620_100357190 3300006931 Bacteria 1556
123 Ga0097620_100628894 3300006931 Unclassified 1166
124 Ga0105240_10022366 3300009093 Bacteria 8384
125 Ga0105240_10171167 3300009093 Bacteria 2572
126 Ga0105240_10308657 3300009093 Bacteria 1807
127 Ga0105240_10309496 3300009093 Unclassified 1804
128 Ga0111539_10385547 3300009094 Bacteria 1632
129 Ga0105245_10233885 3300009098 Unclassified 1778
130 Ga0105245_10291516 3300009098 Bacteria 1598
131 Ga0105247_10034756 3300009101 Bacteria 3070
132 Ga0114129_10023581 3300009147 Bacteria 8721
133 Ga0114129_10117350 3300009147 Bacteria 3667
134 Ga0114129_10326199 3300009147 Bacteria 2040
135 Ga0114129_10742024 3300009147 Bacteria 1258
136 Ga0114129_10841457 3300009147 Bacteria 1167
137 Ga0105243_10417329 3300009148 Bacteria 1251
138 Ga0105241_10056849 3300009174 Bacteria 3000
139 Ga0105241_10325310 3300009174 Bacteria 1327
140 Ga0105242_10017818 3300009176 Bacteria 5542
141 Ga0105248_10038573 3300009177 Bacteria 5347
142 Ga0105248_10328278 3300009177 Bacteria 1723
143 Ga0105237_10106611 3300009545 Unclassified 2794
144 Ga0105237_10772395 3300009545 Bacteria 968
145 Ga0105239_10535184 3300010375 Bacteria 1334
146 Ga0105239_10601533 3300010375 Bacteria 1254
147 Ga0157373_10118462 3300013100 Bacteria 1861
148 Ga0157371_10527720 3300013102 Unclassified 873
149 Ga0157370_10031814 3300013104 Bacteria 5158
150 Ga0157370_10037626 3300013104 Bacteria 4690
151 Ga0157370_10138047 3300013104 Bacteria 2271
152 Ga0157370_10491188 3300013104 Unclassified 1128
153 Ga0157369_10011147 3300013105 Bacteria 10221
154 Ga0157369_10128406 3300013105 Bacteria 2687
155 Ga0157374_10349444 3300013296 Unclassified 1469
156 Ga0157378_10015965 3300013297 Bacteria 6577
157 Ga0157378_10564026 3300013297 Bacteria 1146
158 Ga0163162_10097972 3300013306 Unclassified 3021
159 Ga0163162_10113003 3300013306 Bacteria 2814
160 Ga0163162_10153990 3300013306 Bacteria 2418
161 Ga0157375_10011961 3300013308 Bacteria 7683
162 Ga0163163_10362654 3300014325 Bacteria 1506
163 Ga0157380_10190851 3300014326 Bacteria 1809
164 Ga0182008_10004439 3300014497 Bacteria 8200
165 Ga0157379_10011774 3300014968 Bacteria 7640
166 Ga0157376_10003286 3300014969 Bacteria 11129
167 Ga0157376_10061894 3300014969 Bacteria 3148
168 Ga0182005_1079036 3300015265 Bacteria 907
169 Ga0206356_11755113 3300020070 Bacteria 6781
170 Ga0206356_11796933 3300020070 Unclassified 1957
171 Ga0206354_10349833 3300020081 Bacteria 4251
172 Ga0206354_10686985 3300020081 Bacteria 2086
173 Ga0206353_10249266 3300020082 Bacteria 4521
174 Ga0206353_10832986 3300020082 Bacteria 3642
175 Ga0224712_10078784 3300022467 Unclassified 1355
176 Ga0207692_10063150 3300025898 Bacteria 1924
177 Ga0207642_10010306 3300025899 Bacteria 3290
178 Ga0207685_10003356 3300025905 Bacteria 3883
179 Ga0207685_10113254 3300025905 Bacteria 1179
180 Ga0207699_10003512 3300025906 Bacteria 7483
181 Ga0207699_10061930 3300025906 Bacteria 2253
182 Ga0207705_10052409 3300025909 Bacteria 2937
183 Ga0207705_10087639 3300025909 Bacteria 2276
184 Ga0207705_10173174 3300025909 Bacteria 1626
185 Ga0207705_10223807 3300025909 Unclassified 1430
186 Ga0207705_10247077 3300025909 Bacteria 1360
187 Ga0207684_10186259 3300025910 Bacteria 1790
188 Ga0207654_10044404 3300025911 Bacteria 2524
189 Ga0207707_10031560 3300025912 Bacteria 4636
190 Ga0207707_10060192 3300025912 Bacteria 3304
191 Ga0207707_10208524 3300025912 Bacteria 1703
192 Ga0207707_10429256 3300025912 Unclassified 1132
193 Ga0207695_10120043 3300025913 Bacteria 2598
194 Ga0207695_10276980 3300025913 Bacteria 1572
195 Ga0207695_10445533 3300025913 Bacteria 1178
196 Ga0207695_10512087 3300025913 Bacteria 1082
197 Ga0207693_10000818 3300025915 Bacteria 27776
198 Ga0207693_10005938 3300025915 Bacteria 10132
199 Ga0207693_10073224 3300025915 Bacteria 2682
200 Ga0207660_10034649 3300025917 Bacteria 3500
201 Ga0207660_10040722 3300025917 Bacteria 3253
202 Ga0207660_10059546 3300025917 Bacteria 2742
203 Ga0207660_10138327 3300025917 Bacteria 1860
204 Ga0207657_10002391 3300025919 Bacteria 20291
205 Ga0207657_10003035 3300025919 Bacteria 17975
206 Ga0207657_10005937 3300025919 Bacteria 12708
207 Ga0207657_10008522 3300025919 Bacteria 10397
208 Ga0207657_10009267 3300025919 Bacteria 9917
209 Ga0207657_10160303 3300025919 Bacteria 1827
210 Ga0207649_10049597 3300025920 Bacteria 2593
211 Ga0207649_10067779 3300025920 Bacteria 2267
212 Ga0207652_10034039 3300025921 Bacteria 4292
213 Ga0207652_10047859 3300025921 Bacteria 3653
214 Ga0207652_10148766 3300025921 Unclassified 2096
215 Ga0207652_10346927 3300025921 Bacteria 1340
