F464676

General Info

Members Datasets Scaffolds Average Seq Length
568 260 568 123

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_153854_c1|nmdc:mga0k408_153854_c1_111_563
Length 150
Sequence VDEFRQSEAHRFVPLNDAVIAQRQESKRMVVEFHGARGQRGVTLFGLMFWAIVVGFAALVIMKVLPTLNEYFTIQKAVNKIAKEGGTTVPEIRAAFERTKEIEYSISSISAKDLNITKENDKVVISFAYDKEIELMKPVYLLIKYEGRSK

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
186 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
219 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
220 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
221 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
222 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
229 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
230 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
231 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
234 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
235 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
236 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
237 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
253 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.08
Nodule 0
Rhizoplane 2.11
Rhizosphere 79.75
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10026887 3300003322 Bacteria 4953
2 Ga0055531_10071308 3300003794 Bacteria 800
3 Ga0065715_10021876 3300005293 Bacteria 2135
4 Ga0065715_10720038 3300005293 Bacteria 628
5 Ga0070658_10458467 3300005327 Bacteria 1099
6 Ga0070676_10026130 3300005328 Bacteria 3304
7 Ga0070676_10312707 3300005328 Bacteria 1069
8 Ga0070683_100992529 3300005329 Bacteria 806
9 Ga0070690_100116489 3300005330 Bacteria 1789
10 Ga0070690_100522714 3300005330 Bacteria 891
11 Ga0070670_100003220 3300005331 Bacteria 13475
12 Ga0070670_100357361 3300005331 Bacteria 1284
13 Ga0070670_100624239 3300005331 Bacteria 965
14 Ga0070677_10327525 3300005333 Bacteria 786
15 Ga0068869_100006018 3300005334 Bacteria 7673
16 Ga0068869_100600362 3300005334 Bacteria 930
17 Ga0068869_100855590 3300005334 Bacteria 785
18 Ga0068869_101001994 3300005334 Bacteria 727
19 Ga0068869_101398413 3300005334 Unclassified 619
20 Ga0070666_10005842 3300005335 Bacteria 7558
21 Ga0070666_10027063 3300005335 Bacteria 3752
22 Ga0070666_10411142 3300005335 Bacteria 973
23 Ga0070666_11250166 3300005335 Bacteria 553
24 Ga0068868_100057274 3300005338 Bacteria 3079
25 Ga0068868_100108508 3300005338 Bacteria 2253
26 Ga0068868_100558744 3300005338 Bacteria 1009
27 Ga0068868_100703906 3300005338 Bacteria 904
28 Ga0070689_100753615 3300005340 Bacteria 854
29 Ga0070687_100050192 3300005343 Bacteria 2154
30 Ga0070687_101107243 3300005343 Bacteria 580
31 Ga0070661_100168108 3300005344 Bacteria 1664
32 Ga0070661_100536833 3300005344 Bacteria 940
33 Ga0070668_100011100 3300005347 Bacteria 6705
34 Ga0070668_100231263 3300005347 Bacteria 1528
35 Ga0070668_100512239 3300005347 Bacteria 1040
36 Ga0070669_100017644 3300005353 Bacteria 5091
37 Ga0070669_100041907 3300005353 Bacteria 3331
38 Ga0070669_100068841 3300005353 Bacteria 2613
39 Ga0070669_100074021 3300005353 Bacteria 2524
40 Ga0070669_100289219 3300005353 Bacteria 1315
41 Ga0070675_100079394 3300005354 Bacteria 2734
42 Ga0070675_100084711 3300005354 Bacteria 2647
43 Ga0070675_100114972 3300005354 Bacteria 2280
44 Ga0070671_100043214 3300005355 Bacteria 3745
45 Ga0070671_100068058 3300005355 Bacteria 2969
46 Ga0070671_100140591 3300005355 Bacteria 2037
47 Ga0070671_100242409 3300005355 Bacteria 1530
48 Ga0070671_101325714 3300005355 Bacteria 635
49 Ga0070671_101352584 3300005355 Bacteria 629
50 Ga0070674_100015116 3300005356 Bacteria 4812
51 Ga0070674_100142333 3300005356 Bacteria 1801
52 Ga0070674_100321610 3300005356 Bacteria 1240
53 Ga0070674_100421524 3300005356 Bacteria 1095
54 Ga0070674_101866869 3300005356 Bacteria 545
55 Ga0070674_101977099 3300005356 Bacteria 531
56 Ga0070674_102163569 3300005356 Bacteria 508
57 Ga0070673_100104338 3300005364 Bacteria 2340
58 Ga0070673_100107937 3300005364 Bacteria 2303
59 Ga0070673_100279428 3300005364 Bacteria 1464
60 Ga0070673_100595776 3300005364 Bacteria 1008
61 Ga0070673_100603795 3300005364 Bacteria 1001
62 Ga0070673_101079022 3300005364 Bacteria 749
63 Ga0070659_100369700 3300005366 Bacteria 1206
64 Ga0070667_100002053 3300005367 Bacteria 17829
65 Ga0070667_100016760 3300005367 Bacteria 6063
66 Ga0070667_100610387 3300005367 Bacteria 1005
67 Ga0070667_100927243 3300005367 Bacteria 811
68 Ga0070667_101451654 3300005367 Bacteria 644
69 Ga0070667_102158518 3300005367 Unclassified 525
70 Ga0070700_101892422 3300005441 Bacteria 516
71 Ga0070708_100526662 3300005445 Bacteria 1115
72 Ga0070663_100375128 3300005455 Bacteria 1157
73 Ga0070663_101553515 3300005455 Bacteria 589
74 Ga0070678_100354454 3300005456 Bacteria 1262
75 Ga0070678_100442568 3300005456 Bacteria 1137
76 Ga0070678_100754117 3300005456 Bacteria 881
77 Ga0070662_100040625 3300005457 Bacteria 3313
78 Ga0070662_100074754 3300005457 Bacteria 2508
79 Ga0068867_100039168 3300005459 Bacteria 3454
80 Ga0068867_100048217 3300005459 Bacteria 3133
81 Ga0068867_100066783 3300005459 Bacteria 2679
82 Ga0068867_100137014 3300005459 Bacteria 1909
83 Ga0068867_100286849 3300005459 Bacteria 1352
84 Ga0068867_100494732 3300005459 Bacteria 1050
85 Ga0068867_101510746 3300005459 Bacteria 626
86 Ga0070706_100002337 3300005467 Bacteria 19150
87 Ga0070707_100088292 3300005468 Bacteria 2999
88 Ga0070699_100462167 3300005518 Bacteria 1151
89 Ga0070679_101482486 3300005530 Bacteria 625
90 Ga0070679_101591253 3300005530 Bacteria 601
91 Ga0068853_100273069 3300005539 Bacteria 1557
92 Ga0068853_100408605 3300005539 Bacteria 1272
93 Ga0070672_100011605 3300005543 Bacteria 6147
94 Ga0070672_100017626 3300005543 Bacteria 5144
95 Ga0070672_100061377 3300005543 Bacteria 2963
96 Ga0070672_100155255 3300005543 Bacteria 1895
97 Ga0070672_100391362 3300005543 Bacteria 1190
98 Ga0070686_100128427 3300005544 Bacteria 1750
99 Ga0070686_100576132 3300005544 Bacteria 884
100 Ga0070665_100953241 3300005548 Bacteria 870
101 Ga0070665_101807954 3300005548 Bacteria 617
102 Ga0070665_101849039 3300005548 Bacteria 610
103 Ga0068855_101380704 3300005563 Bacteria 727
104 Ga0070664_100214503 3300005564 Bacteria 1720
105 Ga0070664_101515285 3300005564 Bacteria 635
106 Ga0070664_101578077 3300005564 Bacteria 621
107 Ga0068857_100032353 3300005577 Bacteria 4624
108 Ga0068854_100069324 3300005578 Bacteria 2574
109 Ga0068854_100276284 3300005578 Bacteria 1351
110 Ga0068854_100803625 3300005578 Bacteria 820
111 Ga0068854_101094006 3300005578 Bacteria 710
112 Ga0068854_101451679 3300005578 Bacteria 621
113 Ga0068856_100260353 3300005614 Bacteria 1750
114 Ga0070702_101565047 3300005615 Unclassified 544
115 Ga0068852_100039460 3300005616 Bacteria 3975
116 Ga0068852_100212873 3300005616 Bacteria 1834
117 Ga0068852_100244773 3300005616 Bacteria 1715
118 Ga0068852_100764699 3300005616 Bacteria 979
119 Ga0068859_100270336 3300005617 Bacteria 1792
120 Ga0068859_100389835 3300005617 Bacteria 1489
121 Ga0068859_101072620 3300005617 Bacteria 886
122 Ga0068864_100015540 3300005618 Bacteria 6330
123 Ga0068864_100050174 3300005618 Bacteria 3591
124 Ga0068866_10002843 3300005718 Bacteria 7136
125 Ga0068866_10369647 3300005718 Bacteria 916
126 Ga0068866_10731363 3300005718 Bacteria 682
127 Ga0068861_100089167 3300005719 Bacteria 2431
128 Ga0068861_100223300 3300005719 Bacteria 1593
129 Ga0068861_101052396 3300005719 Bacteria 780
130 Ga0068851_10010095 3300005834 Bacteria 4399
131 Ga0068851_10041979 3300005834 Bacteria 2301
132 Ga0068851_10327016 3300005834 Bacteria 887
133 Ga0068851_10348777 3300005834 Bacteria 861
134 Ga0068870_10232199 3300005840 Bacteria 1135
135 Ga0068870_10764895 3300005840 Bacteria 672
136 Ga0068863_100008147 3300005841 Bacteria 10232
137 Ga0068858_100024249 3300005842 Bacteria 5653
138 Ga0068858_100322425 3300005842 Bacteria 1477
