F464703

General Info

Members Datasets Scaffolds Average Seq Length
569 296 1138 191

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10140524|Ga0070681_101405242
Length 199
Sequence VIVARLMPPAEMVHWWFATGFLTLGLLLVAEALVGRETWTARPWRRYLWPGLLFFLGVAMWPVMTFYTNSTIHMIAHGSWAQVLMLAGGAELGLARGKLRSPYWRLCTTLAMLVSGAALLAHEQQPWLFARAPFLHHALGWTIVGGSVFPLLQAFRPRSVVAAAGFAATVIAVSVMLYSDRDIAPIFGHLSPYAGVQHR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
165 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
198 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
199 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 6.68
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 21.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10140524 3300005458 Bacteria 2345
2 JGI25406J46586_10002096 3300003203 Bacteria 9422
3 Ga0070658_10486804 3300005327 Bacteria 1065
4 Ga0070683_100022352 3300005329 Bacteria 5652
5 Ga0070683_100064775 3300005329 Bacteria 3403
6 Ga0070683_100065377 3300005329 Bacteria 3386
7 Ga0070690_100036578 3300005330 Bacteria 3086
8 Ga0070690_100114152 3300005330 Bacteria 1806
9 Ga0070670_100152610 3300005331 Bacteria 1999
10 Ga0070670_101219343 3300005331 Bacteria 688
11 Ga0070666_10273136 3300005335 Unclassified 1200
12 Ga0070666_10469037 3300005335 Bacteria 911
13 Ga0070680_100009172 3300005336 Bacteria 7586
14 Ga0070680_100109588 3300005336 Bacteria 2298
15 Ga0070680_100124891 3300005336 Bacteria 2150
16 Ga0070680_100270858 3300005336 Unclassified 1438
17 Ga0070682_100028459 3300005337 Bacteria 3361
18 Ga0070682_100059086 3300005337 Bacteria 2420
19 Ga0070682_100224135 3300005337 Unclassified 1340
20 Ga0068868_100242618 3300005338 Unclassified 1514
21 Ga0068868_100480250 3300005338 Bacteria 1085
22 Ga0070660_100035010 3300005339 Bacteria 3798
23 Ga0070660_100046607 3300005339 Unclassified 3323
24 Ga0070660_100062949 3300005339 Bacteria 2883
25 Ga0070660_100208507 3300005339 Unclassified 1586
26 Ga0070660_100290515 3300005339 Bacteria 1339
27 Ga0070660_100368596 3300005339 Unclassified 1185
28 Ga0070689_100130781 3300005340 Bacteria 2013
29 Ga0070689_100631992 3300005340 Unclassified 930
30 Ga0070691_10007000 3300005341 Bacteria 5167
31 Ga0070691_10121666 3300005341 Bacteria 1315
32 Ga0070687_100007025 3300005343 Bacteria 4658
33 Ga0070687_100016961 3300005343 Bacteria 3338
34 Ga0070661_100019120 3300005344 Bacteria 4877
35 Ga0070692_10016518 3300005345 Bacteria 3511
36 Ga0070692_10043730 3300005345 Unclassified 2305
37 Ga0070692_10054979 3300005345 Bacteria 2080
38 Ga0070692_10055381 3300005345 Unclassified 2073
39 Ga0070668_100157961 3300005347 Unclassified 1838
40 Ga0070668_100211056 3300005347 Unclassified 1597
41 Ga0070669_100390012 3300005353 Unclassified 1137
42 Ga0070669_100639818 3300005353 Unclassified 894
43 Ga0070675_100187543 3300005354 Bacteria 1791
44 Ga0070675_100692775 3300005354 Unclassified 928
45 Ga0070671_100588903 3300005355 Unclassified 961
46 Ga0070674_100016384 3300005356 Bacteria 4645
47 Ga0070674_100163070 3300005356 Bacteria 1693
48 Ga0070673_100148885 3300005364 Bacteria 1981
49 Ga0070688_100129846 3300005365 Unclassified 1698
50 Ga0070659_100029578 3300005366 Bacteria 4234
51 Ga0070659_100040104 3300005366 Bacteria 3658
52 Ga0070659_100095718 3300005366 Unclassified 2385
53 Ga0070659_100112632 3300005366 Unclassified 2197
54 Ga0070659_100477851 3300005366 Bacteria 1060
55 Ga0070703_10048240 3300005406 Bacteria 1352
56 Ga0070709_10680847 3300005434 Unclassified 799
57 Ga0070709_10850675 3300005434 Unclassified 719
58 Ga0070714_100423822 3300005435 Bacteria 1261
59 Ga0070710_10035152 3300005437 Bacteria 2731
60 Ga0070701_10009600 3300005438 Bacteria 4244
61 Ga0070701_10091464 3300005438 Bacteria 1667
62 Ga0070700_100003808 3300005441 Bacteria 7813
63 Ga0070700_100577107 3300005441 Unclassified 877
64 Ga0070694_100107750 3300005444 Bacteria 1981
65 Ga0070694_100142606 3300005444 Bacteria 1741
66 Ga0070694_100197159 3300005444 Bacteria 1499
67 Ga0070694_100235847 3300005444 Unclassified 1378
68 Ga0070663_100061257 3300005455 Bacteria 2709
69 Ga0070678_100061675 3300005456 Bacteria 2765
70 Ga0070678_100086442 3300005456 Unclassified 2392
71 Ga0070678_100754050 3300005456 Bacteria 881
72 Ga0070662_100022108 3300005457 Bacteria 4349
73 Ga0070662_100246591 3300005457 Unclassified 1434
74 Ga0070681_10025338 3300005458 Bacteria 5966
75 Ga0068867_100172209 3300005459 Bacteria 1715
76 Ga0070685_10010721 3300005466 Bacteria 4771
77 Ga0070706_100268343 3300005467 Bacteria 1593
78 Ga0070707_100120264 3300005468 Unclassified 2550
79 Ga0070698_100039665 3300005471 Bacteria 4844
80 Ga0070698_100131841 3300005471 Bacteria 2454
81 Ga0070698_100192847 3300005471 Bacteria 1974
82 Ga0070699_100124423 3300005518 Bacteria 2269
83 Ga0070679_100016894 3300005530 Bacteria 7054
84 Ga0070679_100175122 3300005530 Bacteria 2118
85 Ga0070679_100974744 3300005530 Bacteria 792
86 Ga0070684_100024269 3300005535 Bacteria 5084
87 Ga0070684_100035164 3300005535 Bacteria 4287
88 Ga0070684_100042591 3300005535 Bacteria 3920
89 Ga0070684_100059516 3300005535 Bacteria 3340
90 Ga0070697_100837439 3300005536 Bacteria 815
91 Ga0068853_100029728 3300005539 Bacteria 4608
92 Ga0068853_100037603 3300005539 Bacteria 4119
93 Ga0068853_100040737 3300005539 Bacteria 3965
94 Ga0068853_100150181 3300005539 Bacteria 2097
95 Ga0070672_100127250 3300005543 Bacteria 2090