216 Ga0207646_10003389 3300025922 Bacteria 18004
217 Ga0207646_10016098 3300025922 Bacteria 7027
218 Ga0207646_10100926 3300025922 Bacteria 2587
219 Ga0207646_10552323 3300025922 Bacteria 1035
220 Ga0207646_10606091 3300025922 Bacteria 983
221 Ga0207650_10540960 3300025925 Bacteria 976
222 Ga0207659_10693638 3300025926 Unclassified 872
223 Ga0207687_10044009 3300025927 Bacteria 3078
224 Ga0207687_10107179 3300025927 Bacteria 2067
225 Ga0207687_10382267 3300025927 Bacteria 1154
226 Ga0207700_10000039 3300025928 Bacteria 102496
227 Ga0207700_10014054 3300025928 Bacteria 5233
228 Ga0207664_10009424 3300025929 Bacteria 6851
229 Ga0207664_10012053 3300025929 Bacteria 6173
230 Ga0207690_10077170 3300025932 Bacteria 2315
231 Ga0207690_10172053 3300025932 Unclassified 1623
232 Ga0207690_10199168 3300025932 Bacteria 1520
233 Ga0207709_10122612 3300025935 Bacteria 1757
234 Ga0207669_10079254 3300025937 Bacteria 2096
235 Ga0207704_10231572 3300025938 Bacteria 1374
236 Ga0207665_10002350 3300025939 Bacteria 12766
237 Ga0207665_10016380 3300025939 Bacteria 4867
238 Ga0207689_10116685 3300025942 Bacteria 2194
239 Ga0207661_10024230 3300025944 Bacteria 4597
240 Ga0207661_10031873 3300025944 Bacteria 4077
241 Ga0207661_10111033 3300025944 Bacteria 2319
242 Ga0207661_10151595 3300025944 Unclassified 2004
243 Ga0207679_10175849 3300025945 Bacteria 1767
244 Ga0207667_10248127 3300025949 Bacteria 1821
245 Ga0207667_10386539 3300025949 Unclassified 1425
246 Ga0207651_10100464 3300025960 Unclassified 2145
247 Ga0207651_10148194 3300025960 Bacteria 1823
248 Ga0207651_10611286 3300025960 Unclassified 954
249 Ga0207712_10126173 3300025961 Bacteria 1943
250 Ga0207703_10035591 3300026035 Bacteria 3956
251 Ga0207639_10182759 3300026041 Bacteria 1785
252 Ga0207639_10523223 3300026041 Bacteria 1086
253 Ga0207678_10053357 3300026067 Bacteria 3483
254 Ga0207708_10171275 3300026075 Bacteria 1719
255 Ga0207702_10630616 3300026078 Unclassified 1053
256 Ga0207641_10414430 3300026088 Bacteria 1296
257 Ga0207675_100317315 3300026118 Bacteria 1521
258 Ga0207683_10000244 3300026121 Bacteria 48306
259 Ga0207683_10658497 3300026121 Bacteria 970
260 Ga0207698_10503741 3300026142 Bacteria 1179
261 Ga0268265_10885511 3300028380 Bacteria 876
262 Ga0265319_1029278 3300028563 Bacteria 1934
263 Ga0265318_10004002 3300028577 Bacteria 7243
264 Ga0265322_10029714 3300028654 Bacteria 1561
265 Ga0265330_10023818 3300031235 Bacteria 2779
266 Ga0265320_10099911 3300031240 Bacteria 1337
267 Ga0265329_10008096 3300031242 Bacteria 4016
268 Ga0265340_10058722 3300031247 Bacteria 1847
269 Ga0265327_10006570 3300031251 Bacteria 9246
270 Ga0265327_10010040 3300031251 Bacteria 6724
271 Ga0307408_100395621 3300031548 Bacteria 1185
272 Ga0265314_10017125 3300031711 Bacteria 5697
273 Ga0307409_100575043 3300031995 Bacteria 1110
274 Ga0307416_100010707 3300032002 Bacteria 6077
275 Ga0307416_100218606 3300032002 Bacteria 1825
276 Ga0373926_0116084 3300035083 Unclassified 1007
277 Ga0373934_0189240 3300035086 Bacteria 847
278 Ga0373960_0038352 3300035121 Bacteria 1373
279 Ga0373946_0025614 3300035171 Bacteria 2321
280 Ga0373947_0096308 3300035725 Bacteria 1853
281 Ga0373925_0231844 3300037068 Bacteria 1477
282 Ga0373925_0310369 3300037068 Bacteria 1275
283 Ga0373925_0609769 3300037068 Bacteria 899
284 Ga0395899_0018252 3300037312 Bacteria 5336
285 Ga0395899_0034937 3300037312 Bacteria 3774
286 Ga0395899_0040228 3300037312 Bacteria 3497
287 Ga0395899_0114785 3300037312 Bacteria 1934
288 Ga0395899_0193100 3300037312 Bacteria 1424
289 Ga0395899_0244667 3300037312 Bacteria 1233
290 Ga0395900_0000528 3300037418 Bacteria 53945
291 Ga0395900_0001894 3300037418 Bacteria 23794
292 Ga0395900_0003881 3300037418 Bacteria 15977
293 Ga0395900_0005059 3300037418 Bacteria 13833
294 Ga0395900_0046097 3300037418 Bacteria 4489
295 Ga0395900_0062611 3300037418 Bacteria 3824
296 Ga0395900_0064367 3300037418 Bacteria 3768
297 Ga0395900_0074470 3300037418 Bacteria 3490
298 Ga0395900_0194234 3300037418 Bacteria 2057
299 Ga0395900_0243910 3300037418 Bacteria 1801
300 Ga0395900_0248295 3300037418 Unclassified 1782
301 Ga0395900_0283704 3300037418 Bacteria 1647
302 Ga0395900_0385815 3300037418 Bacteria 1368
303 Ga0395898_0003441 3300037466 Bacteria 17697
304 Ga0395898_0008250 3300037466 Bacteria 11015
305 Ga0395898_0018085 3300037466 Bacteria 7191
306 Ga0395898_0026566 3300037466 Bacteria 5822
307 Ga0395898_0053098 3300037466 Bacteria 3958
308 Ga0395898_0059067 3300037466 Bacteria 3732
309 Ga0395898_0126222 3300037466 Bacteria 2451