139 Ga0068858_100699931 3300005842 Bacteria 986
140 Ga0068860_100010210 3300005843 Bacteria 9293
141 Ga0068860_100757309 3300005843 Bacteria 983
142 Ga0068862_100047805 3300005844 Bacteria 3652
143 Ga0068862_100049502 3300005844 Bacteria 3589
144 Ga0081455_10908443 3300005937 Bacteria 547
145 Ga0075363_100454798 3300006048 Bacteria 757
146 Ga0075363_100499060 3300006048 Bacteria 723
147 Ga0075363_100583718 3300006048 Bacteria 669
148 Ga0075364_10178026 3300006051 Bacteria 1438
149 Ga0075362_10017195 3300006177 Bacteria 2976
150 Ga0075362_10101480 3300006177 Bacteria 1346
151 Ga0075362_10436476 3300006177 Bacteria 664
152 Ga0075362_10548028 3300006177 Bacteria 594
153 Ga0075367_10015567 3300006178 Bacteria 4139
154 Ga0075367_10040368 3300006178 Bacteria 2724
155 Ga0075367_10150660 3300006178 Bacteria 1443
156 Ga0075367_10675978 3300006178 Bacteria 656
157 Ga0075369_10216141 3300006186 Bacteria 887
158 Ga0075369_10354464 3300006186 Bacteria 689
159 Ga0075366_10006193 3300006195 Bacteria 6529
160 Ga0075366_10011917 3300006195 Bacteria 4921
161 Ga0075366_10023339 3300006195 Bacteria 3604
162 Ga0075366_10024071 3300006195 Bacteria 3551
163 Ga0075366_10076863 3300006195 Bacteria 1992
164 Ga0075366_10092368 3300006195 Bacteria 1813
165 Ga0075366_10146567 3300006195 Bacteria 1428
166 Ga0075366_10154208 3300006195 Bacteria 1391
167 Ga0075366_10238071 3300006195 Bacteria 1109
168 Ga0075366_10264571 3300006195 Bacteria 1050
169 Ga0075366_10384094 3300006195 Bacteria 864
170 Ga0075366_10384264 3300006195 Bacteria 863
171 Ga0097621_100019117 3300006237 Bacteria 5252
172 Ga0097621_100271365 3300006237 Bacteria 1491
173 Ga0075370_10002177 3300006353 Bacteria 8992
174 Ga0075370_10006689 3300006353 Bacteria 5815
175 Ga0075370_10008615 3300006353 Bacteria 5258
176 Ga0075370_10077994 3300006353 Bacteria 1901
177 Ga0075370_10115053 3300006353 Bacteria 1563
178 Ga0075370_10143437 3300006353 Bacteria 1397
179 Ga0068871_100003964 3300006358 Bacteria 10223
180 Ga0068871_100225161 3300006358 Bacteria 1626
181 Ga0068871_100761165 3300006358 Bacteria 891
182 Ga0068871_101351159 3300006358 Bacteria 671
183 Ga0068871_101446870 3300006358 Bacteria 648
184 Ga0068871_101676718 3300006358 Bacteria 603
185 Ga0068865_100012253 3300006881 Bacteria 5393
186 Ga0068865_100050655 3300006881 Bacteria 2870
187 Ga0068865_100189229 3300006881 Bacteria 1590
188 Ga0068865_100620332 3300006881 Bacteria 916
189 Ga0097620_100270347 3300006931 Bacteria 1792
190 Ga0097620_100389829 3300006931 Bacteria 1489
191 Ga0097620_101072645 3300006931 Bacteria 886
192 Ga0105240_10415143 3300009093 Bacteria 1513
193 Ga0111539_13123822 3300009094 Bacteria 534
194 Ga0105245_10220613 3300009098 Bacteria 1829
195 Ga0105243_10007512 3300009148 Bacteria 8378
196 Ga0105243_10053672 3300009148 Bacteria 3198
197 Ga0105243_10479183 3300009148 Bacteria 1174
198 Ga0105241_10994224 3300009174 Bacteria 784
199 Ga0105242_10471181 3300009176 Bacteria 1188
200 Ga0105242_10682638 3300009176 Bacteria 1003
201 Ga0105248_10489158 3300009177 Bacteria 1387
202 Ga0105248_10863895 3300009177 Bacteria 1021
203 Ga0105248_11403709 3300009177 Bacteria 790
204 Ga0105237_10048132 3300009545 Bacteria 4286
205 Ga0105238_10254414 3300009551 Bacteria 1735
206 Ga0105238_10672408 3300009551 Bacteria 1046
207 Ga0105238_10702547 3300009551 Bacteria 1023
208 Ga0105249_10076441 3300009553 Bacteria 3103
209 Ga0105239_10149287 3300010375 Bacteria 2608
210 Ga0105239_11204838 3300010375 Bacteria 873
211 Ga0157373_10333173 3300013100 Bacteria 1081
212 Ga0157369_11395663 3300013105 Unclassified 713
213 Ga0157374_10043296 3300013296 Bacteria 4158
214 Ga0157374_11055196 3300013296 Bacteria 832
215 Ga0157378_10016476 3300013297 Bacteria 6474
216 Ga0157378_10338489 3300013297 Bacteria 1466
217 Ga0157378_11421818 3300013297 Bacteria 737
218 Ga0163162_10009814 3300013306 Bacteria 9317
219 Ga0163162_10537560 3300013306 Bacteria 1297
220 Ga0163162_12067383 3300013306 Bacteria 653
221 Ga0157372_10143790 3300013307 Bacteria 2750
222 Ga0157375_10059004 3300013308 Bacteria 3799
223 Ga0157375_10725135 3300013308 Bacteria 1147
224 Ga0157380_10044416 3300014326 Bacteria 3483
225 Ga0157380_10072192 3300014326 Bacteria 2795
226 Ga0157380_10130786 3300014326 Bacteria 2141
227 Ga0157380_10956428 3300014326 Bacteria 887
228 Ga0157377_10572353 3300014745 Bacteria 801
229 Ga0157379_10027057 3300014968 Bacteria 5104
230 Ga0157379_10544188 3300014968 Bacteria 1080
231 Ga0157379_11329915 3300014968 Bacteria 695
232 Ga0157379_11682826 3300014968 Bacteria 621
233 Ga0182007_10033495 3300015262 Bacteria 1741
234 Ga0163161_10014817 3300017792 Bacteria 5432
235 Ga0163161_10025520 3300017792 Bacteria 4182
236 Ga0163161_10539466 3300017792 Bacteria 955
237 Ga0163161_10973349 3300017792 Bacteria 723
238 Ga0163161_11143534 3300017792 Bacteria 671
239 Ga0207666_1064659 3300025271 Bacteria 587
240 Ga0209257_1021296 3300025304 Bacteria 2360
241 Ga0207697_10010635 3300025315 Bacteria 3926
242 Ga0207697_10030157 3300025315 Bacteria 2220
243 Ga0207697_10033168 3300025315 Bacteria 2113
244 Ga0207656_10016091 3300025321 Bacteria 2906
245 Ga0207656_10714357 3300025321 Unclassified 513
246 Ga0207682_10003996 3300025893 Bacteria 6276
247 Ga0207682_10146971 3300025893 Bacteria 1061
248 Ga0207642_10008153 3300025899 Bacteria 3580
249 Ga0207688_10022097 3300025901 Bacteria 3481
250 Ga0207688_10050108 3300025901 Bacteria 2336
251 Ga0207688_10097909 3300025901 Bacteria 1691
252 Ga0207688_10194965 3300025901 Bacteria 1213
253 Ga0207680_10017485 3300025903 Bacteria 3790
254 Ga0207680_10249778 3300025903 Bacteria 1225
255 Ga0207647_10090324 3300025904 Bacteria 1827
256 Ga0207647_10365566 3300025904 Bacteria 816
257 Ga0207645_10051984 3300025907 Bacteria 2618
258 Ga0207645_10201490 3300025907 Bacteria 1309
259 Ga0207645_10222756 3300025907 Bacteria 1244
260 Ga0207645_10757979 3300025907 Bacteria 660
261 Ga0207643_10147034 3300025908 Bacteria 1410
262 Ga0207705_10399103 3300025909 Bacteria 1063
263 Ga0207684_10026601 3300025910 Bacteria 4932
264 Ga0207684_10091896 3300025910 Bacteria 2587
265 Ga0207654_10469748 3300025911 Bacteria 885
266 Ga0207695_10301512 3300025913 Bacteria 1493
267 Ga0207671_10073873 3300025914 Bacteria 2548
268 Ga0207662_10028888 3300025918 Bacteria 3210
269 Ga0207649_10144200 3300025920 Bacteria 1633
270 Ga0207649_10320805 3300025920 Bacteria 1138
271 Ga0207649_11514413 3300025920 Bacteria 531
272 Ga0207652_11700210 3300025921 Unclassified 536
273 Ga0207646_10089304 3300025922 Bacteria 2758
274 Ga0207681_10004142 3300025923 Bacteria 8988
275 Ga0207681_10007931 3300025923 Bacteria 6493
276 Ga0207681_10046312 3300025923 Bacteria 2925
277 Ga0207681_10340698 3300025923 Bacteria 1197
278 Ga0207681_10455633 3300025923 Bacteria 1041
279 Ga0207694_10398476 3300025924 Bacteria 1144
280 Ga0207650_10000587 3300025925 Bacteria 29198
281 Ga0207650_10140997 3300025925 Bacteria 1895
282 Ga0207650_10171932 3300025925 Bacteria 1722
283 Ga0207650_10737075 3300025925 Bacteria 833
284 Ga0207659_10000861 3300025926 Bacteria 18018
285 Ga0207659_10067142 3300025926 Bacteria 2605
286 Ga0207659_10625933 3300025926 Bacteria 919
287 Ga0207687_10300670 3300025927 Bacteria 1292
288 Ga0207687_10627811 3300025927 Bacteria 907
289 Ga0207644_10016499 3300025931 Bacteria 4970
290 Ga0207644_10073992 3300025931 Bacteria 2499
291 Ga0207690_10519798 3300025932 Bacteria 965
292 Ga0207706_10264175 3300025933 Bacteria 1502
293 Ga0207706_10473758 3300025933 Bacteria 1082
294 Ga0207706_10565081 3300025933 Bacteria 978
295 Ga0207686_10433439 3300025934 Bacteria 1008
296 Ga0207686_10720470 3300025934 Bacteria 794
297 Ga0207686_11694929 3300025934 Bacteria 523
298 Ga0207709_10031648 3300025935 Bacteria 3092
299 Ga0207709_10077216 3300025935 Bacteria 2134
300 Ga0207709_10207003 3300025935 Bacteria 1405
301 Ga0207709_11288795 3300025935 Unclassified 603
302 Ga0207670_10120004 3300025936 Bacteria 1910
