F464820

General Info

Members Datasets Scaffolds Average Seq Length
570 173 1140 149

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10382950|Ga0105249_103829502
Length 152
Sequence VASPVVVTTDIARPAEEVFAYATDPTCFTEWQAGVVDGHLDTSEPVRAGALCVTSRRIGGATRSVTSVVTHVDPPRAWGVRGTDGPIRATVGLIVQPLTDDSSRLTVSVGFEGLGIGRILVPLLVRRQARREMPANIATLKQRVESEQTYQP

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
69 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
70 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
71 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
72 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
76 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
77 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
100 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
101 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 1.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.84
Rhizosphere 91.4
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10382950 3300009553 Bacteria 1433
2 Ga0070671_100256136 3300005355 Bacteria 1487
3 Ga0070709_10003141 3300005434 Bacteria 8862
4 Ga0070709_10004375 3300005434 Bacteria 7615
5 Ga0070709_10035973 3300005434 Bacteria 3012
6 Ga0070709_10042432 3300005434 Bacteria 2809
7 Ga0070709_10047063 3300005434 Bacteria 2685
8 Ga0070709_10489476 3300005434 Bacteria 933
9 Ga0070709_10728165 3300005434 Bacteria 774
10 Ga0070709_11280267 3300005434 Unclassified 591
11 Ga0070714_100001629 3300005435 Bacteria 16329
12 Ga0070714_100004253 3300005435 Bacteria 10785
13 Ga0070714_100025928 3300005435 Bacteria 4841
14 Ga0070714_100034437 3300005435 Bacteria 4241
15 Ga0070714_100041279 3300005435 Bacteria 3892
16 Ga0070714_100061389 3300005435 Bacteria 3228
17 Ga0070714_100080526 3300005435 Bacteria 2834
18 Ga0070714_100090864 3300005435 Bacteria 2674
19 Ga0070714_100102004 3300005435 Bacteria 2529
20 Ga0070714_100118786 3300005435 Bacteria 2349
21 Ga0070714_100176537 3300005435 Bacteria 1941
22 Ga0070714_100477774 3300005435 Bacteria 1186
23 Ga0070714_100835266 3300005435 Bacteria 893
24 Ga0070714_100964997 3300005435 Bacteria 829
25 Ga0070714_101017491 3300005435 Bacteria 806
26 Ga0070714_101420916 3300005435 Unclassified 677
27 Ga0070714_101476427 3300005435 Unclassified 664
28 Ga0070714_101769172 3300005435 Bacteria 603
29 Ga0070713_100005027 3300005436 Bacteria 8988
30 Ga0070713_100034774 3300005436 Bacteria 4052
31 Ga0070713_100036701 3300005436 Bacteria 3957
32 Ga0070713_100042648 3300005436 Bacteria 3704
33 Ga0070713_100083395 3300005436 Bacteria 2732
34 Ga0070713_100158378 3300005436 Bacteria 2019
35 Ga0070713_100183553 3300005436 Bacteria 1881
36 Ga0070713_100195465 3300005436 Bacteria 1824
37 Ga0070713_100258590 3300005436 Bacteria 1590
38 Ga0070713_100278431 3300005436 Bacteria 1534
39 Ga0070713_100447561 3300005436 Bacteria 1213
40 Ga0070713_100670658 3300005436 Bacteria 989
41 Ga0070713_100771653 3300005436 Bacteria 920
42 Ga0070713_100951292 3300005436 Bacteria 827
43 Ga0070713_101098825 3300005436 Bacteria 768
44 Ga0070710_10002101 3300005437 Bacteria 9449
45 Ga0070710_10020156 3300005437 Bacteria 3455
46 Ga0070710_10021091 3300005437 Plasmid 3390
47 Ga0070710_10082038 3300005437 Bacteria 1884
48 Ga0070710_10104703 3300005437 Bacteria 1690
49 Ga0070710_10131642 3300005437 Bacteria 1525
50 Ga0070711_100012703 3300005439 Bacteria 5269
51 Ga0070711_100019896 3300005439 Bacteria 4316
52 Ga0070711_100057891 3300005439 Bacteria 2685
53 Ga0070711_100088225 3300005439 Bacteria 2228
54 Ga0070711_100180131 3300005439 Bacteria 1617
55 Ga0070711_100267561 3300005439 Bacteria 1347
56 Ga0070711_101327353 3300005439 Bacteria 625
57 Ga0070708_100027925 3300005445 Bacteria 4849
58 Ga0070706_100003675 3300005467 Bacteria 15015
59 Ga0070706_100138803 3300005467 Bacteria 2269
60 Ga0070707_100055612 3300005468 Bacteria 3794
61 Ga0070707_100622704 3300005468 Unclassified 1042
62 Ga0070698_100740590 3300005471 Bacteria 926
63 Ga0070698_101133930 3300005471 Bacteria 731
64 Ga0070699_100001169 3300005518 Bacteria 24338
65 Ga0070679_101399131 3300005530 Bacteria 646
66 Ga0070684_101263431 3300005535 Bacteria 695
67 Ga0070697_100002515 3300005536 Bacteria 14106
68 Ga0070697_100804595 3300005536 Bacteria 832
69 Ga0070695_101750758 3300005545 Unclassified 521
70 Ga0070664_101587385 3300005564 Bacteria 620
71 Ga0068857_100570334 3300005577 Bacteria 1068
72 Ga0068856_100328591 3300005614 Bacteria 1547
73 Ga0068856_100474567 3300005614 Bacteria 1272
74 Ga0068856_101252262 3300005614 Bacteria 758
75 Ga0068856_101560247 3300005614 Bacteria 674
76 Ga0068863_100181778 3300005841 Bacteria 2019
77 Ga0070717_10004657 3300006028 Bacteria 9949
78 Ga0070717_10014902 3300006028 Bacteria 5986
79 Ga0070717_10022333 3300006028 Bacteria 4998
80 Ga0070717_10041043 3300006028 Bacteria 3771
81 Ga0070717_10051777 3300006028 Bacteria 3380
82 Ga0070717_10247606 3300006028 Bacteria 1573
83 Ga0070717_10249620 3300006028 Bacteria 1567
84 Ga0070717_10253763 3300006028 Bacteria 1554
85 Ga0070717_10340866 3300006028 Bacteria 1338
86 Ga0070717_10389858 3300006028 Bacteria 1250
87 Ga0070717_10651912 3300006028 Unclassified 956
88 Ga0070717_10670511 3300006028 Bacteria 941
89 Ga0070717_10930260 3300006028 Bacteria 792
90 Ga0070717_11565586 3300006028 Bacteria 597
91 Ga0070715_10009572 3300006163 Bacteria 3421