310 Ga0395898_0359725 3300037466 Bacteria 1388
311 Ga0395898_0419399 3300037466 Bacteria 1275
312 Ga0395898_0505407 3300037466 Unclassified 1149
313 Ga0395898_0798967 3300037466 Bacteria 884
314 Ga0395905_0000661 3300037471 Bacteria 45819
315 Ga0395905_0004596 3300037471 Bacteria 14282
316 Ga0395905_0008537 3300037471 Bacteria 10103
317 Ga0395905_0018346 3300037471 Bacteria 6641
318 Ga0395905_0022508 3300037471 Bacteria 5961
319 Ga0395905_0052557 3300037471 Unclassified 3814
320 Ga0395905_0085490 3300037471 Bacteria 2956
321 Ga0395905_0094808 3300037471 Bacteria 2800
322 Ga0395905_0386682 3300037471 Bacteria 1293
323 Ga0395905_0512241 3300037471 Unclassified 1100
324 Ga0395901_0001886 3300038443 Bacteria 21635
325 Ga0395901_0004561 3300038443 Bacteria 13983
326 Ga0395901_0008256 3300038443 Bacteria 10521
327 Ga0395901_0012865 3300038443 Bacteria 8487
328 Ga0395901_0042772 3300038443 Bacteria 4698
329 Ga0395901_0050560 3300038443 Bacteria 4318
330 Ga0395901_0080362 3300038443 Bacteria 3404
331 Ga0395901_0082765 3300038443 Bacteria 3353
332 Ga0395901_0143158 3300038443 Unclassified 2513
333 Ga0395901_0194876 3300038443 Bacteria 2124
334 Ga0395901_0254097 3300038443 Bacteria 1830
335 Ga0395901_0712479 3300038443 Unclassified 1000
336 Ga0395901_0955913 3300038443 Unclassified 835
337 Ga0242420_022368 3300038996 Bacteria 1137
338 Ga0439436_0054626 3300041404 Bacteria 1123
339 Ga0439439_0002709 3300041406 Bacteria 3806
340 Ga0451853_1011961 3300041512 Bacteria 1594
341 Ga0451853_1203820 3300041512 Unclassified 1928
342 Ga0451853_3483484 3300041512 Bacteria 1187
343 Ga0439431_0034226 3300041997 Bacteria 1273
344 Ga0439433_0005929 3300041999 Bacteria 2624
345 Ga0439462_0026125 3300042015 Bacteria 1538
346 Ga0439434_0025744 3300042435 Bacteria 1776
347 Ga0466961_0007871 3300044693 Bacteria 6786
348 Ga0466963_0000333 3300044694 Bacteria 21482
349 Ga0466963_0002587 3300044694 Bacteria 10153
350 Ga0466963_0008710 3300044694 Bacteria 6091
351 Ga0466963_0057242 3300044694 Bacteria 2596
352 Ga0466963_0064759 3300044694 Bacteria 2450
353 Ga0466963_0103432 3300044694 Bacteria 1951
354 Ga0466963_0155732 3300044694 Bacteria 1588
355 Ga0466968_0012403 3300044735 Bacteria 3336
356 Ga0466968_0021646 3300044735 Bacteria 2605
357 Ga0466957_0028582 3300044842 Bacteria 3321
358 Ga0466957_0096108 3300044842 Unclassified 1861
359 Ga0466959_0002176 3300045049 Bacteria 12468
360 Ga0466958_0003251 3300045836 Bacteria 8394
361 Ga0466958_0036990 3300045836 Bacteria 2923
362 Ga0466958_0209032 3300045836 Bacteria 1243
363 Ga0466967_0000209 3300045976 Bacteria 24700
364 Ga0466967_0002179 3300045976 Bacteria 12048
365 Ga0466967_0020671 3300045976 Bacteria 5327
366 Ga0466967_0035665 3300045976 Bacteria 4237
367 Ga0466967_0061409 3300045976 Bacteria 3334
368 Ga0466967_0077263 3300045976 Bacteria 2997
369 Ga0466967_0080740 3300045976 Bacteria 2935
370 Ga0466967_0139681 3300045976 Bacteria 2255
371 Ga0466967_0252985 3300045976 Archaea 1683
372 Ga0495592_0171637 3300046454 Bacteria 1485
373 Ga0495603_0020627 3300046455 Bacteria 3993
374 Ga0495603_0104418 3300046455 Bacteria 1654
375 Ga0495629_0125227 3300046459 Bacteria 1790
376 Ga0495651_0235837 3300046462 Bacteria 1257
377 Ga0495651_0445049 3300046462 Bacteria 838
378 Ga0495653_0087201 3300046463 Bacteria 2293
379 Ga0495582_0068060 3300046473 Bacteria 1968
380 Ga0495605_0018812 3300046474 Bacteria 3698
381 Ga0495639_0306846 3300046475 Bacteria 792
382 Ga0495662_0192159 3300046476 Unclassified 1006
383 Ga0495585_0031145 3300046492 Bacteria 3031
384 Ga0495596_0015174 3300046500 Bacteria 3233
385 Ga0495596_0045663 3300046500 Bacteria 1722
386 Ga0495596_0060863 3300046500 Bacteria 1471
387 Ga0495608_0223809 3300046511 Bacteria 1179
388 Ga0495630_0016469 3300046517 Bacteria 5403
389 Ga0495663_0023754 3300046525 Bacteria 1778
390 Ga0495652_0137166 3300046529 Bacteria 1929
391 Ga0495640_0190851 3300046533 Unclassified 1302
392 Ga0495609_0030436 3300046538 Bacteria 2457
393 Ga0495609_0219508 3300046538 Unclassified 790
394 Ga0495621_0178881 3300046539 Bacteria 846
395 Ga0495645_0177638 3300046543 Unclassified 1461
396 Ga0495667_0168655 3300046559 Bacteria 1407
397 Ga0495656_0001601 3300046615 Bacteria 7407
398 Ga0495634_0228376 3300046642 Bacteria 1146
399 Ga0495634_0348923 3300046642 Unclassified 886
400 Ga0495635_0043899 3300046663 Bacteria 3084
401 Ga0495635_0064517 3300046663 Bacteria 2514
402 Ga0495588_0240013 3300046674 Bacteria 956
403 Ga0495588_0280075 3300046674 Bacteria 879
404 Ga0495657_0181305 3300046675 Bacteria 1292