303 Ga0207669_10004732 3300025937 Bacteria 6026
304 Ga0207669_10012938 3300025937 Bacteria 4124
305 Ga0207669_10126727 3300025937 Bacteria 1746
306 Ga0207669_10522219 3300025937 Bacteria 953
307 Ga0207669_11337992 3300025937 Bacteria 609
308 Ga0207704_10022127 3300025938 Bacteria 3399
309 Ga0207704_10138822 3300025938 Bacteria 1696
310 Ga0207704_10178301 3300025938 Bacteria 1532
311 Ga0207691_10001498 3300025940 Bacteria 23269
312 Ga0207691_10040375 3300025940 Bacteria 4311
313 Ga0207691_10144202 3300025940 Bacteria 2097
314 Ga0207691_10184335 3300025940 Bacteria 1823
315 Ga0207691_10186249 3300025940 Bacteria 1812
316 Ga0207691_10430271 3300025940 Bacteria 1124
317 Ga0207691_10585020 3300025940 Bacteria 945
318 Ga0207691_10664077 3300025940 Bacteria 880
319 Ga0207711_10016383 3300025941 Bacteria 6161
320 Ga0207711_10884152 3300025941 Bacteria 831
321 Ga0207689_10009559 3300025942 Bacteria 8364
322 Ga0207689_10113332 3300025942 Bacteria 2229
323 Ga0207689_10468374 3300025942 Bacteria 1054
324 Ga0207661_11555386 3300025944 Unclassified 606
325 Ga0207679_10349124 3300025945 Bacteria 1289
326 Ga0207679_10731712 3300025945 Bacteria 899
327 Ga0207651_10119483 3300025960 Bacteria 1996
328 Ga0207651_10300707 3300025960 Bacteria 1334
329 Ga0207651_10339182 3300025960 Bacteria 1262
330 Ga0207651_10532118 3300025960 Bacteria 1020
331 Ga0207651_10533592 3300025960 Bacteria 1018
332 Ga0207651_10858317 3300025960 Bacteria 807
333 Ga0207712_10004623 3300025961 Bacteria 8693
334 Ga0207712_10311393 3300025961 Bacteria 1296
335 Ga0207668_10024665 3300025972 Bacteria 3884
336 Ga0207668_10226587 3300025972 Bacteria 1504
337 Ga0207668_10257246 3300025972 Bacteria 1421
338 Ga0207668_10798930 3300025972 Bacteria 835
339 Ga0207640_10044374 3300025981 Bacteria 2848
340 Ga0207640_10703313 3300025981 Bacteria 867
341 Ga0207640_11154065 3300025981 Bacteria 687
342 Ga0207658_10003013 3300025986 Bacteria 12045
343 Ga0207658_10007981 3300025986 Bacteria 7206
344 Ga0207658_10120698 3300025986 Bacteria 2089
345 Ga0207658_10180050 3300025986 Bacteria 1749
346 Ga0207658_10544585 3300025986 Bacteria 1038
347 Ga0207677_10033420 3300026023 Bacteria 3319
348 Ga0207677_10035972 3300026023 Bacteria 3222
349 Ga0207677_10607816 3300026023 Bacteria 960
350 Ga0207703_10021107 3300026035 Bacteria 5097
351 Ga0207703_11636122 3300026035 Bacteria 619
352 Ga0207639_10194504 3300026041 Bacteria 1735
353 Ga0207639_10348098 3300026041 Bacteria 1323
354 Ga0207639_10966055 3300026041 Bacteria 797
355 Ga0207678_10625627 3300026067 Bacteria 945
356 Ga0207678_11419383 3300026067 Bacteria 614
357 Ga0207708_10139866 3300026075 Bacteria 1898
358 Ga0207708_10221879 3300026075 Bacteria 1515
359 Ga0207702_10178641 3300026078 Bacteria 1953
360 Ga0207641_10004568 3300026088 Bacteria 11965
361 Ga0207641_10441467 3300026088 Bacteria 1256
362 Ga0207648_10007408 3300026089 Bacteria 10800
363 Ga0207648_10008093 3300026089 Bacteria 10238
364 Ga0207648_10012908 3300026089 Bacteria 7801
365 Ga0207648_10059871 3300026089 Bacteria 3321
366 Ga0207648_10065652 3300026089 Bacteria 3164
367 Ga0207648_10351462 3300026089 Bacteria 1329
368 Ga0207648_10400697 3300026089 Bacteria 1243
369 Ga0207648_11729676 3300026089 Bacteria 587
370 Ga0207676_10066902 3300026095 Bacteria 2868
371 Ga0207676_10074889 3300026095 Bacteria 2729
372 Ga0207674_10143574 3300026116 Bacteria 2346
373 Ga0207674_10705059 3300026116 Bacteria 974
374 Ga0207675_100031877 3300026118 Bacteria 4910
375 Ga0207675_100322102 3300026118 Bacteria 1509
376 Ga0207683_10065429 3300026121 Bacteria 3206
377 Ga0207683_10515261 3300026121 Bacteria 1105
378 Ga0207683_11225779 3300026121 Bacteria 695
379 Ga0207698_10209335 3300026142 Bacteria 1753
380 Ga0207698_10213567 3300026142 Bacteria 1738
381 Ga0207698_10485084 3300026142 Bacteria 1200
382 Ga0209813_10140209 3300027866 Bacteria 858
383 Ga0209813_10171503 3300027866 Bacteria 789
384 Ga0209813_10251558 3300027866 Bacteria 672
385 Ga0268266_10278554 3300028379 Bacteria 1554
386 Ga0268266_10472704 3300028379 Bacteria 1194
387 Ga0268265_10019161 3300028380 Bacteria 4750
388 Ga0268265_10247423 3300028380 Bacteria 1577
389 Ga0268265_10707509 3300028380 Bacteria 974
390 Ga0268264_10003212 3300028381 Bacteria 14160
391 Ga0268264_10541330 3300028381 Bacteria 1141
392 Ga0268264_11231665 3300028381 Bacteria 758
393 Ga0307517_10094000 3300028786 Bacteria 2425
394 Ga0307515_10114478 3300028794 Bacteria 3117
395 Ga0307515_10199724 3300028794 Bacteria 1879
396 Ga0307515_10267821 3300028794 Bacteria 1434
397 Ga0307515_10528283 3300028794 Bacteria 789
398 Ga0307512_10099819 3300030522 Bacteria 1973
399 Ga0307513_10054292 3300031456 Bacteria 4297
400 Ga0307513_10115320 3300031456 Bacteria 2669
401 Ga0307513_10321550 3300031456 Bacteria 1305
402 Ga0307509_10000225 3300031507 Bacteria 90913
403 Ga0307408_100023888 3300031548 Bacteria 4168
404 Ga0307408_100102091 3300031548 Bacteria 2187
405 Ga0307408_100126115 3300031548 Bacteria 1991
406 Ga0307408_100204316 3300031548 Bacteria 1601
407 Ga0307408_100252647 3300031548 Bacteria 1455
408 Ga0307514_10257953 3300031649 Bacteria 1024
409 Ga0307516_10031934 3300031730 Bacteria 5307
410 Ga0307405_10124588 3300031731 Bacteria 1769
411 Ga0307405_10187711 3300031731 Bacteria 1490
412 Ga0307405_10339283 3300031731 Bacteria 1155
413 Ga0307405_10712687 3300031731 Bacteria 832
414 Ga0307413_10012583 3300031824 Bacteria 4216
415 Ga0307413_11598943 3300031824 Bacteria 579
416 Ga0307518_10322741 3300031838 Bacteria 921
417 Ga0307410_10000484 3300031852 Bacteria 16146
418 Ga0307410_10027877 3300031852 Bacteria 3575
419 Ga0307410_10534243 3300031852 Bacteria 970
420 Ga0307406_10005948 3300031901 Bacteria 6696
421 Ga0307406_10251951 3300031901 Bacteria 1331
422 Ga0307406_10967766 3300031901 Bacteria 728
423 Ga0307407_10113173 3300031903 Bacteria 1707
424 Ga0307412_10018963 3300031911 Bacteria 4153
425 Ga0307412_10209165 3300031911 Bacteria 1487
426 Ga0307412_10262494 3300031911 Bacteria 1347
427 Ga0307412_10393433 3300031911 Bacteria 1126
428 Ga0307409_100195583 3300031995 Bacteria 1804
429 Ga0307409_100486735 3300031995 Bacteria 1198
430 Ga0307409_101646596 3300031995 Bacteria 670
431 Ga0307416_100097312 3300032002 Bacteria 2548
432 Ga0307416_101340916 3300032002 Bacteria 821
433 Ga0307414_10228690 3300032004 Bacteria 1532
434 Ga0307414_10744938 3300032004 Bacteria 890
435 Ga0307411_10052407 3300032005 Bacteria 2667
436 Ga0307411_10202935 3300032005 Bacteria 1524
437 Ga0307411_10563616 3300032005 Bacteria 974
438 Ga0307415_100036458 3300032126 Bacteria 3223
439 Ga0307510_10008316 3300033180 Bacteria 12367
440 Ga0307510_10036316 3300033180 Bacteria 5485
441 Ga0307510_10067356 3300033180 Bacteria 3605
442 Ga0373931_0688082 3300035691 Bacteria 674
443 Ga0373927_0331896 3300035695 Bacteria 1002
444 Ga0373947_0622542 3300035725 Bacteria 736
445 Ga0373937_0197282 3300036401 Bacteria 1892
446 Ga0373925_0014411 3300037068 Bacteria 5715
447 Ga0395905_0032804 3300037471 Bacteria 4882
448 Ga0451789_1255977 3300041443 Bacteria 576
449 Ga0451798_0941624 3300041458 Bacteria 699
450 Ga0451800_0060364 3300041459 Bacteria 1374
451 Ga0451802_0562426 3300041460 Bacteria 501
452 Ga0451802_1793975 3300041460 Bacteria 944
453 Ga0451804_0316912 3300041463 Bacteria 942
454 Ga0451804_0366189 3300041463 Bacteria 1134
455 Ga0451807_0943994 3300041486 Bacteria 692
456 Ga0451843_0486527 3300041509 Bacteria 1882
457 Ga0451843_1255163 3300041509 Bacteria 648
458 Ga0451853_0211777 3300041512 Bacteria 750
459 Ga0451853_4085130 3300041512 Bacteria 3599
460 Ga0439450_044458 3300042008 Bacteria 1040
461 Ga0450913_001708 3300042117 Bacteria 1256
462 Ga0450896_038489 3300042133 Bacteria 740
463 Ga0450898_018315 3300042134 Bacteria 1212
464 Ga0439464_0001964 3300042439 Bacteria 4980
465 Ga0439460_0038281 3300042461 Bacteria 1398
466 Ga0451577_1181352 3300042876 Bacteria 683
467 Ga0495590_0070431 3300046457 Bacteria 1226