92 Ga0070715_10010125 3300006163 Bacteria 3350
93 Ga0070715_10134506 3300006163 Bacteria 1194
94 Ga0070716_100002511 3300006173 Bacteria 8494
95 Ga0070716_100004746 3300006173 Bacteria 6519
96 Ga0070716_100014817 3300006173 Bacteria 3998
97 Ga0070716_100015182 3300006173 Bacteria 3952
98 Ga0070716_100320641 3300006173 Bacteria 1086
99 Ga0070712_100007348 3300006175 Bacteria 6875
100 Ga0070712_100013827 3300006175 Bacteria 5165
101 Ga0070712_100016900 3300006175 Bacteria 4718
102 Ga0070712_100058295 3300006175 Bacteria 2716
103 Ga0070712_100162152 3300006175 Unclassified 1727
104 Ga0070712_100194745 3300006175 Bacteria 1588
105 Ga0070712_100313493 3300006175 Bacteria 1273
106 Ga0070712_100339402 3300006175 Bacteria 1226
107 Ga0075433_10058794 3300006852 Bacteria 3363
108 Ga0075434_100128414 3300006871 Bacteria 2553
109 Ga0075434_100473541 3300006871 Bacteria 1274
110 Ga0075434_100652671 3300006871 Unclassified 1070
111 Ga0075436_100041015 3300006914 Bacteria 3194
112 Ga0075435_100009429 3300007076 Bacteria 7067
113 Ga0075435_100243329 3300007076 Bacteria 1530
114 Ga0099795_10221999 3300007788 Bacteria 805
115 Ga0111539_10327929 3300009094 Bacteria 1782
116 Ga0105245_11160790 3300009098 Bacteria 820
117 Ga0114129_10077941 3300009147 Bacteria 4609
118 Ga0105239_10662369 3300010375 Bacteria 1192
119 Ga0157369_10092280 3300013105 Bacteria 3232
120 Ga0157372_10527403 3300013307 Bacteria 1376
121 Ga0157375_11832671 3300013308 Unclassified 720
122 Ga0163163_11399813 3300014325 Bacteria 761
123 Ga0157376_10913598 3300014969 Bacteria 896
124 Ga0197907_10101237 3300020069 Bacteria 1394
125 Ga0206356_11380749 3300020070 Bacteria 1378
126 Ga0206349_1297673 3300020075 Bacteria 1183
127 Ga0206351_10206293 3300020077 Bacteria 583
128 Ga0206352_11305120 3300020078 Bacteria 1749
129 Ga0206350_11031564 3300020080 Bacteria 1466
130 Ga0213875_10242432 3300021388 Bacteria 850
131 Ga0224712_10081116 3300022467 Bacteria 1339
132 Ga0224712_10416432 3300022467 Bacteria 642
133 Ga0224572_1000316 3300024225 Bacteria 5168
134 Ga0207692_10002402 3300025898 Bacteria 7185
135 Ga0207692_10007215 3300025898 Bacteria 4542
136 Ga0207692_10018914 3300025898 Bacteria 3101
137 Ga0207692_10053025 3300025898 Bacteria 2064
138 Ga0207692_10095171 3300025898 Bacteria 1623
139 Ga0207692_10099566 3300025898 Bacteria 1593
140 Ga0207692_10226262 3300025898 Bacteria 1111
141 Ga0207692_10409367 3300025898 Bacteria 847
142 Ga0207685_10003528 3300025905 Bacteria 3821
143 Ga0207685_10080819 3300025905 Bacteria 1344
144 Ga0207685_10142451 3300025905 Bacteria 1076
145 Ga0207699_10007128 3300025906 Bacteria 5452
146 Ga0207699_10048529 3300025906 Bacteria 2494
147 Ga0207699_10069051 3300025906 Bacteria 2153
148 Ga0207699_10144670 3300025906 Bacteria 1566
149 Ga0207699_10196317 3300025906 Bacteria 1365
150 Ga0207699_10392410 3300025906 Bacteria 987
151 Ga0207699_10397940 3300025906 Bacteria 980
152 Ga0207699_10604402 3300025906 Bacteria 799
153 Ga0207699_11473576 3300025906 Unclassified 503
154 Ga0207684_10008233 3300025910 Bacteria 9285
155 Ga0207684_10174154 3300025910 Bacteria 1855
156 Ga0207684_10308350 3300025910 Bacteria 1364
157 Ga0207684_10349223 3300025910 Bacteria 1273
158 Ga0207693_10015865 3300025915 Bacteria 6033
159 Ga0207693_10029568 3300025915 Bacteria 4326
160 Ga0207693_10033261 3300025915 Bacteria 4069
161 Ga0207693_10043937 3300025915 Bacteria 3512
162 Ga0207693_10045231 3300025915 Bacteria 3459
163 Ga0207693_10052251 3300025915 Bacteria 3205
164 Ga0207693_10074200 3300025915 Bacteria 2664
165 Ga0207693_10168342 3300025915 Bacteria 1725
166 Ga0207693_10659657 3300025915 Bacteria 812
167 Ga0207663_10000191 3300025916 Bacteria 27261
168 Ga0207663_10020738 3300025916 Bacteria 3727
169 Ga0207663_10070480 3300025916 Bacteria 2252
170 Ga0207663_10096028 3300025916 Unclassified 1979
171 Ga0207663_10181835 3300025916 Bacteria 1502
172 Ga0207663_10238801 3300025916 Bacteria 1332
173 Ga0207663_10256577 3300025916 Bacteria 1289
174 Ga0207663_10780352 3300025916 Bacteria 760
175 Ga0207646_10001648 3300025922 Bacteria 27293
176 Ga0207646_10055517 3300025922 Bacteria 3541
177 Ga0207687_11041721 3300025927 Bacteria 702
178 Ga0207700_10004355 3300025928 Bacteria 8334
179 Ga0207700_10011560 3300025928 Bacteria 5636
180 Ga0207700_10022333 3300025928 Bacteria 4340
181 Ga0207700_10026114 3300025928 Bacteria 4068
182 Ga0207700_10056315 3300025928 Bacteria 2959
183 Ga0207700_10066239 3300025928 Bacteria 2760
184 Ga0207700_10116198 3300025928 Bacteria 2161
185 Ga0207700_10209699 3300025928 Bacteria 1646
186 Ga0207700_10273520 3300025928 Bacteria 1450
187 Ga0207700_10303568 3300025928 Bacteria 1379
188 Ga0207700_10459134 3300025928 Bacteria 1123
189 Ga0207700_10642511 3300025928 Bacteria 946
190 Ga0207700_10765828 3300025928 Bacteria 863
191 Ga0207700_11045095 3300025928 Bacteria 731
192 Ga0207664_10002149 3300025929 Bacteria 12962
193 Ga0207664_10003315 3300025929 Bacteria 10709
194 Ga0207664_10020613 3300025929 Bacteria 4889
195 Ga0207664_10021032 3300025929 Bacteria 4843
196 Ga0207664_10026409 3300025929 Bacteria 4388
197 Ga0207664_10031385 3300025929 Bacteria 4064
198 Ga0207664_10032231 3300025929 Bacteria 4015
199 Ga0207664_10058150 3300025929 Bacteria 3075
200 Ga0207664_10114853 3300025929 Bacteria 2244
201 Ga0207664_10154668 3300025929 Bacteria 1951