405 Ga0495669_0047283 3300046684 Bacteria 1922
406 Ga0495613_0012660 3300046689 Bacteria 6271
407 Ga0495624_0055579 3300046690 Bacteria 2493
408 Ga0495670_0091387 3300046691 Bacteria 1558
409 Ga0495671_0124698 3300046692 Bacteria 1256
410 Ga0495589_0042213 3300046794 Bacteria 2273
411 Ga0495581_0000417 3300047315 Bacteria 21522
412 Ga0495604_0211478 3300047317 Bacteria 1340
413 Ga0495674_0076457 3300047319 Bacteria 2880
414 Ga0495674_0188440 3300047319 Bacteria 1715
415 Ga0495676_0106615 3300047321 Bacteria 2064
416 Ga0495676_0246061 3300047321 Bacteria 1222
417 Ga0495680_0052372 3300047322 Bacteria 3182
418 Ga0495684_0075353 3300047471 Bacteria 2564
419 Ga0495602_0086834 3300048088 Bacteria 2610
420 Ga0496100_0006416 3300048903 Bacteria 6409
421 Ga0496100_0125211 3300048903 Bacteria 1803
422 Ga0496100_0207789 3300048903 Bacteria 1430
423 Ga0496100_0301429 3300048903 Bacteria 1199
424 Ga0496100_0494460 3300048903 Bacteria 942
425 Ga0496101_0006449 3300048904 Bacteria 7549
426 Ga0496101_0026024 3300048904 Bacteria 4065
427 Ga0496101_0066778 3300048904 Bacteria 2624
428 Ga0496102_0012569 3300048905 Bacteria 7333
429 Ga0496102_0014475 3300048905 Bacteria 6853
430 Ga0496102_0098304 3300048905 Bacteria 2716
431 Ga0496102_0355678 3300048905 Bacteria 1379
432 Ga0496102_0483468 3300048905 Unclassified 1160
433 Ga0496103_0092677 3300048906 Bacteria 1907
434 Ga0496103_0095035 3300048906 Bacteria 1883
435 Ga0496103_0128488 3300048906 Bacteria 1617
436 Ga0496104_0013441 3300048907 Bacteria 7377
437 Ga0496104_0063124 3300048907 Bacteria 3512
438 Ga0496104_0160823 3300048907 Bacteria 2154
439 Ga0496104_0302157 3300048907 Bacteria 1512
440 Ga0496105_0001228 3300048908 Bacteria 17859
441 Ga0496105_0020008 3300048908 Bacteria 5402
442 Ga0496105_0021241 3300048908 Bacteria 5253
443 Ga0496105_0037431 3300048908 Bacteria 3994
444 Ga0496105_0133054 3300048908 Bacteria 2049
445 Ga0496105_0264549 3300048908 Bacteria 1390
446 Ga0496105_0401365 3300048908 Unclassified 1088
447 Ga0496106_0053154 3300048909 Bacteria 3058
448 Ga0496106_0057478 3300048909 Bacteria 2941
449 Ga0496106_0277978 3300048909 Bacteria 1341
450 Ga0496106_0561736 3300048909 Unclassified 915
451 Ga0496107_0005213 3300048910 Bacteria 8874
452 Ga0496107_0007526 3300048910 Bacteria 7514
453 Ga0496107_0048091 3300048910 Bacteria 3072
454 Ga0496108_0041373 3300048911 Bacteria 3847
455 Ga0496108_0051867 3300048911 Bacteria 3436
456 Ga0496108_0052866 3300048911 Bacteria 3405
457 Ga0496108_0094885 3300048911 Bacteria 2539
458 Ga0496108_0502727 3300048911 Bacteria 1059
459 Ga0496109_0000534 3300048912 Bacteria 32226
460 Ga0496109_0003943 3300048912 Bacteria 12398
461 Ga0496109_0013496 3300048912 Bacteria 7087
462 Ga0496109_0022004 3300048912 Bacteria 5644
463 Ga0496109_0202736 3300048912 Bacteria 1865
464 Ga0496110_0021631 3300048913 Bacteria 5450
465 Ga0496110_0086793 3300048913 Bacteria 2794
466 Ga0496110_0135212 3300048913 Bacteria 2227
467 Ga0496110_0678910 3300048913 Unclassified 931
468 Ga0496111_0020430 3300048914 Bacteria 4611
469 Ga0496111_0055348 3300048914 Bacteria 2869
470 Ga0496111_0137555 3300048914 Bacteria 1810
471 Ga0496111_0201919 3300048914 Bacteria 1478
472 Ga0496112_0004991 3300048915 Bacteria 11379
473 Ga0496112_0006947 3300048915 Bacteria 9990
474 Ga0496112_0011718 3300048915 Bacteria 8025
475 Ga0496112_0166925 3300048915 Bacteria 2167
476 Ga0496112_0182768 3300048915 Bacteria 2060
477 Ga0496112_0349903 3300048915 Bacteria 1420
478 Ga0496112_0391520 3300048915 Bacteria 1330
479 Ga0496113_0017584 3300048916 Bacteria 4967
480 Ga0496113_0025415 3300048916 Bacteria 4221
481 Ga0496113_0091217 3300048916 Bacteria 2348
482 Ga0496113_0191674 3300048916 Bacteria 1622
483 Ga0496113_0327918 3300048916 Unclassified 1227
484 Ga0496114_0027171 3300048917 Bacteria 4686
485 Ga0496114_0028430 3300048917 Bacteria 4588
486 Ga0496114_0081947 3300048917 Bacteria 2726
487 Ga0496114_0242153 3300048917 Bacteria 1586
488 Ga0496115_0013003 3300048918 Bacteria 6282
489 Ga0496115_0028747 3300048918 Bacteria 4359
490 Ga0496115_0056781 3300048918 Bacteria 3147
491 Ga0496115_0333232 3300048918 Bacteria 1239
492 Ga0501031_0006591 3300049568 Bacteria 7575
493 Ga0501031_0128229 3300049568 Bacteria 1657
494 Ga0501032_0073018 3300049569 Bacteria 2286
495 Ga0501033_0313953 3300049570 Viruses 1102
496 Ga0501034_0023982 3300049571 Bacteria 6209
497 Ga0501034_0089923 3300049571 Bacteria 3068
498 Ga0501034_0260983 3300049571 Bacteria 1675
499 Ga0501036_0021898 3300049572 Bacteria 5374
500 Ga0501036_0045244 3300049572 Bacteria 3729
501 Ga0501037_0095869 3300049573 Bacteria 2144
