F464628

General Info

Members Datasets Scaffolds Average Seq Length
568 279 496 213

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10251875|Ga0157370_102518752
Length 243
Sequence MTEKPNHAEAMASTTAGDTGRASDAGRNEGQPDPRKASIETDADYAALDSTARAVLDFWFGEPGTTGFGQPSARWFKCDDAFDTTIRERFGATLAAARRGEHDSWQGTPLGALALIVVLDQFSRNTCRDAAQAFAADAKALEVARRLVESHGDRHLPTAEHRAFAYLPFEHAESLEAQRESVRLFEALGQETGQTGRGSYVDYAHRHAVIIERFGRFPHRNIALGRVSTEEELAFLREPGSSF

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
7 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
8 2519103095 Burkholderia sp. KJ006 Isolate Nodule
9 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
10 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
11 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
12 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
13 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
14 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
15 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
16 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
17 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
18 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
19 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
20 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
21 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
22 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
23 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
24 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
25 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
26 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
27 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
28 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
29 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
30 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
31 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
32 2818991450 Burkholderia sp. 604 Isolate Unclassified
33 2818991452 Burkholderia cepacia 561 Isolate Unclassified
34 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
35 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
36 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
37 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
38 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
39 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
40 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
41 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
42 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
43 2904564687 Burkholderia sp. 571 Isolate Unclassified
44 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
45 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
46 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
47 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
48 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
49 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
50 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
51 2928163908 Burkholderia sp. 567 Isolate Unclassified
52 2928170801 Burkholderia sp. 572 Isolate Unclassified
53 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
54 2928536128 Burkholderia sola 565 Isolate Unclassified
55 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
56 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
57 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
58 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
61 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
62 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
65 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
68 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
69 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
70 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
71 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
149 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
231 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
263 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
264 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