468 Ga0495638_0138320 3300046460 Bacteria 1424
469 Ga0495606_0413169 3300046507 Bacteria 700
470 Ga0495620_0055637 3300046515 Bacteria 1667
471 Ga0495632_0019126 3300046519 Bacteria 3739
472 Ga0495632_0029285 3300046519 Bacteria 2868
473 Ga0495642_0070721 3300046528 Bacteria 1459
474 Ga0495598_0184035 3300046537 Bacteria 747
475 Ga0495598_0189791 3300046537 Bacteria 737
476 Ga0495621_0028023 3300046539 Bacteria 1912
477 Ga0495621_0230697 3300046539 Bacteria 752
478 Ga0495597_0048612 3300046542 Bacteria 1876
479 Ga0495597_0175565 3300046542 Bacteria 868
480 Ga0495668_0087270 3300046616 Bacteria 1711
481 Ga0495625_0060457 3300046660 Bacteria 2684
482 Ga0495658_0199009 3300046683 Bacteria 1248
483 Ga0495670_0331650 3300046691 Bacteria 817
484 Ga0495649_0035019 3300046694 Bacteria 2761
485 Ga0495660_0005806 3300046810 Bacteria 7369
486 Ga0495687_000327 3300047443 Bacteria 61677
487 Ga0495687_002550 3300047443 Bacteria 14412
488 Ga0495686_0008561 3300047472 Bacteria 7493
489 Ga0495686_0295025 3300047472 Bacteria 897
490 Ga0495686_0442929 3300047472 Bacteria 691
491 Ga0495626_0019225 3300048091 Bacteria 3417
492 Ga0496100_0409067 3300048903 Bacteria 1035
493 Ga0496104_0224876 3300048907 Bacteria 1789
494 Ga0496106_0044701 3300048909 Bacteria 3325
495 Ga0496110_1407124 3300048913 Bacteria 607
496 Ga0496121_0511530 3300048924 Bacteria 760
497 Ga0496124_0119390 3300048927 Bacteria 2109
498 Ga0501309_052767 3300049129 Bacteria 641
499 Ga0501305_068677 3300049161 Bacteria 620
500 Ga0501292_002950 3300049515 Bacteria 2235
501 Ga0501294_002590 3300049517 Bacteria 1710
502 Ga0501297_055640 3300049520 Bacteria 593
503 Ga0501298_008546 3300049521 Bacteria 1723
504 Ga0501301_001221 3300049524 Bacteria 1617
505 Ga0501042_0607293 3300049578 Bacteria 795
506 Ga0501043_0000020 3300049579 Bacteria 155270
507 Ga0501046_0000039 3300049580 Bacteria 155237
508 Ga0501047_0000028 3300049581 Bacteria 220279
509 Ga0501048_0000484 3300049582 Bacteria 27870
510 Ga0501198_000001 3300049649 Bacteria 234552
511 Ga0501206_001789 3300049653 Bacteria 2696
512 Ga0501206_020954 3300049653 Bacteria 932
513 Ga0501222_000013 3300049662 Bacteria 87490
514 Ga0501253_018237 3300049683 Bacteria 1195
515 Ga0501257_016369 3300049686 Bacteria 1720
516 Ga0501221_051574 3300049704 Bacteria 928
517 Ga0501245_163336 3300049708 Bacteria 500
518 Ga0501262_000983 3300049759 Bacteria 3239
519 Ga0501265_000504 3300049762 Bacteria 4140
520 Ga0501273_016268 3300049770 Bacteria 973
521 Ga0501045_0015944 3300049824 Bacteria 5331
522 nmdc:mga03683_127849_c1 3300050489 Bacteria 1135
523 nmdc:mga03683_258740_c1 3300050489 Bacteria 810
524 nmdc:mga03683_34668_c1 3300050489 Bacteria 2043
525 nmdc:mga03683_50166_c1 3300050489 Bacteria 1393
526 nmdc:mga03n38_416692_c1 3300050490 Bacteria 742
527 nmdc:mga03n38_800757_c1 3300050490 Unclassified 549
528 nmdc:mga03n38_81622_c1 3300050490 Bacteria 1520
529 nmdc:mga00v17_16591_c1 3300050491 Bacteria 4152
530 nmdc:mga0k408_117689_c1 3300050493 Bacteria 1573
531 nmdc:mga0k408_122327_c1 3300050493 Bacteria 1542
532 nmdc:mga0k408_135833_c1 3300050493 Bacteria 1461
533 nmdc:mga0k408_153854_c1 3300050493 Bacteria 1370
534 nmdc:mga0k408_18953_c1 3300050493 Bacteria 3842
535 nmdc:mga0k408_253659_c1 3300050493 Bacteria 1050
536 nmdc:mga0k408_401199_c1 3300050493 Bacteria 816
537 nmdc:mga0k408_513317_c1 3300050493 Bacteria 710
538 nmdc:mga0k408_57958_c1 3300050493 Bacteria 2249
539 nmdc:mga0k408_700031_c1 3300050493 Bacteria 594
540 nmdc:mga06z11_31050_c1 3300050494 Bacteria 2592
541 nmdc:mga06z11_362754_c1 3300050494 Bacteria 869
542 nmdc:mga06z11_475592_c1 3300050494 Bacteria 756
543 nmdc:mga04h51_54553_c1 3300050495 Bacteria 1351
544 nmdc:mga04h51_86019_c1 3300050495 Bacteria 1124
545 nmdc:mga07m45_10161_c1 3300050496 Bacteria 4909
546 nmdc:mga07m45_170805_c1 3300050496 Bacteria 1264
547 nmdc:mga07m45_17093_c1 3300050496 Bacteria 3890
548 nmdc:mga07m45_19223_c1 3300050496 Bacteria 3700
549 nmdc:mga07m45_254523_c1 3300050496 Bacteria 1021
550 nmdc:mga07m45_355797_c1 3300050496 Bacteria 851
551 nmdc:mga07m45_73334_c1 3300050496 Bacteria 1949
552 nmdc:mga08y16_219078_c1 3300050511 Bacteria 1970
553 nmdc:mga0sz30_166552_c1 3300050516 Bacteria 977
554 nmdc:mga0sz30_453400_c1 3300050516 Unclassified 576
555 Ga0495655_0045174 3300053083 Bacteria 1143
556 Ga0500578_0269661 3300053086 Bacteria 1019
557 Ga0500578_0307717 3300053086 Bacteria 938
558 Ga0500646_0051958 3300053090 Bacteria 1185
559 Ga0500583_0079909 3300053092 Bacteria 1578
560 Ga0500594_0002742 3300053118 Bacteria 3835
561 Ga0500621_026662 3300053126 Bacteria 2270
562 Ga0500658_0009667 3300053134 Bacteria 3557
563 Ga0500568_0043133 3300053139 Bacteria 1804
564 Ga0500604_0025933 3300053151 Bacteria 1687
565 Ga0500622_0000347 3300053156 Bacteria 45247
566 Ga0500645_004787 3300053730 Bacteria 5121
567 Ga0590071_005485 3300059421 Bacteria 3047
568 Ga0590074_040878 3300059423 Bacteria 834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006177 Ga0075362_10436476 Ga0075362_104364762 115
2 3300006195 Ga0075366_10092368 Ga0075366_100923682 115
3 3300048927 Ga0496124_0119390 Ga0496124_0119390_1468_1836 115
4 3300050489 nmdc:mga03683_34668_c1 nmdc:mga03683_34668_c1_1104_1466 115
5 3300050493 nmdc:mga0k408_122327_c1 nmdc:mga0k408_122327_c1_434_796 115
6 3300042008 Ga0439450_044458 Ga0439450_044458_292_645 117
7 3300042117 Ga0450913_001708 Ga0450913_001708_781_1134 117
8 3300042439 Ga0439464_0001964 Ga0439464_0001964_1556_1909 117
9 3300042461 Ga0439460_0038281 Ga0439460_0038281_870_1223 117
10 3300015262 Ga0182007_10033495 Ga0182007_100334952 119
11 3300006177 Ga0075362_10101480 Ga0075362_101014802 120
12 3300041463 Ga0451804_0366189 Ga0451804_0366189_503_877 120
13 3300050489 nmdc:mga03683_50166_c1 nmdc:mga03683_50166_c1_258_632 120
14 3300050490 nmdc:mga03n38_81622_c1 nmdc:mga03n38_81622_c1_334_708 120
15 3300005293 Ga0065715_10021876 Ga0065715_100218761 121
16 3300005327 Ga0070658_10458467 Ga0070658_104584671 121
17 3300005328 Ga0070676_10026130 Ga0070676_100261305 121
18 3300005330 Ga0070690_100522714 Ga0070690_1005227142 121
19 3300005331 Ga0070670_100003220 Ga0070670_1000032205 121
20 3300005331 Ga0070670_100624239 Ga0070670_1006242392 121
21 3300005334 Ga0068869_101001994 Ga0068869_1010019942 121
22 3300005335 Ga0070666_10027063 Ga0070666_100270633 121
23 3300005338 Ga0068868_100057274 Ga0068868_1000572743 121
24 3300005344 Ga0070661_100168108 Ga0070661_1001681082 121
25 3300005344 Ga0070661_100536833 Ga0070661_1005368332 121
26 3300005347 Ga0070668_100231263 Ga0070668_1002312632 121
27 3300005353 Ga0070669_100017644 Ga0070669_1000176445 121
28 3300005353 Ga0070669_100068841 Ga0070669_1000688413 121
29 3300005354 Ga0070675_100114972 Ga0070675_1001149722 121
30 3300005355 Ga0070671_100043214 Ga0070671_1000432141 121
31 3300005355 Ga0070671_100068058 Ga0070671_1000680582 121
32 3300005355 Ga0070671_101352584 Ga0070671_1013525841 121
33 3300005356 Ga0070674_100015116 Ga0070674_1000151163 121
34 3300005356 Ga0070674_101866869 Ga0070674_1018668691 121
35 3300005356 Ga0070674_101977099 Ga0070674_1019770991 121
36 3300005364 Ga0070673_100107937 Ga0070673_1001079373 121
37 3300005364 Ga0070673_100595776 Ga0070673_1005957762 121
38 3300005366 Ga0070659_100369700 Ga0070659_1003697002 121
39 3300005367 Ga0070667_100610387 Ga0070667_1006103872 121
40 3300005455 Ga0070663_101553515 Ga0070663_1015535151 121
41 3300005456 Ga0070678_100354454 Ga0070678_1003544542 121
42 3300005456 Ga0070678_100442568 Ga0070678_1004425681 121
43 3300005459 Ga0068867_100048217 Ga0068867_1000482173 121
44 3300005459 Ga0068867_100137014 Ga0068867_1001370143 121
45 3300005459 Ga0068867_100286849 Ga0068867_1002868492 121
46 3300005459 Ga0068867_101510746 Ga0068867_1015107461 121
47 3300005530 Ga0070679_101591253 Ga0070679_1015912531 121
48 3300005539 Ga0068853_100273069 Ga0068853_1002730692 121
49 3300005543 Ga0070672_100017626 Ga0070672_1000176263 121