502 Ga0501038_0009896 3300049574 Bacteria 8729
503 Ga0501038_0589590 3300049574 Bacteria 842
504 Ga0501039_0016892 3300049575 Bacteria 5594
505 Ga0501040_0046624 3300049576 Unclassified 2958
506 Ga0501041_0002462 3300049577 Bacteria 10520
507 Ga0501041_0151173 3300049577 Bacteria 1450
508 Ga0501042_0055196 3300049578 Bacteria 2834
509 Ga0501042_0092381 3300049578 Bacteria 2173
510 Ga0501042_0114286 3300049578 Bacteria 1944
511 Ga0501046_0042882 3300049580 Bacteria 3605
512 Ga0501046_0248059 3300049580 Unclassified 1311
513 Ga0501048_0031141 3300049582 Bacteria 3859
514 Ga0501048_0037765 3300049582 Bacteria 3468
515 Ga0501068_0087383 3300049584 Bacteria 1920
516 Ga0501068_0395273 3300049584 Bacteria 891
517 Ga0501071_0004711 3300049587 Bacteria 8671
518 Ga0501071_0013014 3300049587 Bacteria 5660
519 Ga0501071_0127536 3300049587 Bacteria 1889
520 Ga0501072_0013904 3300049588 Bacteria 6168
521 Ga0501072_0041617 3300049588 Bacteria 3609
522 Ga0501072_0266360 3300049588 Viruses 1363
523 Ga0501073_0042648 3300049589 Archaea 3201
524 Ga0501074_0051737 3300049590 Bacteria 2964
525 Ga0501074_0075866 3300049590 Bacteria 2414
526 Ga0501074_0330554 3300049590 Bacteria 1082
527 Ga0501074_0585778 3300049590 Bacteria 789
528 Ga0501075_0028504 3300049591 Bacteria 4121
529 Ga0501076_0000793 3300049592 Bacteria 20434
530 Ga0501076_0026358 3300049592 Bacteria 4501
531 Ga0501076_0037684 3300049592 Bacteria 3793
532 Ga0501079_0044859 3300049741 Bacteria 3412
533 Ga0501079_0278036 3300049741 Bacteria 1309
534 Ga0501079_0305774 3300049741 Bacteria 1244
535 Ga0501079_0402062 3300049741 Bacteria 1074
536 Ga0501080_0001169 3300049742 Bacteria 21714
537 Ga0501081_0013023 3300049743 Bacteria 5471
538 Ga0501081_0224379 3300049743 Bacteria 1367
539 Ga0501081_0496367 3300049743 Bacteria 909
540 Ga0501083_0070010 3300049744 Bacteria 2334
541 Ga0501035_0158939 3300049822 Bacteria 1957
542 Ga0501035_0416547 3300049822 Bacteria 1116
543 Ga0501045_0003580 3300049824 Bacteria 10667
544 Ga0501045_0062972 3300049824 Bacteria 2722
545 nmdc:mga05p37_10418_c1 3300050507 Bacteria 11033
546 nmdc:mga05p37_119103_c1 3300050507 Bacteria 3244
547 nmdc:mga05p37_476754_c1 3300050507 Bacteria 1438
548 nmdc:mga09592_286904_c1 3300050508 Bacteria 1427
549 nmdc:mga06r32_191220_c1 3300050510 Bacteria 2034
550 nmdc:mga08y16_158686_c1 3300050511 Bacteria 2350
551 nmdc:mga0a205_289376_c1 3300050515 Unclassified 1513
552 nmdc:mga0a205_342200_c1 3300050515 Bacteria 1364
553 Ga0495601_0473464 3300053077 Bacteria 809
554 Ga0495612_0044617 3300053078 Bacteria 1814
555 Ga0495655_0022791 3300053083 Bacteria 1436
556 Ga0495595_0174439 3300053084 Unclassified 1065
557 Ga0495595_0175245 3300053084 Bacteria 1063
558 Ga0495619_0070196 3300053085 Bacteria 2342
559 Ga0501084_0027162 3300054114 Bacteria 4783
560 Ga0501084_0056772 3300054114 Bacteria 3275
561 Ga0501084_0100223 3300054114 Bacteria 2432
562 Ga0501084_0431420 3300054114 Bacteria 1114
563 Ga0590075_001865 3300059424 Bacteria 5123
564 Ga0501082_0012157 3300060353 Bacteria 7396
565 Ga0501082_0740557 3300060353 Bacteria 860
566 Ga0530510_0025275 3300061734 Bacteria 4245
567 Ga0530510_0114957 3300061734 Bacteria 1972
568 Ga0530510_0198736 3300061734 Bacteria 1489
569 Ga0530510_0227817 3300061734 Bacteria 1386
570 2870787652 2870782633 Bacteria 9624083
571 Ga0265318_10014015
572 JGI25406J46586_10080291
573 JGI25407J50210_10014442
574 Ga0070658_10016451
575 Ga0070658_10040928
576 Ga0070658_10049017
577 Ga0070658_10092206
578 Ga0070658_10387276
579 Ga0070683_100061095
580 Ga0070683_100066728
581 Ga0070683_100110188
582 Ga0070683_100770465
583 Ga0070690_100085767
584 Ga0070670_100025990
585 Ga0070666_10177948
586 Ga0070680_100003049
587 Ga0070680_100010216
588 Ga0070680_100033936
589 Ga0070660_100001274
590 Ga0070660_100006046
591 Ga0070660_100008306
592 Ga0070660_100080032
593 Ga0070660_100271023
594 Ga0070660_100288991
595 Ga0070687_100059109
596 Ga0070687_100143275
597 Ga0070661_100471004
598 Ga0070668_100404752
599 Ga0070668_100662561
600 Ga0070669_100367634
601 Ga0070671_100451631
602 Ga0070674_100315940
603 Ga0070673_100478308
604 Ga0070688_100283294
605 Ga0070688_100396806
606 Ga0070659_100042532
607 Ga0070659_100145899
608 Ga0070659_100440456
609 Ga0070714_100020134
610 Ga0070714_100098418
611 Ga0070714_100168048
612 Ga0070713_100079436
613 Ga0070710_10003636
614 Ga0070710_10030562
615 Ga0070711_100099829
616 Ga0070705_100030507
617 Ga0070700_100227345
618 Ga0070678_100003977
619 Ga0070678_100571544
620 Ga0070681_10027877
621 Ga0070681_10052265