265 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
266 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
267 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
268 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
269 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
270 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
271 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
272 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
273 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
274 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
275 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
276 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
277 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
278 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
279 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.15
Metatranscriptomes 0.18
Isolates 12.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 2.99
Rhizoplane 7.39
Rhizosphere 67.61
Stem 0
Stem Tuber 0
Unclassified 13.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004308 3300001904 Bacteria 2438
2 JGI24739J22299_10019408 3300001989 Bacteria 2434
3 JGI24739J22299_10027392 3300001989 Bacteria 1992
4 JGI24737J22298_10064811 3300001990 Bacteria 1095
5 JGI24737J22298_10080417 3300001990 Bacteria 970
6 JGI24735J21928_10015357 3300002067 Bacteria 2389
7 JGI24735J21928_10015804 3300002067 Bacteria 2349
8 JGI24735J21928_10027698 3300002067 Bacteria 1697
9 JGI24738J21930_10011286 3300002075 Bacteria 1967
10 JGI25156J39149_1002658 3300002705 Bacteria 6274
11 JGI25156J39149_1007191 3300002705 Bacteria 2953
12 JGI25156J39149_1025774 3300002705 Bacteria 940
13 JGI25165J46597_1001112 3300003214 Bacteria 17034
14 rootH2_10144662 3300003320 Bacteria 2391
15 rootL2_10000506 3300003322 Bacteria 2834
16 rootH1_10016303 3300003323 Bacteria 1540
17 JGI25160J50197_1001398 3300003354 Bacteria 12123
18 Ga0055533_1000415 3300003756 Bacteria 16614
19 Ga0055533_1012563 3300003756 Bacteria 888
20 Ga0055532_1000063 3300003758 Bacteria 147140
21 Ga0055532_1000764 3300003758 Bacteria 11446
22 Ga0055532_1003316 3300003758 Bacteria 2820
23 Ga0055532_1003330 3300003758 Bacteria 2807
24 Ga0055527_1000049 3300003760 Bacteria 105168
25 Ga0055527_1000596 3300003760 Bacteria 11671
26 Ga0055527_1003210 3300003760 Bacteria 2493
27 Ga0055535_1000042 3300003761 Bacteria 147140
28 Ga0055535_1001464 3300003761 Bacteria 11882
29 Ga0055535_1001470 3300003761 Bacteria 11866
30 Ga0055542_1000071 3300003762 Bacteria 147140
31 Ga0055542_1001437 3300003762 Bacteria 11882
32 Ga0055542_1001771 3300003762 Bacteria 9063
33 Ga0055529_1000081 3300003763 Bacteria 147140
34 Ga0055529_1000378 3300003763 Bacteria 48131
35 Ga0055529_1003123 3300003763 Bacteria 2868
36 Ga0055528_1001333 3300003790 Bacteria 15358
37 Ga0055541_1009614 3300003841 Bacteria 1485
38 Ga0058692_1033103 3300003856 Bacteria 960
39 Ga0065165_1001568 3300005262 Bacteria 23601
40 Ga0070658_10010842 3300005327 Bacteria 7306
41 Ga0070658_10018941 3300005327 Bacteria 5514
42 Ga0070666_10034521 3300005335 Bacteria 3352
43 Ga0070660_100000045 3300005339 Bacteria 70908
44 Ga0070660_100000404 3300005339 Bacteria 28766
45 Ga0070659_100000069 3300005366 Bacteria 81078
46 Ga0070667_100098377 3300005367 Bacteria 2525
47 Ga0070663_100084874 3300005455 Bacteria 2335
48 Ga0070663_100261746 3300005455 Bacteria 1372
49 Ga0068855_100012359 3300005563 Bacteria 10313
50 Ga0068855_100027446 3300005563 Bacteria 6810
51 Ga0068855_100261509 3300005563 Bacteria 1927
52 Ga0070664_100192463 3300005564 Bacteria 1818
53 Ga0068852_100062860 3300005616 Bacteria 3230
54 Ga0105251_10000613 3300009011 Bacteria 32739
55 Ga0105251_10121131 3300009011 Bacteria 1188
56 Ga0105250_10010724 3300009092 Bacteria 3813
57 Ga0105240_10006999 3300009093 Bacteria 16468
58 Ga0105240_10009057 3300009093 Bacteria 14131
59 Ga0105240_10060794 3300009093 Bacteria 4709
60 Ga0105240_10068460 3300009093 Bacteria 4396
61 Ga0105240_10123051 3300009093 Bacteria 3122
62 Ga0105245_10750232 3300009098 Bacteria 1012
63 Ga0105237_10015869 3300009545 Bacteria 7832
64 Ga0105237_10087138 3300009545 Bacteria 3112