96 Ga0070672_100794160 3300005543 Bacteria 833
97 Ga0070686_100011102 3300005544 Bacteria 5103
98 Ga0070686_100018854 3300005544 Bacteria 4057
99 Ga0070695_100031269 3300005545 Bacteria 3319
100 Ga0070695_100316386 3300005545 Bacteria 1159
101 Ga0070696_100210350 3300005546 Bacteria 1456
102 Ga0070665_100025667 3300005548 Bacteria 5935
103 Ga0070704_100052856 3300005549 Bacteria 2868
104 Ga0070704_100099377 3300005549 Unclassified 2188
105 Ga0070704_100234738 3300005549 Bacteria 1498
106 Ga0068855_100067254 3300005563 Bacteria 4175
107 Ga0068855_100180102 3300005563 Unclassified 2390
108 Ga0070664_100026146 3300005564 Bacteria 4840
109 Ga0070664_100173619 3300005564 Bacteria 1913
110 Ga0070664_100247133 3300005564 Bacteria 1603
111 Ga0068857_100060001 3300005577 Bacteria 3380
112 Ga0068857_101372559 3300005577 Bacteria 687
113 Ga0068854_100035666 3300005578 Bacteria 3483
114 Ga0068856_100015345 3300005614 Bacteria 7404
115 Ga0070702_100040690 3300005615 Bacteria 2602
116 Ga0070702_100146471 3300005615 Unclassified 1510
117 Ga0070702_100155648 3300005615 Bacteria 1472
118 Ga0068852_100023502 3300005616 Bacteria 4962
119 Ga0068852_100043381 3300005616 Bacteria 3815
120 Ga0068859_100149723 3300005617 Bacteria 2409
121 Ga0068866_10021327 3300005718 Bacteria 2983
122 Ga0068861_100025427 3300005719 Bacteria 4294
123 Ga0068861_100033748 3300005719 Bacteria 3778
124 Ga0068870_10062801 3300005840 Unclassified 2002
125 Ga0068860_100196800 3300005843 Unclassified 1952
126 Ga0068860_100201114 3300005843 Bacteria 1931
127 Ga0068862_100114480 3300005844 Bacteria 2371
128 Ga0068862_100141432 3300005844 Unclassified 2136
129 Ga0068862_100167530 3300005844 Unclassified 1965
130 Ga0068862_100192227 3300005844 Bacteria 1837
131 Ga0081455_10085166 3300005937 Bacteria 2578
132 Ga0081455_10133012 3300005937 Unclassified 1942
133 Ga0081540_1015334 3300005983 Bacteria 4855
134 Ga0081539_10000957 3300005985 Bacteria 54155
135 Ga0070717_11377096 3300006028 Unclassified 641
136 Ga0075363_100443297 3300006048 Bacteria 766
137 Ga0075364_10017740 3300006051 Bacteria 4451
138 Ga0075432_10001561 3300006058 Bacteria 7504
139 Ga0075432_10031393 3300006058 Bacteria 1839
140 Ga0070716_100016263 3300006173 Bacteria 3835
141 Ga0070712_100001869 3300006175 Bacteria 12850
142 Ga0070712_100143850 3300006175 Bacteria 1823
143 Ga0075367_10148553 3300006178 Bacteria 1454
144 Ga0097621_100231610 3300006237 Bacteria 1613
145 Ga0075428_100005760 3300006844 Bacteria 13762
146 Ga0075431_100911452 3300006847 Bacteria 848
147 Ga0075431_100920994 3300006847 Bacteria 843
148 Ga0075433_10032005 3300006852 Bacteria 4502
149 Ga0075433_10332287 3300006852 Unclassified 1344
150 Ga0075434_100073858 3300006871 Bacteria 3403
151 Ga0075434_100184798 3300006871 Bacteria 2105
152 Ga0075429_100107837 3300006880 Bacteria 2434
153 Ga0068865_100005558 3300006881 Bacteria 7643
154 Ga0068865_100087519 3300006881 Bacteria 2252
155 Ga0068865_100090357 3300006881 Bacteria 2220
156 Ga0097620_100149725 3300006931 Bacteria 2409
157 Ga0111539_10026963 3300009094 Bacteria 7018
158 Ga0111539_10075619 3300009094 Bacteria 3967
159 Ga0105245_10002081 3300009098 Bacteria 18166
160 Ga0105245_10026840 3300009098 Bacteria 5071
161 Ga0105245_10069905 3300009098 Bacteria 3184
162 Ga0105245_10321062 3300009098 Unclassified 1525
163 Ga0105247_10105173 3300009101 Unclassified 1809
164 Ga0105243_10020133 3300009148 Bacteria 5057
165 Ga0105243_10057700 3300009148 Unclassified 3092
166 Ga0105243_10170456 3300009148 Unclassified 1884
167 Ga0105241_10057291 3300009174 Bacteria 2989
168 Ga0105242_10077209 3300009176 Bacteria 2778
169 Ga0105242_10115558 3300009176 Bacteria 2294
170 Ga0105242_10153601 3300009176 Bacteria 2009
171 Ga0105248_10659601 3300009177 Bacteria 1180
172 Ga0105237_10545914 3300009545 Unclassified 1166
173 Ga0105237_10893053 3300009545 Unclassified 896
174 Ga0105238_10285184 3300009551 Unclassified 1633
175 Ga0105249_10016308 3300009553 Bacteria 6589
176 Ga0105249_10257418 3300009553 Bacteria 1733
177 Ga0105249_10369048 3300009553 Bacteria 1458
178 Ga0105239_10040290 3300010375 Bacteria 5118
179 Ga0105239_10047974 3300010375 Bacteria 4681
180 Ga0105239_10108287 3300010375 Unclassified 3079
181 Ga0105239_10222705 3300010375 Bacteria 2116
182 Ga0105246_10283081 3300011119 Unclassified 1331
183 Ga0105246_10326598 3300011119 Unclassified 1249
184 Ga0157371_10143738 3300013102 Bacteria 1700
185 Ga0157371_10166783 3300013102 Bacteria 1573
186 Ga0157370_10718124 3300013104 Bacteria 912
187 Ga0157369_10009150 3300013105 Bacteria 11333
188 Ga0157369_10504287 3300013105 Bacteria 1252
189 Ga0157374_10067726 3300013296 Bacteria 3357
190 Ga0157374_10290158 3300013296 Bacteria 1617
191 Ga0157378_10108563 3300013297 Bacteria 2541
192 Ga0163162_10012596 3300013306 Bacteria 8259
193 Ga0157372_10107788 3300013307 Bacteria 3188
194 Ga0157372_10175889 3300013307 Bacteria 2477
195 Ga0157372_10487649 3300013307 Unclassified 1437
196 Ga0157375_10054216 3300013308 Bacteria 3948
197 Ga0157375_10071580 3300013308 Bacteria 3481
198 Ga0157375_10908985 3300013308 Bacteria 1024
199 Ga0157380_10189192 3300014326 Bacteria 1815
200 Ga0157380_10536530 3300014326 Unclassified 1145
201 Ga0182008_10137880 3300014497 Unclassified 1219
202 Ga0182008_10316868 3300014497 Unclassified 820
203 Ga0157377_10033176 3300014745 Bacteria 2816
204 Ga0157377_10037832 3300014745 Bacteria 2661