622 Ga0070681_10059704
623 Ga0070681_10061412
624 Ga0070681_10107228
625 Ga0070681_10252219
626 Ga0068867_100188937
627 Ga0070707_100000564
628 Ga0070707_100002679
629 Ga0070707_100070572
630 Ga0070707_100107049
631 Ga0070707_100474983
632 Ga0070698_100077255
633 Ga0070698_100298506
634 Ga0070698_100342691
635 Ga0070699_100014051
636 Ga0070699_100060390
637 Ga0070679_100050939
638 Ga0070679_100066780
639 Ga0070679_100086395
640 Ga0070679_100261540
641 Ga0070684_100029809
642 Ga0070684_100116170
643 Ga0070684_100135651
644 Ga0070684_100148894
645 Ga0070697_100695291
646 Ga0070686_100018433
647 Ga0070693_100052527
648 Ga0068855_100039010
649 Ga0068855_100098184
650 Ga0068855_100133454
651 Ga0068855_100477473
652 Ga0070664_100133090
653 Ga0070664_100224139
654 Ga0068856_100035578
655 Ga0068856_100157678
656 Ga0070702_100001634
657 Ga0070702_100269721
658 Ga0068852_100161058
659 Ga0068859_100357187
660 Ga0068859_100628937
661 Ga0068864_100344323
662 Ga0068863_100559333
663 Ga0068858_100145326
664 Ga0068860_100066540
665 Ga0068862_100389015
666 Ga0081538_10012525
667 Ga0081538_10032379
668 Ga0081539_10007824
669 Ga0070717_10028788
670 Ga0070717_10052779
671 Ga0070717_10062457
672 Ga0070717_10357924
673 Ga0075364_10458396
674 Ga0070715_10001308
675 Ga0070716_100076432
676 Ga0070716_100321127
677 Ga0070712_100016545
678 Ga0070712_100160763
679 Ga0075366_10013952
680 Ga0097621_100012081
681 Ga0097621_100804290
682 Ga0068871_100013798
683 Ga0068871_100452888
684 Ga0075428_100032148
685 Ga0075428_100754063
686 Ga0075431_100116771
687 Ga0075433_10289865
688 Ga0075433_10589192
689 Ga0075434_100045175
690 Ga0075434_100348617
691 Ga0068865_100033811
692 Ga0097620_100357190
693 Ga0097620_100628894
694 Ga0105240_10022366
695 Ga0105240_10171167
696 Ga0105240_10308657
697 Ga0105240_10309496
698 Ga0111539_10385547
699 Ga0105245_10233885
700 Ga0105245_10291516
701 Ga0105247_10034756
702 Ga0114129_10023581
703 Ga0114129_10117350
704 Ga0114129_10326199
705 Ga0114129_10742024
706 Ga0114129_10841457
707 Ga0105243_10417329
708 Ga0105241_10056849
709 Ga0105241_10325310
710 Ga0105242_10017818
711 Ga0105248_10038573
712 Ga0105248_10328278
713 Ga0105237_10106611
714 Ga0105237_10772395
715 Ga0105239_10535184
716 Ga0105239_10601533
717 Ga0157373_10118462
718 Ga0157371_10527720
719 Ga0157370_10031814
720 Ga0157370_10037626
721 Ga0157370_10138047
722 Ga0157370_10491188
723 Ga0157369_10011147
724 Ga0157369_10128406
725 Ga0157374_10349444
726 Ga0157378_10015965
727 Ga0157378_10564026
728 Ga0163162_10097972
729 Ga0163162_10113003
730 Ga0163162_10153990
731 Ga0157375_10011961
732 Ga0163163_10362654
733 Ga0157380_10190851
734 Ga0182008_10004439
735 Ga0157379_10011774
736 Ga0157376_10003286
737 Ga0157376_10061894
738 Ga0182005_1079036
739 Ga0206356_11755113
740 Ga0206356_11796933
741 Ga0206354_10349833
742 Ga0206354_10686985
743 Ga0206353_10249266
744 Ga0206353_10832986
745 Ga0224712_10078784
746 Ga0207692_10063150
747 Ga0207642_10010306
748 Ga0207685_10003356
749 Ga0207685_10113254
750 Ga0207699_10003512
751 Ga0207699_10061930
752 Ga0207705_10052409
753 Ga0207705_10087639
754 Ga0207705_10173174
755 Ga0207705_10223807
756 Ga0207705_10247077
757 Ga0207684_10186259
758 Ga0207654_10044404
759 Ga0207707_10031560
760 Ga0207707_10060192
761 Ga0207707_10208524
762 Ga0207707_10429256
763 Ga0207695_10120043
764 Ga0207695_10276980
765 Ga0207695_10445533
766 Ga0207695_10512087
767 Ga0207693_10000818
768 Ga0207693_10005938
769 Ga0207693_10073224
770 Ga0207660_10034649
771 Ga0207660_10040722
772 Ga0207660_10059546
773 Ga0207660_10138327
774 Ga0207657_10002391
775 Ga0207657_10003035
776 Ga0207657_10005937
777 Ga0207657_10008522
778 Ga0207657_10009267
779 Ga0207657_10160303
780 Ga0207649_10049597
781 Ga0207649_10067779
782 Ga0207652_10034039
783 Ga0207652_10047859
784 Ga0207652_10148766
785 Ga0207652_10346927
786 Ga0207646_10003389
787 Ga0207646_10016098
788 Ga0207646_10100926
789 Ga0207646_10552323
790 Ga0207646_10606091
791 Ga0207650_10540960
792 Ga0207659_10693638
793 Ga0207687_10044009
794 Ga0207687_10107179
795 Ga0207687_10382267
796 Ga0207700_10000039
797 Ga0207700_10014054
798 Ga0207664_10009424
799 Ga0207664_10012053
800 Ga0207690_10077170
801 Ga0207690_10172053
802 Ga0207690_10199168
803 Ga0207709_10122612
804 Ga0207669_10079254
805 Ga0207704_10231572
806 Ga0207665_10002350
807 Ga0207665_10016380
808 Ga0207689_10116685
809 Ga0207661_10024230
810 Ga0207661_10031873
811 Ga0207661_10111033
812 Ga0207661_10151595
813 Ga0207679_10175849
814 Ga0207667_10248127
815 Ga0207667_10386539
816 Ga0207651_10100464