65 Ga0105238_10054313 3300009551 Bacteria 4023
66 Ga0105239_10001236 3300010375 Bacteria 34816
67 Ga0105239_10002651 3300010375 Bacteria 22579
68 Ga0157373_10004810 3300013100 Bacteria 10160
69 Ga0157371_10077746 3300013102 Bacteria 2350
70 Ga0157370_10001406 3300013104 Bacteria 29865
71 Ga0157370_10003087 3300013104 Bacteria 19723
72 Ga0157370_10251875 3300013104 Bacteria 1633
73 Ga0157370_10291969 3300013104 Bacteria 1506
74 Ga0157369_10000915 3300013105 Bacteria 37650
75 Ga0157369_10001268 3300013105 Bacteria 31342
76 Ga0157369_10004199 3300013105 Bacteria 17053
77 Ga0157369_10173413 3300013105 Bacteria 2271
78 Ga0157374_10000318 3300013296 Bacteria 44740
79 Ga0157378_10434723 3300013297 Bacteria 1299
80 Ga0163162_10006007 3300013306 Bacteria 11753
81 Ga0157372_10029152 3300013307 Bacteria 6024
82 Ga0157372_10149106 3300013307 Bacteria 2698
83 Ga0182008_10074420 3300014497 Bacteria 1671
84 Ga0182008_10351219 3300014497 Bacteria 782
85 Ga0182006_1021318 3300015261 Bacteria 2703
86 Ga0182006_1085182 3300015261 Bacteria 1146
87 Ga0182007_10019572 3300015262 Bacteria 2432
88 Ga0182007_10050283 3300015262 Bacteria 1376
89 Ga0183361_10010 3300016635 Bacteria 204902
90 Ga0224712_10000188 3300022467 Bacteria 10883
91 Ga0209566_101237 3300025225 Bacteria 8796
92 Ga0209674_100013 3300025226 Bacteria 813140
93 Ga0209674_100174 3300025226 Bacteria 80149
94 Ga0209674_110403 3300025226 Bacteria 993
95 Ga0209672_100010 3300025228 Bacteria 873151
96 Ga0209672_100033 3300025228 Bacteria 315326
97 Ga0209672_100114 3300025228 Bacteria 90538
98 Ga0209672_100224 3300025228 Bacteria 43765
99 Ga0209147_100006 3300025229 Bacteria 873276
100 Ga0209147_100161 3300025229 Bacteria 90627
101 Ga0209147_100168 3300025229 Bacteria 89085
102 Ga0209147_100199 3300025229 Bacteria 67646
103 Ga0209563_106181 3300025230 Bacteria 2080
104 Ga0209258_100010 3300025242 Bacteria 873276
105 Ga0209258_100100 3300025242 Bacteria 214027
106 Ga0209258_100263 3300025242 Bacteria 90453
107 Ga0209148_1000018 3300025254 Bacteria 756247
108 Ga0209148_1000630 3300025254 Bacteria 31045
109 Ga0209148_1001267 3300025254 Bacteria 13898
110 Ga0209759_1000250 3300025256 Bacteria 80232
111 Ga0209759_1000690 3300025256 Bacteria 30331
112 Ga0209759_1001096 3300025256 Bacteria 17547
113 Ga0209759_1002552 3300025256 Bacteria 7901
114 Ga0209233_1000171 3300025261 Bacteria 146605
115 Ga0209455_1000015 3300025272 Bacteria 756128
116 Ga0209455_1000192 3300025272 Bacteria 90553
117 Ga0209455_1002064 3300025272 Bacteria 8114
118 Ga0209673_1000332 3300025273 Bacteria 86973
119 Ga0209130_1014437 3300025284 Bacteria 1982
120 Ga0209564_1001581 3300025295 Bacteria 22255
121 Ga0207426_1000168 3300025302 Bacteria 165214
122 Ga0207713_1000221 3300025735 Bacteria 76659
123 Ga0207680_10067424 3300025903 Bacteria 2204
124 Ga0207647_10000235 3300025904 Bacteria 45337
125 Ga0207647_10000590 3300025904 Bacteria 28264
126 Ga0207647_10022276 3300025904 Bacteria 4211
127 Ga0207647_10028180 3300025904 Bacteria 3651
128 Ga0207647_10047469 3300025904 Bacteria 2671
129 Ga0207705_10010221 3300025909 Bacteria 6827
130 Ga0207705_10184461 3300025909 Bacteria 1576
131 Ga0207705_10542494 3300025909 Bacteria 904
132 Ga0207695_10004347 3300025913 Bacteria 19403
133 Ga0207695_10036589 3300025913 Bacteria 5306
134 Ga0207695_10051646 3300025913 Bacteria 4314
135 Ga0207671_10047271 3300025914 Bacteria 3185
136 Ga0207671_10301082 3300025914 Bacteria 1267
137 Ga0207657_10000068 3300025919 Bacteria 96575
138 Ga0207657_10001021 3300025919 Bacteria 29707
139 Ga0207690_10000027 3300025932 Bacteria 162225
140 Ga0207679_10176225 3300025945 Bacteria 1765
141 Ga0207667_10008611 3300025949 Bacteria 12102
142 Ga0207667_10010187 3300025949 Bacteria 11011
143 Ga0207678_10000386 3300026067 Bacteria 40106
144 Ga0207702_10905525 3300026078 Unclassified 874
145 Ga0207698_10019463 3300026142 Bacteria 4648
146 Ga0207698_10316202 3300026142 Bacteria 1460
147 Ga0209371_1000405 3300027312 Bacteria 44970
148 Ga0209371_1013475 3300027312 Bacteria 2292
149 Ga0268256_1000345 3300030500 Bacteria 44970
150 Ga0268256_1014857 3300030500 Bacteria 2292