205 Ga0157376_10006447 3300014969 Bacteria 8289
206 Ga0157376_11418910 3300014969 Unclassified 726
207 Ga0182007_10028755 3300015262 Unclassified 1908
208 Ga0163161_10064123 3300017792 Unclassified 2679
209 Ga0163161_10606496 3300017792 Bacteria 903
210 Ga0206354_11232971 3300020081 Bacteria 2053
211 Ga0213871_10016503 3300021441 Unclassified 1782
212 Ga0207642_10016374 3300025899 Bacteria 2791
213 Ga0207710_10264343 3300025900 Unclassified 863
214 Ga0207688_10065988 3300025901 Bacteria 2046
215 Ga0207688_10139964 3300025901 Unclassified 1424
216 Ga0207688_10195627 3300025901 Bacteria 1211
217 Ga0207680_10247738 3300025903 Unclassified 1230
218 Ga0207680_10440394 3300025903 Bacteria 924
219 Ga0207647_10076633 3300025904 Unclassified 2011
220 Ga0207699_10031652 3300025906 Bacteria 2972
221 Ga0207699_10746568 3300025906 Unclassified 718
222 Ga0207645_10501971 3300025907 Bacteria 821
223 Ga0207643_10129510 3300025908 Bacteria 1500
224 Ga0207705_10297129 3300025909 Bacteria 1238
225 Ga0207654_10249259 3300025911 Bacteria 1190
226 Ga0207707_10073594 3300025912 Bacteria 2979
227 Ga0207693_10001278 3300025915 Bacteria 22410
228 Ga0207693_10120182 3300025915 Unclassified 2063
229 Ga0207660_10094897 3300025917 Bacteria 2218
230 Ga0207660_10096157 3300025917 Bacteria 2205
231 Ga0207660_10243387 3300025917 Unclassified 1418
232 Ga0207662_10004091 3300025918 Bacteria 7625
233 Ga0207662_10010574 3300025918 Bacteria 5101
234 Ga0207657_10013045 3300025919 Bacteria 8167
235 Ga0207657_10018075 3300025919 Bacteria 6745
236 Ga0207657_10025687 3300025919 Bacteria 5426
237 Ga0207657_10042838 3300025919 Bacteria 3991
238 Ga0207657_10069037 3300025919 Bacteria 3001
239 Ga0207649_10030780 3300025920 Bacteria 3182
240 Ga0207652_10086732 3300025921 Bacteria 2745
241 Ga0207652_10105963 3300025921 Bacteria 2488
242 Ga0207652_10171243 3300025921 Bacteria 1948
243 Ga0207646_10851979 3300025922 Unclassified 810
244 Ga0207681_10342823 3300025923 Unclassified 1194
245 Ga0207681_10360445 3300025923 Unclassified 1166
246 Ga0207650_10017900 3300025925 Bacteria 4965
247 Ga0207650_10859329 3300025925 Bacteria 770
248 Ga0207659_10564708 3300025926 Bacteria 968
249 Ga0207687_10020508 3300025927 Bacteria 4385
250 Ga0207687_10098506 3300025927 Bacteria 2147
251 Ga0207664_10003749 3300025929 Bacteria 10207
252 Ga0207664_10383675 3300025929 Bacteria 1248
253 Ga0207644_10322320 3300025931 Bacteria 1250
254 Ga0207690_10004187 3300025932 Bacteria 8523
255 Ga0207690_10031885 3300025932 Unclassified 3377
256 Ga0207690_10046546 3300025932 Bacteria 2874
257 Ga0207706_10004239 3300025933 Bacteria 13502
258 Ga0207706_10009347 3300025933 Bacteria 9001
259 Ga0207706_10040623 3300025933 Bacteria 4123
260 Ga0207706_10228929 3300025933 Unclassified 1627
261 Ga0207686_10113313 3300025934 Bacteria 1833
262 Ga0207686_10166278 3300025934 Bacteria 1551
263 Ga0207709_10063508 3300025935 Bacteria 2315
264 Ga0207709_10122358 3300025935 Unclassified 1759
265 Ga0207709_10124403 3300025935 Bacteria 1747
266 Ga0207670_10154686 3300025936 Unclassified 1705
267 Ga0207704_10091878 3300025938 Bacteria 1996
268 Ga0207704_10196105 3300025938 Bacteria 1473
269 Ga0207665_10038387 3300025939 Bacteria 3189
270 Ga0207691_10036980 3300025940 Bacteria 4522
271 Ga0207711_10121691 3300025941 Bacteria 2330
272 Ga0207711_10461208 3300025941 Unclassified 1183
273 Ga0207661_10001700 3300025944 Bacteria 15014
274 Ga0207661_10041169 3300025944 Bacteria 3636
275 Ga0207661_10058424 3300025944 Bacteria 3104
276 Ga0207679_10206031 3300025945 Bacteria 1646
277 Ga0207679_10426650 3300025945 Bacteria 1171
278 Ga0207667_10504821 3300025949 Bacteria 1226
279 Ga0207651_10203014 3300025960 Bacteria 1590
280 Ga0207651_10317630 3300025960 Bacteria 1301
281 Ga0207712_10080628 3300025961 Bacteria 2368
282 Ga0207668_10139314 3300025972 Bacteria 1863
283 Ga0207668_10254203 3300025972 Bacteria 1429
284 Ga0207658_10352953 3300025986 Unclassified 1281
285 Ga0207677_11087386 3300026023 Unclassified 728
286 Ga0207639_10127184 3300026041 Bacteria 2104
287 Ga0207639_10153374 3300026041 Bacteria 1932
288 Ga0207678_10118201 3300026067 Bacteria 2262
289 Ga0207708_10000352 3300026075 Bacteria 36059
290 Ga0207708_10022379 3300026075 Bacteria 4773
291 Ga0207702_10075995 3300026078 Bacteria 2902
292 Ga0207648_10000454 3300026089 Bacteria 45454
293 Ga0207648_10004275 3300026089 Bacteria 14729
294 Ga0207674_10013309 3300026116 Bacteria 9138
295 Ga0207675_100023378 3300026118 Bacteria 5749
296 Ga0207675_100024488 3300026118 Bacteria 5611
297 Ga0207675_100056891 3300026118 Bacteria 3648
298 Ga0207683_10001930 3300026121 Bacteria 18362
299 Ga0207683_10351182 3300026121 Bacteria 1353
300 Ga0207698_10341528 3300026142 Unclassified 1411
301 Ga0207698_11119553 3300026142 Bacteria 800
302 Ga0207428_10000511 3300027907 Bacteria 46384
303 Ga0207428_10166605 3300027907 Bacteria 1671
304 Ga0268266_10341682 3300028379 Unclassified 1405
305 Ga0268265_10368978 3300028380 Bacteria 1317
306 Ga0268264_10130123 3300028381 Unclassified 2230
307 Ga0268264_10329320 3300028381 Unclassified 1447
308 Ga0265326_10129601 3300028558 Unclassified 718
309 Ga0265319_1000988 3300028563 Bacteria 17808
310 Ga0265319_1111890 3300028563 Unclassified 853
311 Ga0265334_10100413 3300028573 Bacteria 1048
312 Ga0265318_10009298 3300028577 Bacteria 4328
313 Ga0265336_10044752 3300028666 Bacteria 1347
314 Ga0265338_10022091 3300028800 Bacteria 6607