817 Ga0207651_10148194
818 Ga0207651_10611286
819 Ga0207712_10126173
820 Ga0207703_10035591
821 Ga0207639_10182759
822 Ga0207639_10523223
823 Ga0207678_10053357
824 Ga0207708_10171275
825 Ga0207702_10630616
826 Ga0207641_10414430
827 Ga0207675_100317315
828 Ga0207683_10000244
829 Ga0207683_10658497
830 Ga0207698_10503741
831 Ga0268265_10885511
832 Ga0265319_1029278
833 Ga0265318_10004002
834 Ga0265322_10029714
835 Ga0265330_10023818
836 Ga0265320_10099911
837 Ga0265329_10008096
838 Ga0265340_10058722
839 Ga0265327_10006570
840 Ga0265327_10010040
841 Ga0307408_100395621
842 Ga0265314_10017125
843 Ga0307409_100575043
844 Ga0307416_100010707
845 Ga0307416_100218606
846 Ga0373926_0116084
847 Ga0373934_0189240
848 Ga0373960_0038352
849 Ga0373946_0025614
850 Ga0373947_0096308
851 Ga0373925_0231844
852 Ga0373925_0310369
853 Ga0373925_0609769
854 Ga0395899_0018252
855 Ga0395899_0034937
856 Ga0395899_0040228
857 Ga0395899_0114785
858 Ga0395899_0193100
859 Ga0395899_0244667
860 Ga0395900_0000528
861 Ga0395900_0001894
862 Ga0395900_0003881
863 Ga0395900_0005059
864 Ga0395900_0046097
865 Ga0395900_0062611
866 Ga0395900_0064367
867 Ga0395900_0074470
868 Ga0395900_0194234
869 Ga0395900_0243910
870 Ga0395900_0248295
871 Ga0395900_0283704
872 Ga0395900_0385815
873 Ga0395898_0003441
874 Ga0395898_0008250
875 Ga0395898_0018085
876 Ga0395898_0026566
877 Ga0395898_0053098
878 Ga0395898_0059067
879 Ga0395898_0126222
880 Ga0395898_0359725
881 Ga0395898_0419399
882 Ga0395898_0505407
883 Ga0395898_0798967
884 Ga0395905_0000661
885 Ga0395905_0004596
886 Ga0395905_0008537
887 Ga0395905_0018346
888 Ga0395905_0022508
889 Ga0395905_0052557
890 Ga0395905_0085490
891 Ga0395905_0094808
892 Ga0395905_0386682
893 Ga0395905_0512241
894 Ga0395901_0001886
895 Ga0395901_0004561
896 Ga0395901_0008256
897 Ga0395901_0012865
898 Ga0395901_0042772
899 Ga0395901_0050560
900 Ga0395901_0080362
901 Ga0395901_0082765
902 Ga0395901_0143158
903 Ga0395901_0194876
904 Ga0395901_0254097
905 Ga0395901_0712479
906 Ga0395901_0955913
907 Ga0242420_022368
908 Ga0439436_0054626
909 Ga0439439_0002709
910 Ga0451853_1011961
911 Ga0451853_1203820
912 Ga0451853_3483484
913 Ga0439431_0034226
914 Ga0439433_0005929
915 Ga0439462_0026125
916 Ga0439434_0025744
917 Ga0466961_0007871
918 Ga0466963_0000333
919 Ga0466963_0002587
920 Ga0466963_0008710
921 Ga0466963_0057242
922 Ga0466963_0064759
923 Ga0466963_0103432
924 Ga0466963_0155732
925 Ga0466968_0012403
926 Ga0466968_0021646
927 Ga0466957_0028582
928 Ga0466957_0096108
929 Ga0466959_0002176
930 Ga0466958_0003251
931 Ga0466958_0036990
932 Ga0466958_0209032
933 Ga0466967_0000209
934 Ga0466967_0002179
935 Ga0466967_0020671
936 Ga0466967_0035665
937 Ga0466967_0061409
938 Ga0466967_0077263
939 Ga0466967_0080740
940 Ga0466967_0139681
941 Ga0466967_0252985
942 Ga0495592_0171637
943 Ga0495603_0020627
944 Ga0495603_0104418
945 Ga0495629_0125227
946 Ga0495651_0235837
947 Ga0495651_0445049
948 Ga0495653_0087201
949 Ga0495582_0068060
950 Ga0495605_0018812
951 Ga0495639_0306846
952 Ga0495662_0192159
953 Ga0495585_0031145
954 Ga0495596_0015174
955 Ga0495596_0045663
956 Ga0495596_0060863
957 Ga0495608_0223809
958 Ga0495630_0016469
959 Ga0495663_0023754
960 Ga0495652_0137166
961 Ga0495640_0190851
962 Ga0495609_0030436
963 Ga0495609_0219508
964 Ga0495621_0178881
965 Ga0495645_0177638
966 Ga0495667_0168655
967 Ga0495656_0001601
968 Ga0495634_0228376
969 Ga0495634_0348923
970 Ga0495635_0043899
971 Ga0495635_0064517
972 Ga0495588_0240013
973 Ga0495588_0280075
974 Ga0495657_0181305
975 Ga0495669_0047283
976 Ga0495613_0012660
977 Ga0495624_0055579
978 Ga0495670_0091387
979 Ga0495671_0124698
980 Ga0495589_0042213
981 Ga0495581_0000417
982 Ga0495604_0211478
983 Ga0495674_0076457
984 Ga0495674_0188440
985 Ga0495676_0106615
986 Ga0495676_0246061
987 Ga0495680_0052372
988 Ga0495684_0075353
989 Ga0495602_0086834
990 Ga0496100_0006416
991 Ga0496100_0125211
992 Ga0496100_0207789
993 Ga0496100_0301429
994 Ga0496100_0494460
995 Ga0496101_0006449
996 Ga0496101_0026024
997 Ga0496101_0066778
998 Ga0496102_0012569
999 Ga0496102_0014475
1000 Ga0496102_0098304
1001 Ga0496102_0355678
1002 Ga0496102_0483468
1003 Ga0496103_0092677
1004 Ga0496103_0095035
1005 Ga0496103_0128488
1006 Ga0496104_0013441
1007 Ga0496104_0063124
1008 Ga0496104_0160823
1009 Ga0496104_0302157
1010 Ga0496105_0001228
1011 Ga0496105_0020008
1012 Ga0496105_0021241
1013 Ga0496105_0037431
1014 Ga0496105_0133054
1015 Ga0496105_0264549
1016 Ga0496105_0401365
1017 Ga0496106_0053154
1018 Ga0496106_0057478
1019 Ga0496106_0277978
1020 Ga0496106_0561736