50 3300005543 Ga0070672_100155255 Ga0070672_1001552552 121
51 3300005544 Ga0070686_100576132 Ga0070686_1005761322 121
52 3300005548 Ga0070665_100953241 Ga0070665_1009532412 121
53 3300005548 Ga0070665_101807954 Ga0070665_1018079542 121
54 3300005564 Ga0070664_100214503 Ga0070664_1002145032 121
55 3300005564 Ga0070664_101515285 Ga0070664_1015152851 121
56 3300005578 Ga0068854_100069324 Ga0068854_1000693243 121
57 3300005616 Ga0068852_100244773 Ga0068852_1002447732 121
58 3300005616 Ga0068852_100764699 Ga0068852_1007646992 121
59 3300005618 Ga0068864_100015540 Ga0068864_1000155402 121
60 3300005718 Ga0068866_10369647 Ga0068866_103696472 121
61 3300005719 Ga0068861_100223300 Ga0068861_1002233001 121
62 3300005834 Ga0068851_10010095 Ga0068851_100100956 121
63 3300005834 Ga0068851_10348777 Ga0068851_103487771 121
64 3300005840 Ga0068870_10232199 Ga0068870_102321992 121
65 3300005844 Ga0068862_100049502 Ga0068862_1000495022 121
66 3300006237 Ga0097621_100019117 Ga0097621_1000191173 121
67 3300006237 Ga0097621_100271365 Ga0097621_1002713652 121
68 3300006358 Ga0068871_100003964 Ga0068871_1000039643 121
69 3300006358 Ga0068871_101676718 Ga0068871_1016767182 121
70 3300006881 Ga0068865_100189229 Ga0068865_1001892292 121
71 3300009177 Ga0105248_10863895 Ga0105248_108638952 121
72 3300013297 Ga0157378_10016476 Ga0157378_100164765 121
73 3300013297 Ga0157378_10338489 Ga0157378_103384892 121
74 3300013308 Ga0157375_10725135 Ga0157375_107251352 121
75 3300014745 Ga0157377_10572353 Ga0157377_105723532 121
76 3300014968 Ga0157379_11682826 Ga0157379_116828262 121
77 3300017792 Ga0163161_10014817 Ga0163161_100148173 121
78 3300017792 Ga0163161_10973349 Ga0163161_109733492 121
79 3300017792 Ga0163161_11143534 Ga0163161_111435341 121
80 3300025271 Ga0207666_1064659 Ga0207666_10646591 121
81 3300025315 Ga0207697_10010635 Ga0207697_100106354 121
82 3300025315 Ga0207697_10033168 Ga0207697_100331682 121
83 3300025321 Ga0207656_10016091 Ga0207656_100160914 121
84 3300025893 Ga0207682_10003996 Ga0207682_100039964 121
85 3300025901 Ga0207688_10022097 Ga0207688_100220972 121
86 3300025901 Ga0207688_10097909 Ga0207688_100979092 121
87 3300025903 Ga0207680_10249778 Ga0207680_102497782 121
88 3300025907 Ga0207645_10051984 Ga0207645_100519842 121
89 3300025907 Ga0207645_10201490 Ga0207645_102014902 121
90 3300025907 Ga0207645_10757979 Ga0207645_107579791 121
91 3300025908 Ga0207643_10147034 Ga0207643_101470342 121
92 3300025920 Ga0207649_10144200 Ga0207649_101442002 121
93 3300025921 Ga0207652_11700210 Ga0207652_117002101 121
94 3300025923 Ga0207681_10007931 Ga0207681_100079313 121
95 3300025923 Ga0207681_10340698 Ga0207681_103406982 121
96 3300025925 Ga0207650_10000587 Ga0207650_1000058719 121
97 3300025925 Ga0207650_10140997 Ga0207650_101409973 121
98 3300025925 Ga0207650_10171932 Ga0207650_101719323 121
99 3300025926 Ga0207659_10000861 Ga0207659_100008613 121
100 3300025931 Ga0207644_10016499 Ga0207644_100164993 121
101 3300025931 Ga0207644_10073992 Ga0207644_100739923 121
102 3300025932 Ga0207690_10519798 Ga0207690_105197982 121
103 3300025933 Ga0207706_10473758 Ga0207706_104737582 121
104 3300025934 Ga0207686_11694929 Ga0207686_116949292 121
105 3300025935 Ga0207709_10207003 Ga0207709_102070032 121
106 3300025937 Ga0207669_10004732 Ga0207669_100047323 121
107 3300025937 Ga0207669_11337992 Ga0207669_113379922 121
108 3300025938 Ga0207704_10178301 Ga0207704_101783012 121
109 3300025940 Ga0207691_10001498 Ga0207691_100014982 121
110 3300025940 Ga0207691_10040375 Ga0207691_100403755 121
111 3300025942 Ga0207689_10468374 Ga0207689_104683742 121
112 3300025945 Ga0207679_10349124 Ga0207679_103491242 121
113 3300025945 Ga0207679_10731712 Ga0207679_107317122 121
114 3300025960 Ga0207651_10339182 Ga0207651_103391822 121
115 3300025961 Ga0207712_10311393 Ga0207712_103113932 121
116 3300025972 Ga0207668_10226587 Ga0207668_102265872 121
117 3300025972 Ga0207668_10257246 Ga0207668_102572462 121
118 3300025981 Ga0207640_10044374 Ga0207640_100443743 121
119 3300025986 Ga0207658_10120698 Ga0207658_101206983 121
120 3300025986 Ga0207658_10544585 Ga0207658_105445852 121
121 3300026023 Ga0207677_10033420 Ga0207677_100334203 121
122 3300026041 Ga0207639_10194504 Ga0207639_101945042 121
123 3300026041 Ga0207639_10966055 Ga0207639_109660552 121
124 3300026067 Ga0207678_10625627 Ga0207678_106256272 121
125 3300026067 Ga0207678_11419383 Ga0207678_114193832 121
126 3300026075 Ga0207708_10221879 Ga0207708_102218792 121
127 3300026088 Ga0207641_10441467 Ga0207641_104414672 121
128 3300026089 Ga0207648_10007408 Ga0207648_1000740811 121
129 3300026089 Ga0207648_10008093 Ga0207648_100080933 121
130 3300026089 Ga0207648_10065652 Ga0207648_100656523 121
131 3300026089 Ga0207648_10351462 Ga0207648_103514621 121
132 3300026095 Ga0207676_10074889 Ga0207676_100748892 121
133 3300026121 Ga0207683_10065429 Ga0207683_100654293 121
134 3300026142 Ga0207698_10213567 Ga0207698_102135672 121
135 3300026142 Ga0207698_10485084 Ga0207698_104850842 121
136 3300028379 Ga0268266_10278554 Ga0268266_102785541 121
137 3300028380 Ga0268265_10247423 Ga0268265_102474232 121
138 3300031548 Ga0307408_100023888 Ga0307408_1000238884 121
139 3300031548 Ga0307408_100252647 Ga0307408_1002526472 121
140 3300031731 Ga0307405_10124588 Ga0307405_101245882 121
141 3300031731 Ga0307405_10712687 Ga0307405_107126872 121
142 3300031824 Ga0307413_10012583 Ga0307413_100125835 121
143 3300031852 Ga0307410_10000484 Ga0307410_1000048410 121
144 3300031852 Ga0307410_10534243 Ga0307410_105342432 121
145 3300031901 Ga0307406_10005948 Ga0307406_100059484 121
146 3300031903 Ga0307407_10113173 Ga0307407_101131733 121
147 3300031911 Ga0307412_10018963 Ga0307412_100189635 121
148 3300031911 Ga0307412_10209165 Ga0307412_102091652 121
149 3300031995 Ga0307409_100195583 Ga0307409_1001955833 121
150 3300032002 Ga0307416_100097312 Ga0307416_1000973122 121
151 3300032004 Ga0307414_10228690 Ga0307414_102286901 121
152 3300032005 Ga0307411_10052407 Ga0307411_100524074 121
153 3300032126 Ga0307415_100036458 Ga0307415_1000364584 121
154 3300036401 Ga0373937_0197282 Ga0373937_0197282_366_734 121
155 3300041443 Ga0451789_1255977 Ga0451789_1255977_180_545 121
156 3300041458 Ga0451798_0941624 Ga0451798_0941624_60_425 121
157 3300041460 Ga0451802_0562426 Ga0451802_0562426_82_450 121
158 3300041509 Ga0451843_1255163 Ga0451843_1255163_104_469 121
159 3300046515 Ga0495620_0055637 Ga0495620_0055637_13_384 121
160 3300046537 Ga0495598_0184035 Ga0495598_0184035_119_484 121
161 3300046539 Ga0495621_0230697 Ga0495621_0230697_348_713 121
162 3300046683 Ga0495658_0199009 Ga0495658_0199009_173_541 121
163 3300046691 Ga0495670_0331650 Ga0495670_0331650_211_576 121
164 3300048903 Ga0496100_0409067 Ga0496100_0409067_220_588 121
165 3300048907 Ga0496104_0224876 Ga0496104_0224876_687_1055 121
166 3300050491 nmdc:mga00v17_16591_c1 nmdc:mga00v17_16591_c1_3541_3906 121
167 3300050494 nmdc:mga06z11_31050_c1 nmdc:mga06z11_31050_c1_2044_2409 121
168 3300003794 Ga0055531_10071308 Ga0055531_100713082 122
169 3300005293 Ga0065715_10720038 Ga0065715_107200381 122
170 3300005328 Ga0070676_10312707 Ga0070676_103127071 122
171 3300005329 Ga0070683_100992529 Ga0070683_1009925292 122
172 3300005330 Ga0070690_100116489 Ga0070690_1001164893 122
173 3300005333 Ga0070677_10327525 Ga0070677_103275251 122
174 3300005334 Ga0068869_100006018 Ga0068869_1000060182 122
175 3300005334 Ga0068869_100600362 Ga0068869_1006003622 122
176 3300005334 Ga0068869_100855590 Ga0068869_1008555901 122
177 3300005334 Ga0068869_101398413 Ga0068869_1013984131 122
178 3300005335 Ga0070666_10005842 Ga0070666_100058421 122
179 3300005335 Ga0070666_10411142 Ga0070666_104111421 122
180 3300005335 Ga0070666_11250166 Ga0070666_112501661 122
181 3300005338 Ga0068868_100108508 Ga0068868_1001085082 122
182 3300005338 Ga0068868_100558744 Ga0068868_1005587442 122
183 3300005338 Ga0068868_100703906 Ga0068868_1007039061 122