315 Ga0265338_10191381 3300028800 Bacteria 1550
316 Ga0265332_10137629 3300031238 Bacteria 1024
317 Ga0265320_10004170 3300031240 Bacteria 9496
318 Ga0265325_10278001 3300031241 Bacteria 751
319 Ga0265340_10076162 3300031247 Bacteria 1585
320 Ga0265340_10166694 3300031247 Unclassified 999
321 Ga0265339_10184117 3300031249 Bacteria 1039
322 Ga0265327_10054639 3300031251 Bacteria 2066
323 Ga0265327_10178126 3300031251 Bacteria 973
324 Ga0265316_10267152 3300031344 Bacteria 1253
325 Ga0265314_10072909 3300031711 Bacteria 2291
326 Ga0307406_10248404 3300031901 Bacteria 1339
327 Ga0307409_100075235 3300031995 Bacteria 2703
328 Ga0307416_100027612 3300032002 Bacteria 4207
329 Ga0373958_0010635 3300034819 Bacteria 1539
330 Ga0373926_0144499 3300035083 Bacteria 904
331 Ga0373943_0004056 3300035170 Bacteria 6647
332 Ga0373943_0025166 3300035170 Bacteria 2781
333 Ga0373955_0022313 3300035172 Bacteria 3210
334 Ga0373924_0136489 3300035410 Bacteria 1069
335 Ga0373931_0268332 3300035691 Unclassified 1044
336 Ga0373935_0169370 3300035692 Bacteria 1493
337 Ga0373947_0007884 3300035725 Bacteria 6147
338 Ga0373937_0012092 3300036401 Bacteria 7575
339 Ga0373925_0093675 3300037068 Bacteria 2299
340 Ga0395899_0000892 3300037312 Bacteria 28233
341 Ga0395899_0008990 3300037312 Bacteria 7682
342 Ga0395899_0034537 3300037312 Bacteria 3798
343 Ga0395899_0283643 3300037312 Bacteria 1126
344 Ga0395900_0007337 3300037418 Bacteria 11406
345 Ga0395900_0016995 3300037418 Bacteria 7425
346 Ga0395900_0096700 3300037418 Bacteria 3034
347 Ga0395900_0130404 3300037418 Bacteria 2577
348 Ga0395900_0256210 3300037418 Bacteria 1749
349 Ga0395900_0472313 3300037418 Bacteria 1207
350 Ga0395900_0690042 3300037418 Unclassified 955
351 Ga0395898_0002095 3300037466 Bacteria 24808
352 Ga0395898_0020420 3300037466 Bacteria 6726
353 Ga0395898_0053816 3300037466 Bacteria 3929
354 Ga0395898_0129398 3300037466 Unclassified 2419
355 Ga0395898_0148837 3300037466 Bacteria 2241
356 Ga0395898_0263695 3300037466 Bacteria 1643
357 Ga0395898_0330199 3300037466 Bacteria 1454
358 Ga0395905_0005084 3300037471 Bacteria 13537
359 Ga0395905_0015829 3300037471 Bacteria 7163
360 Ga0395905_0053405 3300037471 Bacteria 3782
361 Ga0395905_0070634 3300037471 Bacteria 3273
362 Ga0395905_0106405 3300037471 Bacteria 2634
363 Ga0395905_0261608 3300037471 Bacteria 1615
364 Ga0395901_0002062 3300038443 Bacteria 20611
365 Ga0395901_0036650 3300038443 Bacteria 5069
366 Ga0395901_0039557 3300038443 Bacteria 4880
367 Ga0395901_0086912 3300038443 Bacteria 3269
368 Ga0395901_0177302 3300038443 Bacteria 2235
369 Ga0395901_0282629 3300038443 Unclassified 1724
370 Ga0395901_0302153 3300038443 Unclassified 1659
371 Ga0395901_0326877 3300038443 Bacteria 1586
372 Ga0395901_0991270 3300038443 Bacteria 817
373 Ga0436360_0310451 3300039438 Bacteria 6794
374 Ga0450906_044770 3300042145 Unclassified 781
375 Ga0450907_002412 3300042146 Bacteria 3570
376 Ga0450910_014466 3300042147 Unclassified 1154
377 Ga0466969_0267270 3300044656 Bacteria 775
378 Ga0466963_0003864 3300044694 Bacteria 8646
379 Ga0466963_0006619 3300044694 Bacteria 6874
380 Ga0466963_0329021 3300044694 Unclassified 1076
381 Ga0466964_0009150 3300044706 Bacteria 3727
382 Ga0466970_0570193 3300044765 Unclassified 655
383 Ga0466957_0069076 3300044842 Bacteria 2182
384 Ga0466957_0150016 3300044842 Unclassified 1507
385 Ga0466957_0224955 3300044842 Bacteria 1240
386 Ga0466957_0536803 3300044842 Bacteria 814
387 Ga0466958_0011419 3300045836 Bacteria 5003
388 Ga0466958_0150275 3300045836 Unclassified 1469
389 Ga0466958_0333825 3300045836 Unclassified 975
390 Ga0466958_0557839 3300045836 Bacteria 744
391 Ga0466967_0051841 3300045976 Bacteria 3598
392 Ga0466967_0195143 3300045976 Bacteria 1915
393 Ga0466967_0498439 3300045976 Unclassified 1195
394 Ga0495603_0011185 3300046455 Bacteria 5439
395 Ga0495603_0053376 3300046455 Bacteria 2398
396 Ga0495603_0075374 3300046455 Bacteria 1980
397 Ga0495641_0251055 3300046461 Unclassified 795
398 Ga0495651_0053163 3300046462 Bacteria 3119
399 Ga0495653_0026351 3300046463 Bacteria 4661
400 Ga0495582_0053629 3300046473 Bacteria 2224
401 Ga0495639_0202983 3300046475 Bacteria 971
402 Ga0495584_0111878 3300046491 Unclassified 1381
403 Ga0495594_0145049 3300046499 Bacteria 1347
404 Ga0495607_0159851 3300046501 Unclassified 1146
405 Ga0495608_0021158 3300046511 Bacteria 4466
406 Ga0495618_0338678 3300046514 Bacteria 929
407 Ga0495630_0307076 3300046517 Archaea 1212
408 Ga0495630_0373430 3300046517 Unclassified 1092
409 Ga0495630_0442406 3300046517 Bacteria 996
410 Ga0495630_0488547 3300046517 Unclassified 944
411 Ga0495631_0277979 3300046518 Bacteria 713
412 Ga0495644_0111434 3300046523 Bacteria 1038
413 Ga0495652_0143622 3300046529 Bacteria 1874
414 Ga0495652_0412999 3300046529 Bacteria 953
415 Ga0495635_0284972 3300046663 Bacteria 1109
416 Ga0495661_0095764 3300046665 Unclassified 1680
417 Ga0495588_0066683 3300046674 Bacteria 1868
418 Ga0495657_0017558 3300046675 Bacteria 5192
419 Ga0495623_0186180 3300046679 Bacteria 1203
420 Ga0495647_0110423 3300046681 Archaea 1147
421 Ga0495658_0105582 3300046683 Bacteria 1687
422 Ga0495613_0113411 3300046689 Bacteria 1952
423 Ga0495624_0201454 3300046690 Unclassified 1209
424 Ga0495670_0394239 3300046691 Unclassified 748
425 Ga0495671_0221968 3300046692 Unclassified 915
426 Ga0495581_0002623 3300047315 Bacteria 10232