202 Ga0207664_11216872 3300025929 Unclassified 671
203 Ga0207664_11289225 3300025929 Bacteria 650
204 Ga0207664_11387280 3300025929 Bacteria 623
205 Ga0207664_11610740 3300025929 Bacteria 571
206 Ga0207664_11913678 3300025929 Unclassified 516
207 Ga0207644_10694600 3300025931 Bacteria 848
208 Ga0207665_10006766 3300025939 Bacteria 7594
209 Ga0207665_10015870 3300025939 Bacteria 4943
210 Ga0207665_10054908 3300025939 Bacteria 2687
211 Ga0207665_10353498 3300025939 Bacteria 1110
212 Ga0207665_10683663 3300025939 Bacteria 806
213 Ga0207665_10845462 3300025939 Bacteria 724
214 Ga0207667_10980112 3300025949 Bacteria 834
215 Ga0207677_12200930 3300026023 Unclassified 513
216 Ga0207702_10480384 3300026078 Unclassified 1209
217 Ga0207702_10539184 3300026078 Bacteria 1140
218 Ga0207702_11397984 3300026078 Bacteria 694
219 Ga0207702_11431553 3300026078 Bacteria 685
220 Ga0207702_11576041 3300026078 Bacteria 650
221 Ga0207641_10903560 3300026088 Bacteria 877
222 Ga0207674_10493172 3300026116 Bacteria 1184
223 Ga0207428_10275298 3300027907 Unclassified 1250
224 Ga0265770_1055979 3300030878 Bacteria 724
225 Ga0265773_1002014 3300031018 Bacteria 1183
226 Ga0307508_10356545 3300031616 Bacteria 1054
227 Ga0316215_1013992 3300033544 Bacteria 801
228 Ga0316212_1026964 3300033547 Bacteria 806
229 Ga0373959_0177626 3300034820 Unclassified 552
230 Ga0373926_0012338 3300035083 Bacteria 2886
231 Ga0373934_0006098 3300035086 Bacteria 4463
232 Ga0373934_0019046 3300035086 Bacteria 2631
233 Ga0373944_0014335 3300035089 Bacteria 2211
234 Ga0373944_0049239 3300035089 Bacteria 1324
235 Ga0373944_0424700 3300035089 Bacteria 515
236 Ga0373949_0017398 3300035090 Bacteria 1620
237 Ga0373952_0095987 3300035092 Bacteria 776
238 Ga0373923_0030707 3300035111 Bacteria 2162
239 Ga0373923_0045947 3300035111 Bacteria 1815
240 Ga0373923_0148466 3300035111 Bacteria 1063
241 Ga0373936_0017906 3300035113 Bacteria 2732
242 Ga0373936_0019416 3300035113 Bacteria 2634
243 Ga0373936_0037461 3300035113 Bacteria 1936
244 Ga0373941_0036295 3300035115 Unclassified 1498
245 Ga0373945_0019598 3300035116 Bacteria 2311
246 Ga0373945_0170101 3300035116 Bacteria 892
247 Ga0373945_0233153 3300035116 Bacteria 773
248 Ga0373945_0290551 3300035116 Bacteria 698
249 Ga0373953_0012974 3300035117 Bacteria 2964
250 Ga0373953_0019011 3300035117 Bacteria 2550
251 Ga0373953_0071513 3300035117 Bacteria 1432
252 Ga0373953_0485159 3300035117 Bacteria 547
253 Ga0373954_0068057 3300035118 Bacteria 1688
254 Ga0373954_0079340 3300035118 Bacteria 1567
255 Ga0373954_0146272 3300035118 Bacteria 1154
256 Ga0373956_0026520 3300035119 Bacteria 2510
257 Ga0373956_0087754 3300035119 Bacteria 1433
258 Ga0373957_0003153 3300035120 Bacteria 4824
259 Ga0373957_0029700 3300035120 Bacteria 1998
260 Ga0373957_0109369 3300035120 Bacteria 1112
261 Ga0373957_0236895 3300035120 Bacteria 766
262 Ga0373957_0265990 3300035120 Bacteria 723
263 Ga0373960_0143630 3300035121 Bacteria 810
264 Ga0373943_0008001 3300035170 Bacteria 4744
265 Ga0373943_0348433 3300035170 Bacteria 848
266 Ga0373943_0595433 3300035170 Bacteria 651
267 Ga0373946_0005494 3300035171 Bacteria 4574
268 Ga0373946_0061610 3300035171 Bacteria 1598
269 Ga0373955_0002688 3300035172 Bacteria 7780
270 Ga0373955_0141397 3300035172 Bacteria 1411
271 Ga0373955_0184268 3300035172 Bacteria 1239
272 Ga0373955_0662182 3300035172 Bacteria 640
273 Ga0373924_0008626 3300035410 Bacteria 3712
274 Ga0373924_0020138 3300035410 Bacteria 2590
275 Ga0373924_0171157 3300035410 Bacteria 954
276 Ga0373924_0207833 3300035410 Bacteria 864
277 Ga0373924_0222704 3300035410 Unclassified 834
278 Ga0373931_0011801 3300035691 Bacteria 4224
279 Ga0373935_0073959 3300035692 Bacteria 2202
280 Ga0373935_0117804 3300035692 Bacteria 1770
281 Ga0373935_0315436 3300035692 Bacteria 1108
282 Ga0373935_0324691 3300035692 Bacteria 1093
283 Ga0373927_0053593 3300035695 Bacteria 2609
284 Ga0373933_0018181 3300035724 Bacteria 3949
285 Ga0373933_0036719 3300035724 Bacteria 2870
286 Ga0373933_0037366 3300035724 Bacteria 2848
287 Ga0373933_0066839 3300035724 Bacteria 2179
288 Ga0373933_0116343 3300035724 Bacteria 1671
289 Ga0373933_0172642 3300035724 Bacteria 1376
290 Ga0373933_0339346 3300035724 Bacteria 975
291 Ga0373947_0058800 3300035725 Bacteria 2330
292 Ga0373947_0119391 3300035725 Bacteria 1673
293 Ga0373947_0333257 3300035725 Bacteria 1016
294 Ga0373947_0436372 3300035725 Bacteria 886
295 Ga0373937_0000952 3300036401 Bacteria 24624
296 Ga0373937_0040842 3300036401 Bacteria 4229
297 Ga0373937_0073897 3300036401 Bacteria 3145
298 Ga0373937_0082010 3300036401 Bacteria 2983
299 Ga0373937_0169393 3300036401 Bacteria 2049
300 Ga0373937_0207521 3300036401 Bacteria 1842
301 Ga0373937_0419231 3300036401 Bacteria 1270
302 Ga0373937_0640241 3300036401 Bacteria 1008
303 Ga0373937_1287413 3300036401 Bacteria 679
304 Ga0372808_008527 3300036459 Bacteria 1422
305 Ga0373925_0001267 3300037068 Bacteria 22297
306 Ga0373925_0023000 3300037068 Bacteria 4548
307 Ga0373925_0092435 3300037068 Bacteria 2314
308 Ga0373925_0127720 3300037068 Bacteria 1979
309 Ga0373925_0764233 3300037068 Bacteria 797
310 Ga0373925_1248194 3300037068 Bacteria 610
311 Ga0436364_0684426 3300037853 Bacteria 1791
312 Ga0436364_1195313 3300037853 Bacteria 803
313 Ga0242420_094542 3300038996 Bacteria 631
314 Ga0451795_0101689 3300041456 Unclassified 1307