184 3300005340 Ga0070689_100753615 Ga0070689_1007536152 122
185 3300005343 Ga0070687_100050192 Ga0070687_1000501923 122
186 3300005343 Ga0070687_101107243 Ga0070687_1011072431 122
187 3300005347 Ga0070668_100011100 Ga0070668_1000111008 122
188 3300005353 Ga0070669_100074021 Ga0070669_1000740213 122
189 3300005353 Ga0070669_100289219 Ga0070669_1002892192 122
190 3300005354 Ga0070675_100084711 Ga0070675_1000847112 122
191 3300005355 Ga0070671_100140591 Ga0070671_1001405913 122
192 3300005355 Ga0070671_100242409 Ga0070671_1002424092 122
193 3300005355 Ga0070671_101325714 Ga0070671_1013257142 122
194 3300005356 Ga0070674_100142333 Ga0070674_1001423332 122
195 3300005356 Ga0070674_100321610 Ga0070674_1003216102 122
196 3300005356 Ga0070674_102163569 Ga0070674_1021635691 122
197 3300005364 Ga0070673_100104338 Ga0070673_1001043382 122
198 3300005364 Ga0070673_100603795 Ga0070673_1006037952 122
199 3300005364 Ga0070673_101079022 Ga0070673_1010790222 122
200 3300005367 Ga0070667_100016760 Ga0070667_1000167603 122
201 3300005367 Ga0070667_102158518 Ga0070667_1021585181 122
202 3300005441 Ga0070700_101892422 Ga0070700_1018924221 122
203 3300005445 Ga0070708_100526662 Ga0070708_1005266622 122
204 3300005455 Ga0070663_100375128 Ga0070663_1003751282 122
205 3300005456 Ga0070678_100754117 Ga0070678_1007541171 122
206 3300005457 Ga0070662_100040625 Ga0070662_1000406253 122
207 3300005457 Ga0070662_100074754 Ga0070662_1000747543 122
208 3300005459 Ga0068867_100039168 Ga0068867_1000391683 122
209 3300005459 Ga0068867_100066783 Ga0068867_1000667833 122
210 3300005459 Ga0068867_100494732 Ga0068867_1004947322 122
211 3300005467 Ga0070706_100002337 Ga0070706_1000023372 122
212 3300005468 Ga0070707_100088292 Ga0070707_1000882923 122
213 3300005518 Ga0070699_100462167 Ga0070699_1004621672 122
214 3300005530 Ga0070679_101482486 Ga0070679_1014824862 122
215 3300005539 Ga0068853_100408605 Ga0068853_1004086052 122
216 3300005543 Ga0070672_100061377 Ga0070672_1000613772 122
217 3300005543 Ga0070672_100391362 Ga0070672_1003913622 122
218 3300005544 Ga0070686_100128427 Ga0070686_1001284273 122
219 3300005548 Ga0070665_101849039 Ga0070665_1018490392 122
220 3300005563 Ga0068855_101380704 Ga0068855_1013807042 122
221 3300005564 Ga0070664_101578077 Ga0070664_1015780771 122
222 3300005577 Ga0068857_100032353 Ga0068857_1000323535 122
223 3300005578 Ga0068854_100276284 Ga0068854_1002762842 122
224 3300005578 Ga0068854_100803625 Ga0068854_1008036252 122
225 3300005578 Ga0068854_101094006 Ga0068854_1010940062 122
226 3300005578 Ga0068854_101451679 Ga0068854_1014516792 122
227 3300005614 Ga0068856_100260353 Ga0068856_1002603532 122
228 3300005615 Ga0070702_101565047 Ga0070702_1015650471 122
229 3300005616 Ga0068852_100039460 Ga0068852_1000394603 122
230 3300005616 Ga0068852_100212873 Ga0068852_1002128732 122
231 3300005617 Ga0068859_100270336 Ga0068859_1002703362 122
232 3300005617 Ga0068859_100389835 Ga0068859_1003898352 122
233 3300005617 Ga0068859_101072620 Ga0068859_1010726202 122
234 3300005618 Ga0068864_100050174 Ga0068864_1000501743 122
235 3300005718 Ga0068866_10002843 Ga0068866_100028438 122
236 3300005718 Ga0068866_10731363 Ga0068866_107313632 122
237 3300005719 Ga0068861_100089167 Ga0068861_1000891673 122
238 3300005719 Ga0068861_101052396 Ga0068861_1010523962 122
239 3300005834 Ga0068851_10041979 Ga0068851_100419792 122
240 3300005834 Ga0068851_10327016 Ga0068851_103270162 122
241 3300005840 Ga0068870_10764895 Ga0068870_107648952 122
242 3300005841 Ga0068863_100008147 Ga0068863_1000081473 122
243 3300005842 Ga0068858_100024249 Ga0068858_1000242493 122
244 3300005842 Ga0068858_100322425 Ga0068858_1003224252 122
245 3300005843 Ga0068860_100010210 Ga0068860_1000102103 122
246 3300005844 Ga0068862_100047805 Ga0068862_1000478055 122
247 3300006048 Ga0075363_100454798 Ga0075363_1004547982 122
248 3300006048 Ga0075363_100499060 Ga0075363_1004990602 122
249 3300006048 Ga0075363_100583718 Ga0075363_1005837182 122
250 3300006051 Ga0075364_10178026 Ga0075364_101780262 122
251 3300006177 Ga0075362_10017195 Ga0075362_100171953 122
252 3300006177 Ga0075362_10548028 Ga0075362_105480281 122
253 3300006178 Ga0075367_10015567 Ga0075367_100155673 122
254 3300006178 Ga0075367_10040368 Ga0075367_100403683 122
255 3300006178 Ga0075367_10150660 Ga0075367_101506602 122
256 3300006178 Ga0075367_10675978 Ga0075367_106759782 122
257 3300006186 Ga0075369_10216141 Ga0075369_102161412 122
258 3300006186 Ga0075369_10354464 Ga0075369_103544642 122
259 3300006195 Ga0075366_10006193 Ga0075366_100061933 122
260 3300006195 Ga0075366_10011917 Ga0075366_100119174 122
261 3300006195 Ga0075366_10023339 Ga0075366_100233393 122
262 3300006195 Ga0075366_10024071 Ga0075366_100240713 122
263 3300006195 Ga0075366_10076863 Ga0075366_100768633 122
264 3300006195 Ga0075366_10146567 Ga0075366_101465672 122
265 3300006195 Ga0075366_10154208 Ga0075366_101542082 122
266 3300006195 Ga0075366_10238071 Ga0075366_102380712 122
267 3300006195 Ga0075366_10384094 Ga0075366_103840942 122
268 3300006195 Ga0075366_10384264 Ga0075366_103842642 122
269 3300006353 Ga0075370_10002177 Ga0075370_100021778 122
270 3300006353 Ga0075370_10006689 Ga0075370_100066892 122
271 3300006353 Ga0075370_10008615 Ga0075370_100086155 122
272 3300006353 Ga0075370_10077994 Ga0075370_100779942 122
273 3300006353 Ga0075370_10115053 Ga0075370_101150532 122
274 3300006353 Ga0075370_10143437 Ga0075370_101434372 122
275 3300006358 Ga0068871_100761165 Ga0068871_1007611651 122
276 3300006358 Ga0068871_101351159 Ga0068871_1013511592 122
277 3300006358 Ga0068871_101446870 Ga0068871_1014468702 122
278 3300006881 Ga0068865_100012253 Ga0068865_1000122532 122
279 3300006881 Ga0068865_100050655 Ga0068865_1000506552 122
280 3300006881 Ga0068865_100620332 Ga0068865_1006203322 122
281 3300006931 Ga0097620_100270347 Ga0097620_1002703472 122
282 3300006931 Ga0097620_100389829 Ga0097620_1003898292 122
283 3300006931 Ga0097620_101072645 Ga0097620_1010726452 122
284 3300009093 Ga0105240_10415143 Ga0105240_104151432 122
285 3300009094 Ga0111539_13123822 Ga0111539_131238221 122
286 3300009148 Ga0105243_10007512 Ga0105243_100075123 122
287 3300009148 Ga0105243_10053672 Ga0105243_100536722 122
288 3300009148 Ga0105243_10479183 Ga0105243_104791831 122
289 3300009174 Ga0105241_10994224 Ga0105241_109942242 122
290 3300009176 Ga0105242_10471181 Ga0105242_104711812 122
291 3300009176 Ga0105242_10682638 Ga0105242_106826382 122
292 3300009177 Ga0105248_10489158 Ga0105248_104891582 122
293 3300009177 Ga0105248_11403709 Ga0105248_114037092 122
294 3300009545 Ga0105237_10048132 Ga0105237_100481324 122
295 3300009551 Ga0105238_10254414 Ga0105238_102544142 122
296 3300009551 Ga0105238_10672408 Ga0105238_106724082 122
297 3300009551 Ga0105238_10702547 Ga0105238_107025472 122
298 3300009553 Ga0105249_10076441 Ga0105249_100764413 122
299 3300010375 Ga0105239_10149287 Ga0105239_101492872 122
300 3300010375 Ga0105239_11204838 Ga0105239_112048382 122
301 3300013100 Ga0157373_10333173 Ga0157373_103331732 122
302 3300013105 Ga0157369_11395663 Ga0157369_113956632 122
303 3300013296 Ga0157374_10043296 Ga0157374_100432962 122
304 3300013296 Ga0157374_11055196 Ga0157374_110551962 122
305 3300013297 Ga0157378_11421818 Ga0157378_114218182 122
306 3300013306 Ga0163162_10009814 Ga0163162_100098148 122
307 3300013306 Ga0163162_10537560 Ga0163162_105375602 122
308 3300013306 Ga0163162_12067383 Ga0163162_120673831 122
309 3300013307 Ga0157372_10143790 Ga0157372_101437903 122
310 3300013308 Ga0157375_10059004 Ga0157375_100590043 122
311 3300014326 Ga0157380_10044416 Ga0157380_100444165 122
312 3300014326 Ga0157380_10072192 Ga0157380_100721923 122
313 3300014326 Ga0157380_10956428 Ga0157380_109564282 122
314 3300014968 Ga0157379_10027057 Ga0157379_100270575 122
315 3300014968 Ga0157379_11329915 Ga0157379_113299152 122
316 3300017792 Ga0163161_10025520 Ga0163161_100255202 122