427 Ga0495676_0100667 3300047321 Bacteria 2139
428 Ga0495676_0130326 3300047321 Unclassified 1816
429 Ga0495676_0135321 3300047321 Bacteria 1773
430 Ga0495680_0370487 3300047322 Bacteria 994
431 Ga0495675_0065250 3300047444 Bacteria 2303
432 Ga0495614_0051593 3300048089 Unclassified 1763
433 Ga0495614_0139127 3300048089 Archaea 1078
434 Ga0496100_0008705 3300048903 Bacteria 5670
435 Ga0496100_0122609 3300048903 Bacteria 1820
436 Ga0496100_0509064 3300048903 Unclassified 928
437 Ga0496101_0032393 3300048904 Bacteria 3680
438 Ga0496101_0035759 3300048904 Bacteria 3514
439 Ga0496102_0214743 3300048905 Unclassified 1813
440 Ga0496102_0303577 3300048905 Bacteria 1504
441 Ga0496102_0436571 3300048905 Bacteria 1229
442 Ga0496103_0014071 3300048906 Bacteria 4750
443 Ga0496103_0089246 3300048906 Bacteria 1944
444 Ga0496104_0255194 3300048907 Bacteria 1666
445 Ga0496104_0279182 3300048907 Bacteria 1583
446 Ga0496105_0119298 3300048908 Bacteria 2176
447 Ga0496106_0069254 3300048909 Bacteria 2692
448 Ga0496107_0484692 3300048910 Unclassified 917
449 Ga0496108_0132859 3300048911 Bacteria 2139
450 Ga0496108_0792907 3300048911 Unclassified 818
451 Ga0496109_0089792 3300048912 Bacteria 2841
452 Ga0496109_0203225 3300048912 Bacteria 1863
453 Ga0496109_0348747 3300048912 Bacteria 1398
454 Ga0496110_0008521 3300048913 Bacteria 8258
455 Ga0496110_0045706 3300048913 Bacteria 3829
456 Ga0496110_0156892 3300048913 Unclassified 2062
457 Ga0496110_0348200 3300048913 Unclassified 1350
458 Ga0496111_0009543 3300048914 Bacteria 6484
459 Ga0496111_0010809 3300048914 Bacteria 6135
460 Ga0496111_0167867 3300048914 Bacteria 1630
461 Ga0496112_0049248 3300048915 Bacteria 4130
462 Ga0496112_0053011 3300048915 Bacteria 3983
463 Ga0496112_0310976 3300048915 Bacteria 1521
464 Ga0496112_0522047 3300048915 Bacteria 1122
465 Ga0496112_0601545 3300048915 Unclassified 1031
466 Ga0496112_1162010 3300048915 Bacteria 689
467 Ga0496113_0043299 3300048916 Bacteria 3331
468 Ga0496113_0120117 3300048916 Bacteria 2054
469 Ga0496113_0154794 3300048916 Unclassified 1810
470 Ga0496114_0031341 3300048917 Bacteria 4375
471 Ga0496115_0246016 3300048918 Unclassified 1473
472 Ga0501031_0007718 3300049568 Bacteria 7003
473 Ga0501031_0017934 3300049568 Bacteria 4605
474 Ga0501033_0017079 3300049570 Bacteria 5485
475 Ga0501033_0376928 3300049570 Unclassified 991
476 Ga0501034_0003192 3300049571 Bacteria 18823
477 Ga0501034_0308708 3300049571 Bacteria 1517
478 Ga0501036_0010141 3300049572 Bacteria 7766
479 Ga0501036_0019396 3300049572 Bacteria 5708
480 Ga0501036_0081582 3300049572 Bacteria 2733
481 Ga0501037_0070961 3300049573 Bacteria 2534
482 Ga0501038_0016857 3300049574 Bacteria 6612
483 Ga0501038_0340630 3300049574 Bacteria 1169
484 Ga0501039_0004869 3300049575 Bacteria 10165
485 Ga0501039_0023345 3300049575 Bacteria 4748
486 Ga0501039_0701399 3300049575 Bacteria 791
487 Ga0501040_0031939 3300049576 Bacteria 3560
488 Ga0501040_0044144 3300049576 Bacteria 3039
489 Ga0501041_0005836 3300049577 Bacteria 7201
490 Ga0501041_0046186 3300049577 Bacteria 2649
491 Ga0501041_0180290 3300049577 Unclassified 1322
492 Ga0501042_0004385 3300049578 Bacteria 8999
493 Ga0501043_0016439 3300049579 Bacteria 5802
494 Ga0501046_0003418 3300049580 Bacteria 14581
495 Ga0501046_0344145 3300049580 Unclassified 1083
496 Ga0501047_0054725 3300049581 Bacteria 3860
497 Ga0501047_0103670 3300049581 Bacteria 2725
498 Ga0501048_0011774 3300049582 Bacteria 6519
499 Ga0501048_0325807 3300049582 Unclassified 1094
500 Ga0501067_0092957 3300049583 Bacteria 1674
501 Ga0501068_0001817 3300049584 Bacteria 11330
502 Ga0501068_0048114 3300049584 Unclassified 2574
503 Ga0501068_0089926 3300049584 Bacteria 1893
504 Ga0501069_0012011 3300049585 Bacteria 4597
505 Ga0501069_0070628 3300049585 Bacteria 1956
506 Ga0501070_0021253 3300049586 Bacteria 5446
507 Ga0501070_0185288 3300049586 Bacteria 1712
508 Ga0501071_0002966 3300049587 Bacteria 10490
509 Ga0501071_0011922 3300049587 Bacteria 5872
510 Ga0501071_0400827 3300049587 Unclassified 1047
511 Ga0501072_0017867 3300049588 Bacteria 5454
512 Ga0501072_0019943 3300049588 Bacteria 5189
513 Ga0501072_0200378 3300049588 Unclassified 1591
514 Ga0501072_0854658 3300049588 Bacteria 711
515 Ga0501073_0009750 3300049589 Bacteria 7071
516 Ga0501073_0097481 3300049589 Bacteria 2042
517 Ga0501073_0293371 3300049589 Bacteria 1122
518 Ga0501074_0008442 3300049590 Bacteria 7466
519 Ga0501074_0062773 3300049590 Bacteria 2676
520 Ga0501075_0010179 3300049591 Bacteria 6601
521 Ga0501075_0026631 3300049591 Bacteria 4258
522 Ga0501075_0155639 3300049591 Bacteria 1743
523 Ga0501076_0006135 3300049592 Bacteria 8698
524 Ga0501076_0036361 3300049592 Bacteria 3858
525 Ga0501076_0122688 3300049592 Bacteria 2104
526 Ga0501076_0207871 3300049592 Bacteria 1599
527 Ga0501077_0001318 3300049593 Bacteria 14989
528 Ga0501077_0037990 3300049593 Bacteria 3065
529 Ga0501077_0099968 3300049593 Bacteria 1838
530 Ga0501077_0201361 3300049593 Unclassified 1265
531 Ga0501077_0655674 3300049593 Bacteria 674
532 Ga0501079_0001747 3300049741 Bacteria 15498
533 Ga0501079_0011119 3300049741 Bacteria 6864
534 Ga0501079_0029498 3300049741 Bacteria 4211
535 Ga0501080_0005485 3300049742 Bacteria 11323
536 Ga0501080_0023500 3300049742 Bacteria 5713
537 Ga0501080_0252813 3300049742 Unclassified 1607
538 Ga0501081_0003955 3300049743 Bacteria 9498