315 Ga0451841_0859338 3300041498 Unclassified 572
316 Ga0466957_0102941 3300044842 Bacteria 1802
317 Ga0466958_0006957 3300045836 Bacteria 6189
318 Ga0495592_0001321 3300046454 Bacteria 17200
319 Ga0495592_0014125 3300046454 Bacteria 6066
320 Ga0495592_0030838 3300046454 Bacteria 4056
321 Ga0495592_0063071 3300046454 Bacteria 2718
322 Ga0495592_0123235 3300046454 Bacteria 1821
323 Ga0495592_0205501 3300046454 Unclassified 1326
324 Ga0495603_0006415 3300046455 Bacteria 7041
325 Ga0495629_0027180 3300046459 Bacteria 4064
326 Ga0495629_0205236 3300046459 Bacteria 1362
327 Ga0495641_0025367 3300046461 Bacteria 2910
328 Ga0495641_0051180 3300046461 Bacteria 1887
329 Ga0495641_0367299 3300046461 Bacteria 651
330 Ga0495651_0000558 3300046462 Bacteria 28750
331 Ga0495651_0030874 3300046462 Bacteria 4178
332 Ga0495651_0057083 3300046462 Bacteria 2997
333 Ga0495651_0120247 3300046462 Bacteria 1930
334 Ga0495651_0121996 3300046462 Bacteria 1913
335 Ga0495651_0340906 3300046462 Bacteria 993
336 Ga0495651_0762168 3300046462 Bacteria 599
337 Ga0495653_0002218 3300046463 Bacteria 15356
338 Ga0495653_0004228 3300046463 Bacteria 11635
339 Ga0495653_0059602 3300046463 Bacteria 2896
340 Ga0495653_0067070 3300046463 Bacteria 2696
341 Ga0495653_0080959 3300046463 Bacteria 2400
342 Ga0495653_0243510 3300046463 Bacteria 1197
343 Ga0495653_0461725 3300046463 Bacteria 797
344 Ga0495580_0121943 3300046472 Bacteria 1809
345 Ga0495582_0010281 3300046473 Bacteria 5148
346 Ga0495582_0022120 3300046473 Bacteria 3478
347 Ga0495582_0265871 3300046473 Bacteria 984
348 Ga0495639_0010575 3300046475 Bacteria 3974
349 Ga0495639_0013707 3300046475 Bacteria 3505
350 Ga0495662_0005150 3300046476 Bacteria 6553
351 Ga0495664_0029056 3300046477 Bacteria 3231
352 Ga0495664_0065923 3300046477 Unclassified 2159
353 Ga0495664_0334630 3300046477 Bacteria 912
354 Ga0495664_0357670 3300046477 Bacteria 879
355 Ga0495664_0534681 3300046477 Bacteria 699
356 Ga0495664_0606246 3300046477 Bacteria 650
357 Ga0495594_0021236 3300046499 Bacteria 3464
358 Ga0495608_0027814 3300046511 Bacteria 3845
359 Ga0495608_0068485 3300046511 Bacteria 2320
360 Ga0495608_0146343 3300046511 Unclassified 1507
361 Ga0495608_0232564 3300046511 Bacteria 1153
362 Ga0495608_0818680 3300046511 Bacteria 549
363 Ga0495618_0014938 3300046514 Bacteria 4735
364 Ga0495618_0025768 3300046514 Bacteria 3652
365 Ga0495618_0165554 3300046514 Bacteria 1408
366 Ga0495618_0215851 3300046514 Bacteria 1211
367 Ga0495618_0304312 3300046514 Bacteria 990
368 Ga0495628_0003235 3300046516 Bacteria 14598
369 Ga0495628_0008696 3300046516 Bacteria 8687
370 Ga0495628_0054593 3300046516 Bacteria 3149
371 Ga0495628_0079285 3300046516 Bacteria 2553
372 Ga0495628_0117436 3300046516 Bacteria 2043
373 Ga0495628_0176468 3300046516 Bacteria 1618
374 Ga0495628_0217035 3300046516 Bacteria 1437
375 Ga0495628_0700480 3300046516 Bacteria 715
376 Ga0495628_1174172 3300046516 Unclassified 522
377 Ga0495630_0027165 3300046517 Bacteria 4242
378 Ga0495630_0051319 3300046517 Bacteria 3087
379 Ga0495630_0103388 3300046517 Bacteria 2155
380 Ga0495630_0584780 3300046517 Bacteria 856
381 Ga0495630_0903134 3300046517 Bacteria 673
382 Ga0495630_0976196 3300046517 Bacteria 644
383 Ga0495630_1206299 3300046517 Unclassified 572
384 Ga0495666_0001924 3300046526 Bacteria 10242
385 Ga0495652_0002858 3300046529 Bacteria 17411
386 Ga0495652_0251029 3300046529 Bacteria 1311
387 Ga0495652_0324187 3300046529 Bacteria 1112
388 Ga0495652_0339528 3300046529 Bacteria 1079
389 Ga0495652_0536935 3300046529 Unclassified 806
390 Ga0495665_0009483 3300046531 Bacteria 5268
391 Ga0495665_0062310 3300046531 Bacteria 1969
392 Ga0495665_0077813 3300046531 Bacteria 1745
393 Ga0495665_0140417 3300046531 Bacteria 1263
394 Ga0495640_0004138 3300046533 Bacteria 11606
395 Ga0495640_0007438 3300046533 Bacteria 8607
396 Ga0495640_0041014 3300046533 Bacteria 3237
397 Ga0495640_0274451 3300046533 Bacteria 1051
398 Ga0495586_0031877 3300046535 Bacteria 2825
399 Ga0495586_0101695 3300046535 Bacteria 1595
400 Ga0495586_0112564 3300046535 Unclassified 1515
401 Ga0495587_0002740 3300046536 Bacteria 11746
402 Ga0495587_0017571 3300046536 Bacteria 4443
403 Ga0495587_0091009 3300046536 Bacteria 1762
404 Ga0495587_0176939 3300046536 Bacteria 1210
405 Ga0495587_0226226 3300046536 Bacteria 1054
406 Ga0495645_0001518 3300046543 Bacteria 15655
407 Ga0495645_0065246 3300046543 Bacteria 2633
408 Ga0495645_0098364 3300046543 Bacteria 2082
409 Ga0495622_0078509 3300046557 Bacteria 1520
410 Ga0495667_0000852 3300046559 Bacteria 19723
411 Ga0495667_0012612 3300046559 Bacteria 5729
412 Ga0495667_0027054 3300046559 Bacteria 3865
413 Ga0495667_0036238 3300046559 Bacteria 3294
414 Ga0495667_0615941 3300046559 Bacteria 676
415 Ga0495667_0867481 3300046559 Bacteria 554
416 Ga0495634_0006540 3300046642 Bacteria 8845
417 Ga0495634_0033479 3300046642 Bacteria 3531
418 Ga0495634_0044648 3300046642 Bacteria 2998
419 Ga0495634_0082478 3300046642 Bacteria 2101
420 Ga0495635_0005579 3300046663 Bacteria 8762
421 Ga0495635_0028093 3300046663 Bacteria 3910
422 Ga0495635_0100427 3300046663 Bacteria 1977
423 Ga0495635_0102533 3300046663 Bacteria 1955
424 Ga0495635_0185938 3300046663 Bacteria 1411
425 Ga0495635_0227541 3300046663 Bacteria 1260
426 Ga0495635_0922457 3300046663 Bacteria 558
427 Ga0495657_0002208 3300046675 Bacteria 16488