1021 Ga0496107_0005213
1022 Ga0496107_0007526
1023 Ga0496107_0048091
1024 Ga0496108_0041373
1025 Ga0496108_0051867
1026 Ga0496108_0052866
1027 Ga0496108_0094885
1028 Ga0496108_0502727
1029 Ga0496109_0000534
1030 Ga0496109_0003943
1031 Ga0496109_0013496
1032 Ga0496109_0022004
1033 Ga0496109_0202736
1034 Ga0496110_0021631
1035 Ga0496110_0086793
1036 Ga0496110_0135212
1037 Ga0496110_0678910
1038 Ga0496111_0020430
1039 Ga0496111_0055348
1040 Ga0496111_0137555
1041 Ga0496111_0201919
1042 Ga0496112_0004991
1043 Ga0496112_0006947
1044 Ga0496112_0011718
1045 Ga0496112_0166925
1046 Ga0496112_0182768
1047 Ga0496112_0349903
1048 Ga0496112_0391520
1049 Ga0496113_0017584
1050 Ga0496113_0025415
1051 Ga0496113_0091217
1052 Ga0496113_0191674
1053 Ga0496113_0327918
1054 Ga0496114_0027171
1055 Ga0496114_0028430
1056 Ga0496114_0081947
1057 Ga0496114_0242153
1058 Ga0496115_0013003
1059 Ga0496115_0028747
1060 Ga0496115_0056781
1061 Ga0496115_0333232
1062 Ga0501031_0006591
1063 Ga0501031_0128229
1064 Ga0501032_0073018
1065 Ga0501033_0313953
1066 Ga0501034_0023982
1067 Ga0501034_0089923
1068 Ga0501034_0260983
1069 Ga0501036_0021898
1070 Ga0501036_0045244
1071 Ga0501037_0095869
1072 Ga0501038_0009896
1073 Ga0501038_0589590
1074 Ga0501039_0016892
1075 Ga0501040_0046624
1076 Ga0501041_0002462
1077 Ga0501041_0151173
1078 Ga0501042_0055196
1079 Ga0501042_0092381
1080 Ga0501042_0114286
1081 Ga0501046_0042882
1082 Ga0501046_0248059
1083 Ga0501048_0031141
1084 Ga0501048_0037765
1085 Ga0501068_0087383
1086 Ga0501068_0395273
1087 Ga0501071_0004711
1088 Ga0501071_0013014
1089 Ga0501071_0127536
1090 Ga0501072_0013904
1091 Ga0501072_0041617
1092 Ga0501072_0266360
1093 Ga0501073_0042648
1094 Ga0501074_0051737
1095 Ga0501074_0075866
1096 Ga0501074_0330554
1097 Ga0501074_0585778
1098 Ga0501075_0028504
1099 Ga0501076_0000793
1100 Ga0501076_0026358
1101 Ga0501076_0037684
1102 Ga0501079_0044859
1103 Ga0501079_0278036
1104 Ga0501079_0305774
1105 Ga0501079_0402062
1106 Ga0501080_0001169
1107 Ga0501081_0013023
1108 Ga0501081_0224379
1109 Ga0501081_0496367
1110 Ga0501083_0070010
1111 Ga0501035_0158939
1112 Ga0501035_0416547
1113 Ga0501045_0003580
1114 Ga0501045_0062972
1115 nmdc:mga05p37_10418_c1
1116 nmdc:mga05p37_119103_c1
1117 nmdc:mga05p37_476754_c1
1118 nmdc:mga09592_286904_c1
1119 nmdc:mga06r32_191220_c1
1120 nmdc:mga08y16_158686_c1
1121 nmdc:mga0a205_289376_c1
1122 nmdc:mga0a205_342200_c1
1123 Ga0495601_0473464
1124 Ga0495612_0044617
1125 Ga0495655_0022791
1126 Ga0495595_0174439
1127 Ga0495595_0175245
1128 Ga0495619_0070196
1129 Ga0501084_0027162
1130 Ga0501084_0056772
1131 Ga0501084_0100223
1132 Ga0501084_0431420
1133 Ga0590075_001865
1134 Ga0501082_0012157
1135 Ga0501082_0740557
1136 Ga0530510_0025275
1137 Ga0530510_0114957
1138 Ga0530510_0198736
1139 Ga0530510_0227817
1140 2870787652

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03301

Trp_dioxygenase

Tryptophan 2,3-dioxygenase

37

158

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nox-assembly3.cif.gz_I crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.8733 21 229
3bk9-assembly2.cif.gz_F h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris 0.8694 21 227
2nw8-assembly1.cif.gz_A crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and tryptophan. northeast structural genomics target xcr13. 0.8576 16 229
3bk9-assembly2.cif.gz_H h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris 0.8483 24 229
2nox-assembly2.cif.gz_G crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.8482 24 229
ID Description Score Start End Superfamily
2noxJ00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8473 21 229 1.20.58.480
2nw9B00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.826 24 227 1.20.58.480
3bk9C00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8178 12 227 1.20.58.480
4hkaA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7835 15 227 1.20.58.480
2noxJ00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7491 21 229 1.20.58.480
ID Description Score Start End GO Terms
AF-A0A535C5V8-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9631 49 236 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A535CT12-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9613 70 236 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A6V8LBX3-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9586 25 230 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A7X0KDH8-F1-model_v4 deleted 0.9517 25 234
AF-A0A2N9NBD5-F1-model_v4 Tryptophan 23-dioxygenase 0.9508 96 236 GO:0019441
GO:0020037
GO:0046872
GO:0051213

Map