539 Ga0501081_0127905 3300049743 Bacteria 1813
540 Ga0501081_0232007 3300049743 Unclassified 1344
541 Ga0501083_0044842 3300049744 Bacteria 2993
542 Ga0501083_0049824 3300049744 Bacteria 2822
543 Ga0501083_0591405 3300049744 Bacteria 722
544 Ga0501035_0033397 3300049822 Bacteria 4679
545 Ga0501044_0042337 3300049823 Bacteria 4737
546 Ga0501045_0002818 3300049824 Bacteria 11875
547 Ga0501045_0027133 3300049824 Bacteria 4124
548 nmdc:mga00v17_42463_c1 3300050491 Bacteria 2735
549 nmdc:mga05p37_1406134_c1 3300050507 Unclassified 702
550 nmdc:mga05p37_3182_c1 3300050507 Bacteria 19099
551 nmdc:mga06r32_394085_c1 3300050510 Bacteria 1367
552 nmdc:mga06r32_790588_c1 3300050510 Bacteria 910
553 nmdc:mga08y16_11621_c1 3300050511 Bacteria 9250
554 nmdc:mga08y16_220409_c1 3300050511 Bacteria 1964
555 nmdc:mga0n895_11036_c1 3300050512 Bacteria 8032
556 nmdc:mga0n895_1285004_c1 3300050512 Bacteria 703
557 nmdc:mga0rr50_7141_c1 3300050513 Bacteria 6861
558 nmdc:mga0a205_55044_c1 3300050515 Bacteria 3842
559 Ga0495595_0160536 3300053084 Bacteria 1109
560 Ga0501084_0005221 3300054114 Bacteria 10630
561 Ga0501084_0017299 3300054114 Bacteria 5991
562 Ga0501084_0571356 3300054114 Bacteria 955
563 Ga0501082_0013005 3300060353 Bacteria 7154
564 Ga0501082_0016395 3300060353 Bacteria 6378
565 Ga0501082_0152195 3300060353 Bacteria 2010
566 Ga0501082_0399392 3300060353 Bacteria 1200
567 Ga0530510_0003782 3300061734 Bacteria 10422
568 Ga0530510_0011898 3300061734 Bacteria 6106
569 Ga0530510_0068580 3300061734 Bacteria 2573
570 Ga0070681_10140524
571 JGI25406J46586_10002096
572 Ga0070658_10486804
573 Ga0070683_100022352
574 Ga0070683_100064775
575 Ga0070683_100065377
576 Ga0070690_100036578
577 Ga0070690_100114152
578 Ga0070670_100152610
579 Ga0070670_101219343
580 Ga0070666_10273136
581 Ga0070666_10469037
582 Ga0070680_100009172
583 Ga0070680_100109588
584 Ga0070680_100124891
585 Ga0070680_100270858
586 Ga0070682_100028459
587 Ga0070682_100059086
588 Ga0070682_100224135
589 Ga0068868_100242618
590 Ga0068868_100480250
591 Ga0070660_100035010
592 Ga0070660_100046607
593 Ga0070660_100062949
594 Ga0070660_100208507
595 Ga0070660_100290515
596 Ga0070660_100368596
597 Ga0070689_100130781
598 Ga0070689_100631992
599 Ga0070691_10007000
600 Ga0070691_10121666
601 Ga0070687_100007025
602 Ga0070687_100016961
603 Ga0070661_100019120
604 Ga0070692_10016518
605 Ga0070692_10043730
606 Ga0070692_10054979
607 Ga0070692_10055381
608 Ga0070668_100157961
609 Ga0070668_100211056
610 Ga0070669_100390012
611 Ga0070669_100639818
612 Ga0070675_100187543
613 Ga0070675_100692775
614 Ga0070671_100588903
615 Ga0070674_100016384
616 Ga0070674_100163070
617 Ga0070673_100148885
618 Ga0070688_100129846
619 Ga0070659_100029578
620 Ga0070659_100040104
621 Ga0070659_100095718
622 Ga0070659_100112632
623 Ga0070659_100477851
624 Ga0070703_10048240
625 Ga0070709_10680847
626 Ga0070709_10850675
627 Ga0070714_100423822
628 Ga0070710_10035152
629 Ga0070701_10009600
630 Ga0070701_10091464
631 Ga0070700_100003808
632 Ga0070700_100577107
633 Ga0070694_100107750
634 Ga0070694_100142606
635 Ga0070694_100197159
636 Ga0070694_100235847
637 Ga0070663_100061257
638 Ga0070678_100061675
639 Ga0070678_100086442
640 Ga0070678_100754050
641 Ga0070662_100022108
642 Ga0070662_100246591
643 Ga0070681_10025338
644 Ga0068867_100172209
645 Ga0070685_10010721
646 Ga0070706_100268343
647 Ga0070707_100120264
648 Ga0070698_100039665
649 Ga0070698_100131841
650 Ga0070698_100192847
651 Ga0070699_100124423
652 Ga0070679_100016894
653 Ga0070679_100175122
654 Ga0070679_100974744
655 Ga0070684_100024269
656 Ga0070684_100035164
657 Ga0070684_100042591
658 Ga0070684_100059516
659 Ga0070697_100837439
660 Ga0068853_100029728
661 Ga0068853_100037603
662 Ga0068853_100040737
663 Ga0068853_100150181
664 Ga0070672_100127250
665 Ga0070672_100794160
666 Ga0070686_100011102
667 Ga0070686_100018854
668 Ga0070695_100031269
669 Ga0070695_100316386
670 Ga0070696_100210350
671 Ga0070665_100025667
672 Ga0070704_100052856
673 Ga0070704_100099377
674 Ga0070704_100234738
675 Ga0068855_100067254
676 Ga0068855_100180102
677 Ga0070664_100026146
678 Ga0070664_100173619
679 Ga0070664_100247133
680 Ga0068857_100060001
681 Ga0068857_101372559
682 Ga0068854_100035666
683 Ga0068856_100015345
684 Ga0070702_100040690
685 Ga0070702_100146471
686 Ga0070702_100155648
687 Ga0068852_100023502
688 Ga0068852_100043381
689 Ga0068859_100149723
690 Ga0068866_10021327
691 Ga0068861_100025427
692 Ga0068861_100033748
693 Ga0068870_10062801
694 Ga0068860_100196800
695 Ga0068860_100201114
696 Ga0068862_100114480
697 Ga0068862_100141432
698 Ga0068862_100167530
699 Ga0068862_100192227
700 Ga0081455_10085166
701 Ga0081455_10133012
702 Ga0081540_1015334
703 Ga0081539_10000957
704 Ga0070717_11377096
705 Ga0075363_100443297
706 Ga0075364_10017740
707 Ga0075432_10001561
708 Ga0075432_10031393
709 Ga0070716_100016263
710 Ga0070712_100001869
711 Ga0070712_100143850
712 Ga0075367_10148553
713 Ga0097621_100231610
714 Ga0075428_100005760
715 Ga0075431_100911452
716 Ga0075431_100920994
717 Ga0075433_10032005
718 Ga0075433_10332287
719 Ga0075434_100073858
720 Ga0075434_100184798
721 Ga0075429_100107837
722 Ga0068865_100005558
723 Ga0068865_100087519
724 Ga0068865_100090357
725 Ga0097620_100149725
726 Ga0111539_10026963
727 Ga0111539_10075619
728 Ga0105245_10002081
729 Ga0105245_10026840
730 Ga0105245_10069905
731 Ga0105245_10321062