428 Ga0495657_0034230 3300046675 Bacteria 3529
429 Ga0495657_0098328 3300046675 Bacteria 1867
430 Ga0495657_0334985 3300046675 Bacteria 897
431 Ga0495657_0354111 3300046675 Bacteria 868
432 Ga0495599_0001902 3300046678 Bacteria 12090
433 Ga0495599_0035693 3300046678 Bacteria 3121
434 Ga0495599_0037462 3300046678 Bacteria 3047
435 Ga0495599_0039487 3300046678 Bacteria 2965
436 Ga0495599_0113465 3300046678 Bacteria 1687
437 Ga0495623_0021978 3300046679 Bacteria 4120
438 Ga0495623_0072193 3300046679 Bacteria 2146
439 Ga0495623_0167286 3300046679 Bacteria 1287
440 Ga0495646_0007588 3300046680 Bacteria 6892
441 Ga0495646_0009445 3300046680 Bacteria 6189
442 Ga0495646_0016320 3300046680 Bacteria 4712
443 Ga0495646_0051944 3300046680 Bacteria 2479
444 Ga0495647_0009447 3300046681 Bacteria 3305
445 Ga0495647_0050531 3300046681 Bacteria 1614
446 Ga0495658_0048663 3300046683 Bacteria 2391
447 Ga0495613_0025065 3300046689 Bacteria 4445
448 Ga0495613_0045222 3300046689 Bacteria 3256
449 Ga0495624_0008307 3300046690 Bacteria 7256
450 Ga0495624_0049868 3300046690 Bacteria 2653
451 Ga0495600_0003018 3300046809 Bacteria 9825
452 Ga0495600_0003359 3300046809 Bacteria 9410
453 Ga0495600_0019886 3300046809 Bacteria 4291
454 Ga0495600_0063128 3300046809 Bacteria 2420
455 Ga0495600_0256525 3300046809 Bacteria 1111
456 Ga0495600_0321343 3300046809 Unclassified 973
457 Ga0495600_0363879 3300046809 Bacteria 904
458 Ga0495600_0460931 3300046809 Bacteria 785
459 Ga0495581_0011474 3300047315 Bacteria 5128
460 Ga0495581_0034087 3300047315 Bacteria 2946
461 Ga0495581_0072949 3300047315 Bacteria 1986
462 Ga0495604_0002133 3300047317 Bacteria 15905
463 Ga0495604_0008180 3300047317 Bacteria 8276
464 Ga0495604_0040205 3300047317 Bacteria 3672
465 Ga0495674_0005699 3300047319 Bacteria 11934
466 Ga0495674_0054718 3300047319 Bacteria 3503
467 Ga0495674_0119134 3300047319 Bacteria 2231
468 Ga0495674_0125338 3300047319 Bacteria 2168
469 Ga0495674_0251782 3300047319 Bacteria 1453
470 Ga0495674_0437699 3300047319 Bacteria 1052
471 Ga0495674_0905780 3300047319 Unclassified 680
472 Ga0495676_0010004 3300047321 Bacteria 8617
473 Ga0495680_0003622 3300047322 Bacteria 15111
474 Ga0495680_0004469 3300047322 Bacteria 13372
475 Ga0495680_0010978 3300047322 Bacteria 8050
476 Ga0495680_0104554 3300047322 Bacteria 2106
477 Ga0495680_0106955 3300047322 Bacteria 2078
478 Ga0495680_0109342 3300047322 Bacteria 2050
479 Ga0495680_0291440 3300047322 Bacteria 1148
480 Ga0495680_0634625 3300047322 Bacteria 711
481 Ga0495675_0014650 3300047444 Bacteria 4954
482 Ga0495675_0014731 3300047444 Bacteria 4942
483 Ga0495675_0628921 3300047444 Bacteria 606
484 Ga0495684_0000448 3300047471 Bacteria 33687
485 Ga0495684_0006269 3300047471 Bacteria 9242
486 Ga0495684_0007030 3300047471 Bacteria 8745
487 Ga0495684_0071054 3300047471 Bacteria 2645
488 Ga0495684_0178805 3300047471 Bacteria 1573
489 Ga0495684_0233352 3300047471 Bacteria 1345
490 Ga0495684_0357834 3300047471 Bacteria 1035
491 Ga0495684_0515814 3300047471 Bacteria 819
492 Ga0495593_0017099 3300047673 Bacteria 4081
493 Ga0495593_0023476 3300047673 Bacteria 3428
494 Ga0495593_0088406 3300047673 Bacteria 1597
495 Ga0495602_0002546 3300048088 Bacteria 18578
496 Ga0495602_0025468 3300048088 Bacteria 5725
497 Ga0495602_0249248 3300048088 Bacteria 1324
498 Ga0495602_0379302 3300048088 Unclassified 1013
499 Ga0495602_0447911 3300048088 Bacteria 912
500 Ga0495602_0491670 3300048088 Bacteria 859
501 Ga0495602_0507931 3300048088 Bacteria 841
502 Ga0495602_0517575 3300048088 Bacteria 831
503 Ga0495614_0059846 3300048089 Bacteria 1636
504 Ga0496100_0054454 3300048903 Bacteria 2609
505 Ga0496100_1110920 3300048903 Bacteria 623
506 Ga0496101_0708236 3300048904 Bacteria 795
507 Ga0496102_0568917 3300048905 Bacteria 1056
508 Ga0496102_0700470 3300048905 Bacteria 936
509 Ga0496102_1066692 3300048905 Bacteria 728
510 Ga0496104_0041262 3300048907 Bacteria 4326
511 Ga0496104_0629746 3300048907 Bacteria 982
512 Ga0496105_0012366 3300048908 Bacteria 6757
513 Ga0496105_0027530 3300048908 Bacteria 4645
514 Ga0496106_0046973 3300048909 Bacteria 3247
515 Ga0496106_0430785 3300048909 Bacteria 1060
516 Ga0496107_0046617 3300048910 Bacteria 3119
517 Ga0496107_0262858 3300048910 Bacteria 1284
518 Ga0496108_0043222 3300048911 Bacteria 3764
519 Ga0496108_0150533 3300048911 Bacteria 2008
520 Ga0496108_0196092 3300048911 Bacteria 1751
521 Ga0496108_0496564 3300048911 Unclassified 1066
522 Ga0496109_0047708 3300048912 Bacteria 3895
523 Ga0496109_0079529 3300048912 Bacteria 3021
524 Ga0496109_0260000 3300048912 Bacteria 1635
525 Ga0496109_0405450 3300048912 Bacteria 1288
526 Ga0496109_0476056 3300048912 Bacteria 1179
527 Ga0496109_0602218 3300048912 Bacteria 1035
528 Ga0496110_0100364 3300048913 Bacteria 2594
529 Ga0496110_0616737 3300048913 Bacteria 983
530 Ga0496112_0039071 3300048915 Bacteria 4635
531 Ga0496112_0085351 3300048915 Bacteria 3123
532 Ga0496112_0326159 3300048915 Bacteria 1479
533 Ga0496112_0592851 3300048915 Bacteria 1040
534 Ga0496113_0092309 3300048916 Bacteria 2335
535 Ga0496113_0385011 3300048916 Bacteria 1126
536 Ga0496113_0717767 3300048916 Bacteria 797
537 Ga0496113_0855772 3300048916 Unclassified 720
538 Ga0496114_0058510 3300048917 Bacteria 3218
539 Ga0496115_0000996 3300048918 Bacteria 20523