317 3300017792 Ga0163161_10539466 Ga0163161_105394662 122
318 3300025304 Ga0209257_1021296 Ga0209257_10212963 122
319 3300025315 Ga0207697_10030157 Ga0207697_100301573 122
320 3300025321 Ga0207656_10714357 Ga0207656_107143571 122
321 3300025893 Ga0207682_10146971 Ga0207682_101469712 122
322 3300025899 Ga0207642_10008153 Ga0207642_100081531 122
323 3300025901 Ga0207688_10050108 Ga0207688_100501083 122
324 3300025901 Ga0207688_10194965 Ga0207688_101949652 122
325 3300025903 Ga0207680_10017485 Ga0207680_100174855 122
326 3300025904 Ga0207647_10090324 Ga0207647_100903242 122
327 3300025904 Ga0207647_10365566 Ga0207647_103655661 122
328 3300025907 Ga0207645_10222756 Ga0207645_102227562 122
329 3300025910 Ga0207684_10026601 Ga0207684_100266016 122
330 3300025910 Ga0207684_10091896 Ga0207684_100918963 122
331 3300025911 Ga0207654_10469748 Ga0207654_104697482 122
332 3300025913 Ga0207695_10301512 Ga0207695_103015122 122
333 3300025914 Ga0207671_10073873 Ga0207671_100738732 122
334 3300025918 Ga0207662_10028888 Ga0207662_100288883 122
335 3300025920 Ga0207649_10320805 Ga0207649_103208052 122
336 3300025920 Ga0207649_11514413 Ga0207649_115144131 122
337 3300025922 Ga0207646_10089304 Ga0207646_100893042 122
338 3300025923 Ga0207681_10004142 Ga0207681_100041428 122
339 3300025923 Ga0207681_10455633 Ga0207681_104556332 122
340 3300025924 Ga0207694_10398476 Ga0207694_103984762 122
341 3300025926 Ga0207659_10067142 Ga0207659_100671422 122
342 3300025927 Ga0207687_10300670 Ga0207687_103006702 122
343 3300025933 Ga0207706_10264175 Ga0207706_102641753 122
344 3300025933 Ga0207706_10565081 Ga0207706_105650812 122
345 3300025934 Ga0207686_10433439 Ga0207686_104334392 122
346 3300025934 Ga0207686_10720470 Ga0207686_107204702 122
347 3300025935 Ga0207709_10031648 Ga0207709_100316483 122
348 3300025935 Ga0207709_10077216 Ga0207709_100772162 122
349 3300025935 Ga0207709_11288795 Ga0207709_112887951 122
350 3300025936 Ga0207670_10120004 Ga0207670_101200042 122
351 3300025937 Ga0207669_10012938 Ga0207669_100129383 122
352 3300025937 Ga0207669_10522219 Ga0207669_105222192 122
353 3300025938 Ga0207704_10022127 Ga0207704_100221274 122
354 3300025938 Ga0207704_10138822 Ga0207704_101388222 122
355 3300025940 Ga0207691_10144202 Ga0207691_101442022 122
356 3300025940 Ga0207691_10184335 Ga0207691_101843352 122
357 3300025940 Ga0207691_10585020 Ga0207691_105850202 122
358 3300025940 Ga0207691_10664077 Ga0207691_106640772 122
359 3300025941 Ga0207711_10016383 Ga0207711_100163833 122
360 3300025942 Ga0207689_10009559 Ga0207689_100095598 122
361 3300025942 Ga0207689_10113332 Ga0207689_101133321 122
362 3300025944 Ga0207661_11555386 Ga0207661_115553862 122
363 3300025960 Ga0207651_10300707 Ga0207651_103007072 122
364 3300025960 Ga0207651_10532118 Ga0207651_105321182 122
365 3300025960 Ga0207651_10533592 Ga0207651_105335922 122
366 3300025960 Ga0207651_10858317 Ga0207651_108583171 122
367 3300025961 Ga0207712_10004623 Ga0207712_100046234 122
368 3300025972 Ga0207668_10024665 Ga0207668_100246655 122
369 3300025981 Ga0207640_10703313 Ga0207640_107033132 122
370 3300025981 Ga0207640_11154065 Ga0207640_111540651 122
371 3300025986 Ga0207658_10007981 Ga0207658_100079814 122
372 3300025986 Ga0207658_10180050 Ga0207658_101800502 122
373 3300026023 Ga0207677_10035972 Ga0207677_100359721 122
374 3300026023 Ga0207677_10607816 Ga0207677_106078162 122
375 3300026035 Ga0207703_10021107 Ga0207703_100211075 122
376 3300026035 Ga0207703_11636122 Ga0207703_116361222 122
377 3300026041 Ga0207639_10348098 Ga0207639_103480982 122
378 3300026075 Ga0207708_10139866 Ga0207708_101398662 122
379 3300026078 Ga0207702_10178641 Ga0207702_101786412 122
380 3300026088 Ga0207641_10004568 Ga0207641_100045689 122
381 3300026089 Ga0207648_10012908 Ga0207648_100129082 122
382 3300026089 Ga0207648_10059871 Ga0207648_100598713 122
383 3300026089 Ga0207648_10400697 Ga0207648_104006972 122
384 3300026089 Ga0207648_11729676 Ga0207648_117296761 122
385 3300026095 Ga0207676_10066902 Ga0207676_100669022 122
386 3300026116 Ga0207674_10143574 Ga0207674_101435743 122
387 3300026116 Ga0207674_10705059 Ga0207674_107050591 122
388 3300026118 Ga0207675_100031877 Ga0207675_1000318777 122
389 3300026118 Ga0207675_100322102 Ga0207675_1003221022 122
390 3300026121 Ga0207683_10515261 Ga0207683_105152611 122
391 3300026142 Ga0207698_10209335 Ga0207698_102093352 122
392 3300027866 Ga0209813_10140209 Ga0209813_101402092 122
393 3300027866 Ga0209813_10171503 Ga0209813_101715032 122
394 3300027866 Ga0209813_10251558 Ga0209813_102515582 122
395 3300028379 Ga0268266_10472704 Ga0268266_104727042 122
396 3300028380 Ga0268265_10019161 Ga0268265_100191613 122
397 3300028381 Ga0268264_10003212 Ga0268264_100032126 122
398 3300028381 Ga0268264_10541330 Ga0268264_105413302 122
399 3300028786 Ga0307517_10094000 Ga0307517_100940003 122
400 3300028794 Ga0307515_10199724 Ga0307515_101997242 122
401 3300028794 Ga0307515_10267821 Ga0307515_102678212 122
402 3300028794 Ga0307515_10528283 Ga0307515_105282832 122
403 3300030522 Ga0307512_10099819 Ga0307512_100998192 122
404 3300031456 Ga0307513_10054292 Ga0307513_100542922 122
405 3300031456 Ga0307513_10321550 Ga0307513_103215502 122
406 3300031507 Ga0307509_10000225 Ga0307509_1000022538 122
407 3300031548 Ga0307408_100102091 Ga0307408_1001020913 122
408 3300031548 Ga0307408_100126115 Ga0307408_1001261153 122
409 3300031649 Ga0307514_10257953 Ga0307514_102579532 122
410 3300031730 Ga0307516_10031934 Ga0307516_100319343 122
411 3300031731 Ga0307405_10339283 Ga0307405_103392832 122
412 3300031824 Ga0307413_11598943 Ga0307413_115989432 122
413 3300031838 Ga0307518_10322741 Ga0307518_103227412 122
414 3300031852 Ga0307410_10027877 Ga0307410_100278771 122
415 3300031901 Ga0307406_10967766 Ga0307406_109677662 122
416 3300031911 Ga0307412_10262494 Ga0307412_102624942 122
417 3300031995 Ga0307409_100486735 Ga0307409_1004867352 122
418 3300032002 Ga0307416_101340916 Ga0307416_1013409162 122
419 3300032005 Ga0307411_10202935 Ga0307411_102029353 122
420 3300032005 Ga0307411_10563616 Ga0307411_105636162 122
421 3300033180 Ga0307510_10008316 Ga0307510_100083164 122
422 3300033180 Ga0307510_10036316 Ga0307510_100363163 122
423 3300033180 Ga0307510_10067356 Ga0307510_100673563 122
424 3300035691 Ga0373931_0688082 Ga0373931_0688082_164_532 122
425 3300037471 Ga0395905_0032804 Ga0395905_0032804_3928_4308 122
426 3300041459 Ga0451800_0060364 Ga0451800_0060364_569_937 122
427 3300041460 Ga0451802_1793975 Ga0451802_1793975_12_380 122
428 3300041463 Ga0451804_0316912 Ga0451804_0316912_46_462 122
429 3300041486 Ga0451807_0943994 Ga0451807_0943994_14_382 122
430 3300041509 Ga0451843_0486527 Ga0451843_0486527_741_1124 122
431 3300041512 Ga0451853_0211777 Ga0451853_0211777_355_723 122
432 3300041512 Ga0451853_4085130 Ga0451853_4085130_2458_2841 122
433 3300042133 Ga0450896_038489 Ga0450896_038489_107_481 122
434 3300042134 Ga0450898_018315 Ga0450898_018315_518_892 122
435 3300042876 Ga0451577_1181352 Ga0451577_1181352_34_405 122
436 3300046457 Ga0495590_0070431 Ga0495590_0070431_214_582 122
437 3300046460 Ga0495638_0138320 Ga0495638_0138320_55_438 122
438 3300046507 Ga0495606_0413169 Ga0495606_0413169_242_658 122
439 3300046519 Ga0495632_0019126 Ga0495632_0019126_2917_3309 122
440 3300046519 Ga0495632_0029285 Ga0495632_0029285_966_1334 122
441 3300046542 Ga0495597_0048612 Ga0495597_0048612_961_1329 122
442 3300046542 Ga0495597_0175565 Ga0495597_0175565_10_378 122
443 3300046616 Ga0495668_0087270 Ga0495668_0087270_1057_1425 122
444 3300046660 Ga0495625_0060457 Ga0495625_0060457_276_686 122
445 3300046694 Ga0495649_0035019 Ga0495649_0035019_1191_1559 122
446 3300046810 Ga0495660_0005806 Ga0495660_0005806_2306_2674 122
447 3300047443 Ga0495687_000327 Ga0495687_000327_1438_1806 122
448 3300047443 Ga0495687_002550 Ga0495687_002550_13785_14153 122
449 3300047472 Ga0495686_0008561 Ga0495686_0008561_5164_5532 122