732 Ga0105247_10105173
733 Ga0105243_10020133
734 Ga0105243_10057700
735 Ga0105243_10170456
736 Ga0105241_10057291
737 Ga0105242_10077209
738 Ga0105242_10115558
739 Ga0105242_10153601
740 Ga0105248_10659601
741 Ga0105237_10545914
742 Ga0105237_10893053
743 Ga0105238_10285184
744 Ga0105249_10016308
745 Ga0105249_10257418
746 Ga0105249_10369048
747 Ga0105239_10040290
748 Ga0105239_10047974
749 Ga0105239_10108287
750 Ga0105239_10222705
751 Ga0105246_10283081
752 Ga0105246_10326598
753 Ga0157371_10143738
754 Ga0157371_10166783
755 Ga0157370_10718124
756 Ga0157369_10009150
757 Ga0157369_10504287
758 Ga0157374_10067726
759 Ga0157374_10290158
760 Ga0157378_10108563
761 Ga0163162_10012596
762 Ga0157372_10107788
763 Ga0157372_10175889
764 Ga0157372_10487649
765 Ga0157375_10054216
766 Ga0157375_10071580
767 Ga0157375_10908985
768 Ga0157380_10189192
769 Ga0157380_10536530
770 Ga0182008_10137880
771 Ga0182008_10316868
772 Ga0157377_10033176
773 Ga0157377_10037832
774 Ga0157376_10006447
775 Ga0157376_11418910
776 Ga0182007_10028755
777 Ga0163161_10064123
778 Ga0163161_10606496
779 Ga0206354_11232971
780 Ga0213871_10016503
781 Ga0207642_10016374
782 Ga0207710_10264343
783 Ga0207688_10065988
784 Ga0207688_10139964
785 Ga0207688_10195627
786 Ga0207680_10247738
787 Ga0207680_10440394
788 Ga0207647_10076633
789 Ga0207699_10031652
790 Ga0207699_10746568
791 Ga0207645_10501971
792 Ga0207643_10129510
793 Ga0207705_10297129
794 Ga0207654_10249259
795 Ga0207707_10073594
796 Ga0207693_10001278
797 Ga0207693_10120182
798 Ga0207660_10094897
799 Ga0207660_10096157
800 Ga0207660_10243387
801 Ga0207662_10004091
802 Ga0207662_10010574
803 Ga0207657_10013045
804 Ga0207657_10018075
805 Ga0207657_10025687
806 Ga0207657_10042838
807 Ga0207657_10069037
808 Ga0207649_10030780
809 Ga0207652_10086732
810 Ga0207652_10105963
811 Ga0207652_10171243
812 Ga0207646_10851979
813 Ga0207681_10342823
814 Ga0207681_10360445
815 Ga0207650_10017900
816 Ga0207650_10859329
817 Ga0207659_10564708
818 Ga0207687_10020508
819 Ga0207687_10098506
820 Ga0207664_10003749
821 Ga0207664_10383675
822 Ga0207644_10322320
823 Ga0207690_10004187
824 Ga0207690_10031885
825 Ga0207690_10046546
826 Ga0207706_10004239
827 Ga0207706_10009347
828 Ga0207706_10040623
829 Ga0207706_10228929
830 Ga0207686_10113313
831 Ga0207686_10166278
832 Ga0207709_10063508
833 Ga0207709_10122358
834 Ga0207709_10124403
835 Ga0207670_10154686
836 Ga0207704_10091878
837 Ga0207704_10196105
838 Ga0207665_10038387
839 Ga0207691_10036980
840 Ga0207711_10121691
841 Ga0207711_10461208
842 Ga0207661_10001700
843 Ga0207661_10041169
844 Ga0207661_10058424
845 Ga0207679_10206031
846 Ga0207679_10426650
847 Ga0207667_10504821
848 Ga0207651_10203014
849 Ga0207651_10317630
850 Ga0207712_10080628
851 Ga0207668_10139314
852 Ga0207668_10254203
853 Ga0207658_10352953
854 Ga0207677_11087386
855 Ga0207639_10127184
856 Ga0207639_10153374
857 Ga0207678_10118201
858 Ga0207708_10000352
859 Ga0207708_10022379
860 Ga0207702_10075995
861 Ga0207648_10000454
862 Ga0207648_10004275
863 Ga0207674_10013309
864 Ga0207675_100023378
865 Ga0207675_100024488
866 Ga0207675_100056891
867 Ga0207683_10001930
868 Ga0207683_10351182
869 Ga0207698_10341528
870 Ga0207698_11119553
871 Ga0207428_10000511
872 Ga0207428_10166605
873 Ga0268266_10341682
874 Ga0268265_10368978
875 Ga0268264_10130123
876 Ga0268264_10329320
877 Ga0265326_10129601
878 Ga0265319_1000988
879 Ga0265319_1111890
880 Ga0265334_10100413
881 Ga0265318_10009298
882 Ga0265336_10044752
883 Ga0265338_10022091
884 Ga0265338_10191381
885 Ga0265332_10137629
886 Ga0265320_10004170
887 Ga0265325_10278001
888 Ga0265340_10076162
889 Ga0265340_10166694
890 Ga0265339_10184117
891 Ga0265327_10054639
892 Ga0265327_10178126
893 Ga0265316_10267152
894 Ga0265314_10072909
895 Ga0307406_10248404
896 Ga0307409_100075235
897 Ga0307416_100027612
898 Ga0373958_0010635
899 Ga0373926_0144499
900 Ga0373943_0004056
901 Ga0373943_0025166
902 Ga0373955_0022313
903 Ga0373924_0136489
904 Ga0373931_0268332
905 Ga0373935_0169370
906 Ga0373947_0007884
907 Ga0373937_0012092
908 Ga0373925_0093675
909 Ga0395899_0000892
910 Ga0395899_0008990
911 Ga0395899_0034537
912 Ga0395899_0283643
913 Ga0395900_0007337
914 Ga0395900_0016995
915 Ga0395900_0096700
916 Ga0395900_0130404
917 Ga0395900_0256210
918 Ga0395900_0472313
919 Ga0395900_0690042
920 Ga0395898_0002095
921 Ga0395898_0020420
922 Ga0395898_0053816
923 Ga0395898_0129398
924 Ga0395898_0148837
925 Ga0395898_0263695
926 Ga0395898_0330199
927 Ga0395905_0005084
928 Ga0395905_0015829
929 Ga0395905_0053405
930 Ga0395905_0070634
931 Ga0395905_0106405
932 Ga0395905_0261608
933 Ga0395901_0002062
934 Ga0395901_0036650
935 Ga0395901_0039557
936 Ga0395901_0086912
937 Ga0395901_0177302
938 Ga0395901_0282629
939 Ga0395901_0302153
940 Ga0395901_0326877
941 Ga0395901_0991270
942 Ga0436360_0310451
943 Ga0450906_044770
944 Ga0450907_002412
945 Ga0450910_014466
946 Ga0466969_0267270
947 Ga0466963_0003864
948 Ga0466963_0006619
949 Ga0466963_0329021
950 Ga0466964_0009150
951 Ga0466970_0570193
952 Ga0466957_0069076
953 Ga0466957_0150016
954 Ga0466957_0224955
955 Ga0466957_0536803
956 Ga0466958_0011419
957 Ga0466958_0150275
958 Ga0466958_0333825
959 Ga0466958_0557839
960 Ga0466967_0051841
961 Ga0466967_0195143
962 Ga0466967_0498439
963 Ga0495603_0011185
964 Ga0495603_0053376
965 Ga0495603_0075374
966 Ga0495641_0251055
967 Ga0495651_0053163