540 Ga0496115_0079466 3300048918 Bacteria 2669
541 Ga0496115_0107476 3300048918 Bacteria 2290
542 Ga0496126_0019530 3300048929 Bacteria 6671
543 Ga0496126_0075254 3300048929 Bacteria 2997
544 nmdc:mga05p37_132279_c1 3300050507 Bacteria 3061
545 nmdc:mga08y16_463593_c1 3300050511 Unclassified 1291
546 nmdc:mga0n895_312114_c1 3300050512 Bacteria 1594
547 nmdc:mga0n895_68657_c1 3300050512 Bacteria 3511
548 nmdc:mga0rr50_172678_c1 3300050513 Bacteria 1763
549 nmdc:mga0rr50_681532_c1 3300050513 Bacteria 877
550 nmdc:mga08x19_248329_c1 3300050514 Unclassified 1228
551 nmdc:mga08x19_2702_c1 3300050514 Bacteria 10729
552 Ga0495601_0002968 3300053077 Bacteria 9650
553 Ga0495601_0051539 3300053077 Bacteria 2597
554 Ga0495601_0154582 3300053077 Bacteria 1498
555 Ga0495601_0168352 3300053077 Bacteria 1432
556 Ga0495601_0243645 3300053077 Bacteria 1174
557 Ga0495601_0574411 3300053077 Bacteria 724
558 Ga0495612_0006539 3300053078 Bacteria 4788
559 Ga0495612_0120335 3300053078 Bacteria 1129
560 Ga0495612_0203115 3300053078 Bacteria 875
561 Ga0495612_0310045 3300053078 Bacteria 709
562 Ga0495595_0012433 3300053084 Bacteria 3579
563 Ga0495595_0014882 3300053084 Bacteria 3308
564 Ga0495595_0111350 3300053084 Unclassified 1328
565 Ga0495595_0114282 3300053084 Bacteria 1311
566 Ga0495595_0244159 3300053084 Bacteria 898
567 Ga0495595_0275510 3300053084 Bacteria 844
568 Ga0495619_0049940 3300053085 Bacteria 2759
569 Ga0495619_0053297 3300053085 Bacteria 2675
570 Ga0495619_0094826 3300053085 Bacteria 2024
571 Ga0105249_10382950
572 Ga0070671_100256136
573 Ga0070709_10003141
574 Ga0070709_10004375
575 Ga0070709_10035973
576 Ga0070709_10042432
577 Ga0070709_10047063
578 Ga0070709_10489476
579 Ga0070709_10728165
580 Ga0070709_11280267
581 Ga0070714_100001629
582 Ga0070714_100004253
583 Ga0070714_100025928
584 Ga0070714_100034437
585 Ga0070714_100041279
586 Ga0070714_100061389
587 Ga0070714_100080526
588 Ga0070714_100090864
589 Ga0070714_100102004
590 Ga0070714_100118786
591 Ga0070714_100176537
592 Ga0070714_100477774
593 Ga0070714_100835266
594 Ga0070714_100964997
595 Ga0070714_101017491
596 Ga0070714_101420916
597 Ga0070714_101476427
598 Ga0070714_101769172
599 Ga0070713_100005027
600 Ga0070713_100034774
601 Ga0070713_100036701
602 Ga0070713_100042648
603 Ga0070713_100083395
604 Ga0070713_100158378
605 Ga0070713_100183553
606 Ga0070713_100195465
607 Ga0070713_100258590
608 Ga0070713_100278431
609 Ga0070713_100447561
610 Ga0070713_100670658
611 Ga0070713_100771653
612 Ga0070713_100951292
613 Ga0070713_101098825
614 Ga0070710_10002101
615 Ga0070710_10020156
616 Ga0070710_10021091
617 Ga0070710_10082038
618 Ga0070710_10104703
619 Ga0070710_10131642
620 Ga0070711_100012703
621 Ga0070711_100019896
622 Ga0070711_100057891
623 Ga0070711_100088225
624 Ga0070711_100180131
625 Ga0070711_100267561
626 Ga0070711_101327353
627 Ga0070708_100027925
628 Ga0070706_100003675
629 Ga0070706_100138803
630 Ga0070707_100055612
631 Ga0070707_100622704
632 Ga0070698_100740590
633 Ga0070698_101133930
634 Ga0070699_100001169
635 Ga0070679_101399131
636 Ga0070684_101263431
637 Ga0070697_100002515
638 Ga0070697_100804595
639 Ga0070695_101750758
640 Ga0070664_101587385
641 Ga0068857_100570334
642 Ga0068856_100328591
643 Ga0068856_100474567
644 Ga0068856_101252262
645 Ga0068856_101560247
646 Ga0068863_100181778
647 Ga0070717_10004657
648 Ga0070717_10014902
649 Ga0070717_10022333
650 Ga0070717_10041043
651 Ga0070717_10051777
652 Ga0070717_10247606
653 Ga0070717_10249620
654 Ga0070717_10253763
655 Ga0070717_10340866
656 Ga0070717_10389858
657 Ga0070717_10651912
658 Ga0070717_10670511
659 Ga0070717_10930260
660 Ga0070717_11565586
661 Ga0070715_10009572
662 Ga0070715_10010125
663 Ga0070715_10134506
664 Ga0070716_100002511
665 Ga0070716_100004746
666 Ga0070716_100014817
667 Ga0070716_100015182
668 Ga0070716_100320641
669 Ga0070712_100007348
670 Ga0070712_100013827
671 Ga0070712_100016900
672 Ga0070712_100058295
673 Ga0070712_100162152
674 Ga0070712_100194745
675 Ga0070712_100313493
676 Ga0070712_100339402
677 Ga0075433_10058794
678 Ga0075434_100128414
679 Ga0075434_100473541
680 Ga0075434_100652671
681 Ga0075436_100041015
682 Ga0075435_100009429
683 Ga0075435_100243329
684 Ga0099795_10221999
685 Ga0111539_10327929
686 Ga0105245_11160790
687 Ga0114129_10077941
688 Ga0105239_10662369
689 Ga0157369_10092280
690 Ga0157372_10527403
691 Ga0157375_11832671
692 Ga0163163_11399813
693 Ga0157376_10913598
694 Ga0197907_10101237
695 Ga0206356_11380749
696 Ga0206349_1297673
697 Ga0206351_10206293
698 Ga0206352_11305120
699 Ga0206350_11031564
700 Ga0213875_10242432
701 Ga0224712_10081116
702 Ga0224712_10416432
703 Ga0224572_1000316
704 Ga0207692_10002402
705 Ga0207692_10007215
706 Ga0207692_10018914
707 Ga0207692_10053025
708 Ga0207692_10095171
709 Ga0207692_10099566
710 Ga0207692_10226262
711 Ga0207692_10409367
712 Ga0207685_10003528
713 Ga0207685_10080819
714 Ga0207685_10142451
715 Ga0207699_10007128
716 Ga0207699_10048529
717 Ga0207699_10069051
718 Ga0207699_10144670
719 Ga0207699_10196317
720 Ga0207699_10392410
721 Ga0207699_10397940
722 Ga0207699_10604402
723 Ga0207699_11473576
724 Ga0207684_10008233
725 Ga0207684_10174154
726 Ga0207684_10308350
727 Ga0207684_10349223
728 Ga0207693_10015865
729 Ga0207693_10029568
730 Ga0207693_10033261
731 Ga0207693_10043937
732 Ga0207693_10045231