450 3300048091 Ga0495626_0019225 Ga0495626_0019225_1220_1588 122
451 3300048913 Ga0496110_1407124 Ga0496110_1407124_107_481 122
452 3300049129 Ga0501309_052767 Ga0501309_052767_207_581 122
453 3300049161 Ga0501305_068677 Ga0501305_068677_187_561 122
454 3300049515 Ga0501292_002950 Ga0501292_002950_359_733 122
455 3300049517 Ga0501294_002590 Ga0501294_002590_909_1283 122
456 3300049520 Ga0501297_055640 Ga0501297_055640_185_559 122
457 3300049521 Ga0501298_008546 Ga0501298_008546_326_700 122
458 3300049524 Ga0501301_001221 Ga0501301_001221_188_562 122
459 3300049578 Ga0501042_0607293 Ga0501042_0607293_100_474 122
460 3300049579 Ga0501043_0000020 Ga0501043_0000020_16008_16382 122
461 3300049580 Ga0501046_0000039 Ga0501046_0000039_16046_16420 122
462 3300049581 Ga0501047_0000028 Ga0501047_0000028_16020_16394 122
463 3300049582 Ga0501048_0000484 Ga0501048_0000484_11694_12068 122
464 3300049649 Ga0501198_000001 Ga0501198_000001_147812_148186 122
465 3300049653 Ga0501206_001789 Ga0501206_001789_433_807 122
466 3300049653 Ga0501206_020954 Ga0501206_020954_463_837 122
467 3300049662 Ga0501222_000013 Ga0501222_000013_776_1150 122
468 3300049683 Ga0501253_018237 Ga0501253_018237_279_653 122
469 3300049686 Ga0501257_016369 Ga0501257_016369_630_1004 122
470 3300049704 Ga0501221_051574 Ga0501221_051574_242_616 122
471 3300049708 Ga0501245_163336 Ga0501245_163336_39_413 122
472 3300049759 Ga0501262_000983 Ga0501262_000983_2844_3218 122
473 3300049762 Ga0501265_000504 Ga0501265_000504_575_949 122
474 3300049770 Ga0501273_016268 Ga0501273_016268_278_652 122
475 3300049824 Ga0501045_0015944 Ga0501045_0015944_3727_4101 122
476 3300050489 nmdc:mga03683_127849_c1 nmdc:mga03683_127849_c1_14_382 122
477 3300050489 nmdc:mga03683_258740_c1 nmdc:mga03683_258740_c1_412_780 122
478 3300050490 nmdc:mga03n38_416692_c1 nmdc:mga03n38_416692_c1_206_574 122
479 3300050490 nmdc:mga03n38_800757_c1 nmdc:mga03n38_800757_c1_151_519 122
480 3300050493 nmdc:mga0k408_117689_c1 nmdc:mga0k408_117689_c1_1096_1464 122
481 3300050493 nmdc:mga0k408_135833_c1 nmdc:mga0k408_135833_c1_385_783 122
482 3300050493 nmdc:mga0k408_153854_c1 nmdc:mga0k408_153854_c1_111_563 122
483 3300050493 nmdc:mga0k408_18953_c1 nmdc:mga0k408_18953_c1_1054_1422 122
484 3300050493 nmdc:mga0k408_401199_c1 nmdc:mga0k408_401199_c1_430_804 122
485 3300050493 nmdc:mga0k408_513317_c1 nmdc:mga0k408_513317_c1_119_487 122
486 3300050493 nmdc:mga0k408_57958_c1 nmdc:mga0k408_57958_c1_503_880 122
487 3300050493 nmdc:mga0k408_700031_c1 nmdc:mga0k408_700031_c1_27_437 122
488 3300050494 nmdc:mga06z11_362754_c1 nmdc:mga06z11_362754_c1_217_585 122
489 3300050494 nmdc:mga06z11_475592_c1 nmdc:mga06z11_475592_c1_109_477 122
490 3300050495 nmdc:mga04h51_54553_c1 nmdc:mga04h51_54553_c1_830_1198 122
491 3300050495 nmdc:mga04h51_86019_c1 nmdc:mga04h51_86019_c1_477_845 122
492 3300050496 nmdc:mga07m45_10161_c1 nmdc:mga07m45_10161_c1_1461_1871 122
493 3300050496 nmdc:mga07m45_170805_c1 nmdc:mga07m45_170805_c1_853_1221 122
494 3300050496 nmdc:mga07m45_17093_c1 nmdc:mga07m45_17093_c1_755_1123 122
495 3300050496 nmdc:mga07m45_19223_c1 nmdc:mga07m45_19223_c1_468_836 122
496 3300050496 nmdc:mga07m45_254523_c1 nmdc:mga07m45_254523_c1_321_689 122
497 3300050496 nmdc:mga07m45_73334_c1 nmdc:mga07m45_73334_c1_1270_1638 122
498 3300050511 nmdc:mga08y16_219078_c1 nmdc:mga08y16_219078_c1_174_557 122
499 3300050516 nmdc:mga0sz30_166552_c1 nmdc:mga0sz30_166552_c1_445_813 122
500 3300050516 nmdc:mga0sz30_453400_c1 nmdc:mga0sz30_453400_c1_144_512 122
501 3300053083 Ga0495655_0045174 Ga0495655_0045174_155_523 122
502 3300053086 Ga0500578_0269661 Ga0500578_0269661_412_780 122
503 3300053090 Ga0500646_0051958 Ga0500646_0051958_336_728 122
504 3300053092 Ga0500583_0079909 Ga0500583_0079909_26_418 122
505 3300053118 Ga0500594_0002742 Ga0500594_0002742_2458_2841 122
506 3300053126 Ga0500621_026662 Ga0500621_026662_822_1205 122
507 3300053134 Ga0500658_0009667 Ga0500658_0009667_941_1309 122
508 3300053139 Ga0500568_0043133 Ga0500568_0043133_1019_1387 122
509 3300053151 Ga0500604_0025933 Ga0500604_0025933_368_751 122
510 3300053156 Ga0500622_0000347 Ga0500622_0000347_38593_38976 122
511 3300059421 Ga0590071_005485 Ga0590071_005485_857_1252 122
512 3300059423 Ga0590074_040878 Ga0590074_040878_166_561 122
513 3300003322 rootL2_10026887 rootL2_100268872 123
514 3300005331 Ga0070670_100357361 Ga0070670_1003573612 123
515 3300005347 Ga0070668_100512239 Ga0070668_1005122392 123
516 3300005353 Ga0070669_100041907 Ga0070669_1000419074 123
517 3300005354 Ga0070675_100079394 Ga0070675_1000793942 123
518 3300005356 Ga0070674_100421524 Ga0070674_1004215241 123
519 3300005364 Ga0070673_100279428 Ga0070673_1002794282 123
520 3300005367 Ga0070667_100002053 Ga0070667_1000020538 123
521 3300005367 Ga0070667_100927243 Ga0070667_1009272432 123
522 3300005367 Ga0070667_101451654 Ga0070667_1014516541 123
523 3300005543 Ga0070672_100011605 Ga0070672_1000116055 123
524 3300005842 Ga0068858_100699931 Ga0068858_1006999311 123
525 3300005843 Ga0068860_100757309 Ga0068860_1007573091 123
526 3300005937 Ga0081455_10908443 Ga0081455_109084431 123
527 3300006195 Ga0075366_10264571 Ga0075366_102645712 123
528 3300006358 Ga0068871_100225161 Ga0068871_1002251613 123
529 3300009098 Ga0105245_10220613 Ga0105245_102206133 123
530 3300014326 Ga0157380_10130786 Ga0157380_101307862 123
531 3300014968 Ga0157379_10544188 Ga0157379_105441882 123
532 3300025909 Ga0207705_10399103 Ga0207705_103991032 123
533 3300025923 Ga0207681_10046312 Ga0207681_100463122 123
534 3300025925 Ga0207650_10737075 Ga0207650_107370752 123
535 3300025926 Ga0207659_10625933 Ga0207659_106259332 123
536 3300025927 Ga0207687_10627811 Ga0207687_106278112 123
537 3300025937 Ga0207669_10126727 Ga0207669_101267272 123
538 3300025940 Ga0207691_10186249 Ga0207691_101862492 123
539 3300025940 Ga0207691_10430271 Ga0207691_104302712 123
540 3300025941 Ga0207711_10884152 Ga0207711_108841522 123
541 3300025960 Ga0207651_10119483 Ga0207651_101194832 123
542 3300025972 Ga0207668_10798930 Ga0207668_107989302 123
543 3300025986 Ga0207658_10003013 Ga0207658_100030134 123
544 3300026121 Ga0207683_11225779 Ga0207683_112257792 123
545 3300028380 Ga0268265_10707509 Ga0268265_107075092 123
546 3300028381 Ga0268264_11231665 Ga0268264_112316652 123
547 3300028794 Ga0307515_10114478 Ga0307515_101144783 123
548 3300031456 Ga0307513_10115320 Ga0307513_101153203 123
549 3300031548 Ga0307408_100204316 Ga0307408_1002043162 123
550 3300031731 Ga0307405_10187711 Ga0307405_101877112 123
551 3300031901 Ga0307406_10251951 Ga0307406_102519513 123
552 3300031911 Ga0307412_10393433 Ga0307412_103934332 123
553 3300031995 Ga0307409_101646596 Ga0307409_1016465962 123
554 3300032004 Ga0307414_10744938 Ga0307414_107449381 123
555 3300035695 Ga0373927_0331896 Ga0373927_0331896_97_468 123
556 3300035725 Ga0373947_0622542 Ga0373947_0622542_271_642 123
557 3300037068 Ga0373925_0014411 Ga0373925_0014411_4243_4614 123
558 3300046528 Ga0495642_0070721 Ga0495642_0070721_351_722 123
559 3300046537 Ga0495598_0189791 Ga0495598_0189791_270_656 123
560 3300046539 Ga0495621_0028023 Ga0495621_0028023_1293_1679 123
561 3300047472 Ga0495686_0295025 Ga0495686_0295025_61_444 123
562 3300047472 Ga0495686_0442929 Ga0495686_0442929_193_591 123
563 3300048909 Ga0496106_0044701 Ga0496106_0044701_990_1364 123
564 3300048924 Ga0496121_0511530 Ga0496121_0511530_251_649 123
565 3300050493 nmdc:mga0k408_253659_c1 nmdc:mga0k408_253659_c1_18_389 123
566 3300050496 nmdc:mga07m45_355797_c1 nmdc:mga07m45_355797_c1_213_599 123
567 3300053086 Ga0500578_0307717 Ga0500578_0307717_381_764 123
568 3300053730 Ga0500645_004787 Ga0500645_004787_3570_3953 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16137

DUF4845

Domain of unknown function (DUF4845)

63

145

0.98

Feature Viewer

pLDDT pTM Quality
60.52 0.27 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map