968 Ga0495653_0026351
969 Ga0495582_0053629
970 Ga0495639_0202983
971 Ga0495584_0111878
972 Ga0495594_0145049
973 Ga0495607_0159851
974 Ga0495608_0021158
975 Ga0495618_0338678
976 Ga0495630_0307076
977 Ga0495630_0373430
978 Ga0495630_0442406
979 Ga0495630_0488547
980 Ga0495631_0277979
981 Ga0495644_0111434
982 Ga0495652_0143622
983 Ga0495652_0412999
984 Ga0495635_0284972
985 Ga0495661_0095764
986 Ga0495588_0066683
987 Ga0495657_0017558
988 Ga0495623_0186180
989 Ga0495647_0110423
990 Ga0495658_0105582
991 Ga0495613_0113411
992 Ga0495624_0201454
993 Ga0495670_0394239
994 Ga0495671_0221968
995 Ga0495581_0002623
996 Ga0495676_0100667
997 Ga0495676_0130326
998 Ga0495676_0135321
999 Ga0495680_0370487
1000 Ga0495675_0065250
1001 Ga0495614_0051593
1002 Ga0495614_0139127
1003 Ga0496100_0008705
1004 Ga0496100_0122609
1005 Ga0496100_0509064
1006 Ga0496101_0032393
1007 Ga0496101_0035759
1008 Ga0496102_0214743
1009 Ga0496102_0303577
1010 Ga0496102_0436571
1011 Ga0496103_0014071
1012 Ga0496103_0089246
1013 Ga0496104_0255194
1014 Ga0496104_0279182
1015 Ga0496105_0119298
1016 Ga0496106_0069254
1017 Ga0496107_0484692
1018 Ga0496108_0132859
1019 Ga0496108_0792907
1020 Ga0496109_0089792
1021 Ga0496109_0203225
1022 Ga0496109_0348747
1023 Ga0496110_0008521
1024 Ga0496110_0045706
1025 Ga0496110_0156892
1026 Ga0496110_0348200
1027 Ga0496111_0009543
1028 Ga0496111_0010809
1029 Ga0496111_0167867
1030 Ga0496112_0049248
1031 Ga0496112_0053011
1032 Ga0496112_0310976
1033 Ga0496112_0522047
1034 Ga0496112_0601545
1035 Ga0496112_1162010
1036 Ga0496113_0043299
1037 Ga0496113_0120117
1038 Ga0496113_0154794
1039 Ga0496114_0031341
1040 Ga0496115_0246016
1041 Ga0501031_0007718
1042 Ga0501031_0017934
1043 Ga0501033_0017079
1044 Ga0501033_0376928
1045 Ga0501034_0003192
1046 Ga0501034_0308708
1047 Ga0501036_0010141
1048 Ga0501036_0019396
1049 Ga0501036_0081582
1050 Ga0501037_0070961
1051 Ga0501038_0016857
1052 Ga0501038_0340630
1053 Ga0501039_0004869
1054 Ga0501039_0023345
1055 Ga0501039_0701399
1056 Ga0501040_0031939
1057 Ga0501040_0044144
1058 Ga0501041_0005836
1059 Ga0501041_0046186
1060 Ga0501041_0180290
1061 Ga0501042_0004385
1062 Ga0501043_0016439
1063 Ga0501046_0003418
1064 Ga0501046_0344145
1065 Ga0501047_0054725
1066 Ga0501047_0103670
1067 Ga0501048_0011774
1068 Ga0501048_0325807
1069 Ga0501067_0092957
1070 Ga0501068_0001817
1071 Ga0501068_0048114
1072 Ga0501068_0089926
1073 Ga0501069_0012011
1074 Ga0501069_0070628
1075 Ga0501070_0021253
1076 Ga0501070_0185288
1077 Ga0501071_0002966
1078 Ga0501071_0011922
1079 Ga0501071_0400827
1080 Ga0501072_0017867
1081 Ga0501072_0019943
1082 Ga0501072_0200378
1083 Ga0501072_0854658
1084 Ga0501073_0009750
1085 Ga0501073_0097481
1086 Ga0501073_0293371
1087 Ga0501074_0008442
1088 Ga0501074_0062773
1089 Ga0501075_0010179
1090 Ga0501075_0026631
1091 Ga0501075_0155639
1092 Ga0501076_0006135
1093 Ga0501076_0036361
1094 Ga0501076_0122688
1095 Ga0501076_0207871
1096 Ga0501077_0001318
1097 Ga0501077_0037990
1098 Ga0501077_0099968
1099 Ga0501077_0201361
1100 Ga0501077_0655674
1101 Ga0501079_0001747
1102 Ga0501079_0011119
1103 Ga0501079_0029498
1104 Ga0501080_0005485
1105 Ga0501080_0023500
1106 Ga0501080_0252813
1107 Ga0501081_0003955
1108 Ga0501081_0127905
1109 Ga0501081_0232007
1110 Ga0501083_0044842
1111 Ga0501083_0049824
1112 Ga0501083_0591405
1113 Ga0501035_0033397
1114 Ga0501044_0042337
1115 Ga0501045_0002818
1116 Ga0501045_0027133
1117 nmdc:mga00v17_42463_c1
1118 nmdc:mga05p37_1406134_c1
1119 nmdc:mga05p37_3182_c1
1120 nmdc:mga06r32_394085_c1
1121 nmdc:mga06r32_790588_c1
1122 nmdc:mga08y16_11621_c1
1123 nmdc:mga08y16_220409_c1
1124 nmdc:mga0n895_11036_c1
1125 nmdc:mga0n895_1285004_c1
1126 nmdc:mga0rr50_7141_c1
1127 nmdc:mga0a205_55044_c1
1128 Ga0495595_0160536
1129 Ga0501084_0005221
1130 Ga0501084_0017299
1131 Ga0501084_0571356
1132 Ga0501082_0013005
1133 Ga0501082_0016395
1134 Ga0501082_0152195
1135 Ga0501082_0399392
1136 Ga0530510_0003782
1137 Ga0530510_0011898
1138 Ga0530510_0068580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.7235 6 178
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.659 6 178
1mqv-assembly1.cif.gz_A crystal structure of the q1a/f32w/w72f mutant of rhodopseudomonas palustris cytochrome c' (prime) expressed in e. coli 0.6338 64 168
5l0c-assembly1.cif.gz_C-2 human metavinculin (residues 959-1134) in complex with pip2 0.5832 48 181
1qkr-assembly2.cif.gz_B crystal structure of the vinculin tail and a pathway for activation 0.5812 48 181
ID Description Score Start End Superfamily
af_Q7K3Z2_1_95_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6919 97 173 1.20.1070.10
1mqvB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6157 64 175 1.20.120.10
af_Q8IM26_1_284_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5838 1 189 1.20.1070.10
af_Q7K3Z2_1_95_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5807 97 173 1.20.1070.10
af_Q8IM26_1_284_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5718 1 189 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A537ZDG8-F1-model_v4 DUF998 domain-containing protein 0.936 1 171 GO:0016020
AF-A0A537ZDG8-F1-model_v4 DUF998 domain-containing protein 0.9256 1 171 GO:0016020
AF-A0A7M2Z0Z7-F1-model_v4 Uncharacterized protein 0.8824 1 193 GO:0016020
AF-A0A7M2Z0Z7-F1-model_v4 Uncharacterized protein 0.878 1 193 GO:0016020
AF-A0A7X1PD47-F1-model_v4 Uncharacterized protein 0.8621 1 175 GO:0016020

Map