733 Ga0207693_10052251
734 Ga0207693_10074200
735 Ga0207693_10168342
736 Ga0207693_10659657
737 Ga0207663_10000191
738 Ga0207663_10020738
739 Ga0207663_10070480
740 Ga0207663_10096028
741 Ga0207663_10181835
742 Ga0207663_10238801
743 Ga0207663_10256577
744 Ga0207663_10780352
745 Ga0207646_10001648
746 Ga0207646_10055517
747 Ga0207687_11041721
748 Ga0207700_10004355
749 Ga0207700_10011560
750 Ga0207700_10022333
751 Ga0207700_10026114
752 Ga0207700_10056315
753 Ga0207700_10066239
754 Ga0207700_10116198
755 Ga0207700_10209699
756 Ga0207700_10273520
757 Ga0207700_10303568
758 Ga0207700_10459134
759 Ga0207700_10642511
760 Ga0207700_10765828
761 Ga0207700_11045095
762 Ga0207664_10002149
763 Ga0207664_10003315
764 Ga0207664_10020613
765 Ga0207664_10021032
766 Ga0207664_10026409
767 Ga0207664_10031385
768 Ga0207664_10032231
769 Ga0207664_10058150
770 Ga0207664_10114853
771 Ga0207664_10154668
772 Ga0207664_11216872
773 Ga0207664_11289225
774 Ga0207664_11387280
775 Ga0207664_11610740
776 Ga0207664_11913678
777 Ga0207644_10694600
778 Ga0207665_10006766
779 Ga0207665_10015870
780 Ga0207665_10054908
781 Ga0207665_10353498
782 Ga0207665_10683663
783 Ga0207665_10845462
784 Ga0207667_10980112
785 Ga0207677_12200930
786 Ga0207702_10480384
787 Ga0207702_10539184
788 Ga0207702_11397984
789 Ga0207702_11431553
790 Ga0207702_11576041
791 Ga0207641_10903560
792 Ga0207674_10493172
793 Ga0207428_10275298
794 Ga0265770_1055979
795 Ga0265773_1002014
796 Ga0307508_10356545
797 Ga0316215_1013992
798 Ga0316212_1026964
799 Ga0373959_0177626
800 Ga0373926_0012338
801 Ga0373934_0006098
802 Ga0373934_0019046
803 Ga0373944_0014335
804 Ga0373944_0049239
805 Ga0373944_0424700
806 Ga0373949_0017398
807 Ga0373952_0095987
808 Ga0373923_0030707
809 Ga0373923_0045947
810 Ga0373923_0148466
811 Ga0373936_0017906
812 Ga0373936_0019416
813 Ga0373936_0037461
814 Ga0373941_0036295
815 Ga0373945_0019598
816 Ga0373945_0170101
817 Ga0373945_0233153
818 Ga0373945_0290551
819 Ga0373953_0012974
820 Ga0373953_0019011
821 Ga0373953_0071513
822 Ga0373953_0485159
823 Ga0373954_0068057
824 Ga0373954_0079340
825 Ga0373954_0146272
826 Ga0373956_0026520
827 Ga0373956_0087754
828 Ga0373957_0003153
829 Ga0373957_0029700
830 Ga0373957_0109369
831 Ga0373957_0236895
832 Ga0373957_0265990
833 Ga0373960_0143630
834 Ga0373943_0008001
835 Ga0373943_0348433
836 Ga0373943_0595433
837 Ga0373946_0005494
838 Ga0373946_0061610
839 Ga0373955_0002688
840 Ga0373955_0141397
841 Ga0373955_0184268
842 Ga0373955_0662182
843 Ga0373924_0008626
844 Ga0373924_0020138
845 Ga0373924_0171157
846 Ga0373924_0207833
847 Ga0373924_0222704
848 Ga0373931_0011801
849 Ga0373935_0073959
850 Ga0373935_0117804
851 Ga0373935_0315436
852 Ga0373935_0324691
853 Ga0373927_0053593
854 Ga0373933_0018181
855 Ga0373933_0036719
856 Ga0373933_0037366
857 Ga0373933_0066839
858 Ga0373933_0116343
859 Ga0373933_0172642
860 Ga0373933_0339346
861 Ga0373947_0058800
862 Ga0373947_0119391
863 Ga0373947_0333257
864 Ga0373947_0436372
865 Ga0373937_0000952
866 Ga0373937_0040842
867 Ga0373937_0073897
868 Ga0373937_0082010
869 Ga0373937_0169393
870 Ga0373937_0207521
871 Ga0373937_0419231
872 Ga0373937_0640241
873 Ga0373937_1287413
874 Ga0372808_008527
875 Ga0373925_0001267
876 Ga0373925_0023000
877 Ga0373925_0092435
878 Ga0373925_0127720
879 Ga0373925_0764233
880 Ga0373925_1248194
881 Ga0436364_0684426
882 Ga0436364_1195313
883 Ga0242420_094542
884 Ga0451795_0101689
885 Ga0451841_0859338
886 Ga0466957_0102941
887 Ga0466958_0006957
888 Ga0495592_0001321
889 Ga0495592_0014125
890 Ga0495592_0030838
891 Ga0495592_0063071
892 Ga0495592_0123235
893 Ga0495592_0205501
894 Ga0495603_0006415
895 Ga0495629_0027180
896 Ga0495629_0205236
897 Ga0495641_0025367
898 Ga0495641_0051180
899 Ga0495641_0367299
900 Ga0495651_0000558
901 Ga0495651_0030874
902 Ga0495651_0057083
903 Ga0495651_0120247
904 Ga0495651_0121996
905 Ga0495651_0340906
906 Ga0495651_0762168
907 Ga0495653_0002218
908 Ga0495653_0004228
909 Ga0495653_0059602
910 Ga0495653_0067070
911 Ga0495653_0080959
912 Ga0495653_0243510
913 Ga0495653_0461725
914 Ga0495580_0121943
915 Ga0495582_0010281
916 Ga0495582_0022120
917 Ga0495582_0265871
918 Ga0495639_0010575
919 Ga0495639_0013707
920 Ga0495662_0005150
921 Ga0495664_0029056
922 Ga0495664_0065923
923 Ga0495664_0334630
924 Ga0495664_0357670
925 Ga0495664_0534681
926 Ga0495664_0606246
927 Ga0495594_0021236
928 Ga0495608_0027814
929 Ga0495608_0068485
930 Ga0495608_0146343
931 Ga0495608_0232564
932 Ga0495608_0818680
933 Ga0495618_0014938
934 Ga0495618_0025768
935 Ga0495618_0165554
936 Ga0495618_0215851
937 Ga0495618_0304312
938 Ga0495628_0003235
939 Ga0495628_0008696
940 Ga0495628_0054593
941 Ga0495628_0079285
942 Ga0495628_0117436
943 Ga0495628_0176468
944 Ga0495628_0217035
945 Ga0495628_0700480
946 Ga0495628_1174172
947 Ga0495630_0027165
948 Ga0495630_0051319
949 Ga0495630_0103388
950 Ga0495630_0584780
951 Ga0495630_0903134
952 Ga0495630_0976196
953 Ga0495630_1206299
954 Ga0495666_0001924
955 Ga0495652_0002858
956 Ga0495652_0251029
957 Ga0495652_0324187
958 Ga0495652_0339528
959 Ga0495652_0536935
960 Ga0495665_0009483
961 Ga0495665_0062310
962 Ga0495665_0077813
963 Ga0495665_0140417
964 Ga0495640_0004138
965 Ga0495640_0007438
966 Ga0495640_0041014
967 Ga0495640_0274451
968 Ga0495586_0031877
969 Ga0495586_0101695
970 Ga0495586_0112564
971 Ga0495587_0002740
972 Ga0495587_0017571
973 Ga0495587_0091009
974 Ga0495587_0176939
975 Ga0495587_0226226
976 Ga0495645_0001518
977 Ga0495645_0065246
978 Ga0495645_0098364
979 Ga0495622_0078509
980 Ga0495667_0000852
981 Ga0495667_0012612
982 Ga0495667_0027054
983 Ga0495667_0036238
984 Ga0495667_0615941
985 Ga0495667_0867481
986 Ga0495634_0006540
987 Ga0495634_0033479
988 Ga0495634_0044648
989 Ga0495634_0082478
990 Ga0495635_0005579
991 Ga0495635_0028093
992 Ga0495635_0100427
993 Ga0495635_0102533
994 Ga0495635_0185938
995 Ga0495635_0227541
996 Ga0495635_0922457
997 Ga0495657_0002208
998 Ga0495657_0034230
999 Ga0495657_0098328
1000 Ga0495657_0334985
1001 Ga0495657_0354111
1002 Ga0495599_0001902
1003 Ga0495599_0035693
1004 Ga0495599_0037462
1005 Ga0495599_0039487
1006 Ga0495599_0113465
1007 Ga0495623_0021978
1008 Ga0495623_0072193
1009 Ga0495623_0167286
1010 Ga0495646_0007588
1011 Ga0495646_0009445
1012 Ga0495646_0016320
1013 Ga0495646_0051944
1014 Ga0495647_0009447
1015 Ga0495647_0050531
1016 Ga0495658_0048663
1017 Ga0495613_0025065
1018 Ga0495613_0045222
1019 Ga0495624_0008307
1020 Ga0495624_0049868
1021 Ga0495600_0003018
1022 Ga0495600_0003359
1023 Ga0495600_0019886
1024 Ga0495600_0063128
1025 Ga0495600_0256525
1026 Ga0495600_0321343
1027 Ga0495600_0363879
1028 Ga0495600_0460931
1029 Ga0495581_0011474
1030 Ga0495581_0034087
1031 Ga0495581_0072949
1032 Ga0495604_0002133
1033 Ga0495604_0008180
1034 Ga0495604_0040205
1035 Ga0495674_0005699
1036 Ga0495674_0054718
1037 Ga0495674_0119134
1038 Ga0495674_0125338
1039 Ga0495674_0251782
1040 Ga0495674_0437699
1041 Ga0495674_0905780
1042 Ga0495676_0010004
1043 Ga0495680_0003622
1044 Ga0495680_0004469
1045 Ga0495680_0010978
1046 Ga0495680_0104554
1047 Ga0495680_0106955
1048 Ga0495680_0109342
1049 Ga0495680_0291440
1050 Ga0495680_0634625
1051 Ga0495675_0014650
1052 Ga0495675_0014731
1053 Ga0495675_0628921
1054 Ga0495684_0000448
1055 Ga0495684_0006269
1056 Ga0495684_0007030
1057 Ga0495684_0071054
1058 Ga0495684_0178805
1059 Ga0495684_0233352
1060 Ga0495684_0357834
1061 Ga0495684_0515814
1062 Ga0495593_0017099
1063 Ga0495593_0023476
1064 Ga0495593_0088406
1065 Ga0495602_0002546
1066 Ga0495602_0025468
1067 Ga0495602_0249248
1068 Ga0495602_0379302
1069 Ga0495602_0447911
1070 Ga0495602_0491670
1071 Ga0495602_0507931
1072 Ga0495602_0517575
1073 Ga0495614_0059846
1074 Ga0496100_0054454
1075 Ga0496100_1110920
1076 Ga0496101_0708236
1077 Ga0496102_0568917
1078 Ga0496102_0700470
1079 Ga0496102_1066692
1080 Ga0496104_0041262
1081 Ga0496104_0629746
1082 Ga0496105_0012366
1083 Ga0496105_0027530
1084 Ga0496106_0046973
1085 Ga0496106_0430785
1086 Ga0496107_0046617
1087 Ga0496107_0262858
1088 Ga0496108_0043222
1089 Ga0496108_0150533
1090 Ga0496108_0196092
1091 Ga0496108_0496564
1092 Ga0496109_0047708
1093 Ga0496109_0079529
1094 Ga0496109_0260000
1095 Ga0496109_0405450
1096 Ga0496109_0476056
1097 Ga0496109_0602218
1098 Ga0496110_0100364
1099 Ga0496110_0616737
1100 Ga0496112_0039071
1101 Ga0496112_0085351
1102 Ga0496112_0326159
1103 Ga0496112_0592851
1104 Ga0496113_0092309
1105 Ga0496113_0385011
1106 Ga0496113_0717767
1107 Ga0496113_0855772
1108 Ga0496114_0058510
1109 Ga0496115_0000996
1110 Ga0496115_0079466
1111 Ga0496115_0107476
1112 Ga0496126_0019530
1113 Ga0496126_0075254
1114 nmdc:mga05p37_132279_c1
1115 nmdc:mga08y16_463593_c1
1116 nmdc:mga0n895_312114_c1
1117 nmdc:mga0n895_68657_c1
1118 nmdc:mga0rr50_172678_c1
1119 nmdc:mga0rr50_681532_c1
1120 nmdc:mga08x19_248329_c1
1121 nmdc:mga08x19_2702_c1
1122 Ga0495601_0002968
1123 Ga0495601_0051539
1124 Ga0495601_0154582
1125 Ga0495601_0168352
1126 Ga0495601_0243645
1127 Ga0495601_0574411
1128 Ga0495612_0006539
1129 Ga0495612_0120335
1130 Ga0495612_0203115
1131 Ga0495612_0310045
1132 Ga0495595_0012433
1133 Ga0495595_0014882
1134 Ga0495595_0111350
1135 Ga0495595_0114282
1136 Ga0495595_0244159
1137 Ga0495595_0275510
1138 Ga0495619_0049940
1139 Ga0495619_0053297
1140 Ga0495619_0094826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

4

145

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.7933 3 148
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.7879 1 145
3neg-assembly2.cif.gz_B pyrabactin-bound pyl1 structure in the open and close forms 0.7779 2 144
4xrw-assembly1.cif.gz_A crystal structure of the di-domain aro/cyc bexl from the be-7585a biosynthetic pathway 0.7644 1 150
1xn5-assembly1.cif.gz_A solution structure of bacillus halodurans protein bh1534: the northeast structural genomics consortium target bhr29 0.7642 1 140
ID Description Score Start End Superfamily
af_A0A1D8PNQ2_25_168_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.798 3 148 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7897 1 150 3.30.530.20
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7892 4 148 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.785 1 150 3.30.530.20
af_P9WLU7_2_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7833 3 144 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A521CS85-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9307 1 149
AF-A0A7Y5WH31-F1-model_v4 SRPBCC family protein 0.9168 3 149
AF-A0A7Y7ISL0-F1-model_v4 SRPBCC family protein 0.916 1 148
AF-A0A521CS85-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9123 1 149
AF-A0A543P0H4-F1-model_v4 Polyketide cyclase/dehydrase/lipid transport protein 0.9076 1 130

Map