151 Ga0307408_100002981 3300031548 Bacteria 11722
152 Ga0307412_10000005 3300031911 Bacteria 526194
153 Ga0307412_10160063 3300031911 Bacteria 1671
154 Ga0307416_100099641 3300032002 Bacteria 2524
155 Ga0395899_0000038 3300037312 Bacteria 272627
156 Ga0395899_0009113 3300037312 Bacteria 7624
157 Ga0395899_0041605 3300037312 Bacteria 3433
158 Ga0395900_0000030 3300037418 Bacteria 272630
159 Ga0395900_0000635 3300037418 Bacteria 47215
160 Ga0395900_0056050 3300037418 Bacteria 4057
161 Ga0395900_0115375 3300037418 Bacteria 2756
162 Ga0395900_0121152 3300037418 Bacteria 2684
163 Ga0395900_0302667 3300037418 Bacteria 1585
164 Ga0395900_0745833 3300037418 Bacteria 910
165 Ga0395898_0000409 3300037466 Bacteria 92805
166 Ga0395898_0001892 3300037466 Bacteria 26705
167 Ga0395898_0043167 3300037466 Bacteria 4444
168 Ga0395898_0588290 3300037466 Bacteria 1055
169 Ga0395905_0000012 3300037471 Bacteria 420861
170 Ga0395901_0000002 3300038443 Bacteria 761045
171 Ga0395901_0000079 3300038443 Bacteria 134462
172 Ga0395901_0000417 3300038443 Bacteria 50166
173 Ga0395901_0062632 3300038443 Bacteria 3870
174 Ga0395901_0204575 3300038443 Bacteria 2068
175 Ga0395901_0425537 3300038443 Bacteria 1361
176 Ga0436361_0723959 3300039447 Bacteria 5657
177 Ga0439448_0001158 3300042005 Bacteria 6689
178 Ga0466969_0024770 3300044656 Bacteria 3086
179 Ga0466969_0056006 3300044656 Bacteria 1926
180 Ga0466973_0042623 3300044659 Bacteria 4265
181 Ga0466980_0079820 3300044668 Bacteria 2270
182 Ga0466965_0000552 3300044683 Bacteria 13479
183 Ga0466965_0009422 3300044683 Bacteria 4539
184 Ga0466966_0003017 3300044684 Bacteria 11103
185 Ga0466966_0005413 3300044684 Bacteria 8392
186 Ga0466966_0378589 3300044684 Bacteria 850
187 Ga0466961_0004320 3300044693 Bacteria 8897
188 Ga0466961_0005705 3300044693 Bacteria 7875
189 Ga0466961_0129382 3300044693 Bacteria 1582
190 Ga0466961_0323240 3300044693 Bacteria 941
191 Ga0466963_0000989 3300044694 Bacteria 14647
192 Ga0466963_0001909 3300044694 Bacteria 11405
193 Ga0466971_0005454 3300044719 Bacteria 5520
194 Ga0466971_0271204 3300044719 Bacteria 811
195 Ga0466968_0011694 3300044735 Bacteria 3424
196 Ga0466968_0094149 3300044735 Bacteria 1331
197 Ga0466970_0035633 3300044765 Bacteria 2636
198 Ga0466957_0000377 3300044842 Bacteria 21850
199 Ga0466957_0248295 3300044842 Bacteria 1182
200 Ga0466960_0358598 3300044901 Bacteria 833
201 Ga0466959_0001316 3300045049 Bacteria 15078
202 Ga0466959_0021478 3300045049 Bacteria 4760
203 Ga0466959_0072598 3300045049 Bacteria 2490
204 Ga0466958_0003652 3300045836 Bacteria 8030
205 Ga0466958_0056037 3300045836 Bacteria 2393
206 Ga0466958_0087205 3300045836 Bacteria 1927
207 Ga0495592_0012309 3300046454 Bacteria 6495
208 Ga0495592_0241592 3300046454 Bacteria 1198
209 Ga0495603_0000924 3300046455 Bacteria 16860
210 Ga0495603_0011446 3300046455 Bacteria 5369
211 Ga0495603_0017279 3300046455 Bacteria 4367
212 Ga0495590_0086144 3300046457 Bacteria 1109
213 Ga0495591_001281 3300046458 Bacteria 16028
214 Ga0495591_023789 3300046458 Bacteria 1955
215 Ga0495591_064372 3300046458 Bacteria 966
216 Ga0495629_0000774 3300046459 Bacteria 25829
217 Ga0495629_0004019 3300046459 Bacteria 11052
218 Ga0495629_0012033 3300046459 Bacteria 6272
219 Ga0495629_0070929 3300046459 Bacteria 2431
220 Ga0495638_0004983 3300046460 Bacteria 9959
221 Ga0495641_0017923 3300046461 Bacteria 3669
222 Ga0495651_0001916 3300046462 Bacteria 16111
223 Ga0495651_0066028 3300046462 Bacteria 2762
224 Ga0495653_0004233 3300046463 Bacteria 11629
225 Ga0495653_0005707 3300046463 Bacteria 10171
226 Ga0495653_0010517 3300046463 Bacteria 7575
227 Ga0495653_0267064 3300046463 Bacteria 1128
228 Ga0495650_0002070 3300046471 Bacteria 17390
229 Ga0495650_0004418 3300046471 Bacteria 9646
230 Ga0495650_0007548 3300046471 Bacteria 6514
231 Ga0495650_0021878 3300046471 Bacteria 3076
232 Ga0495650_0058035 3300046471 Bacteria 1564
233 Ga0495580_0004489 3300046472 Bacteria 11727
234 Ga0495580_0004862 3300046472 Bacteria 11240
235 Ga0495580_0006304 3300046472 Bacteria 9690
236 Ga0495580_0008325 3300046472 Bacteria 8248
237 Ga0495580_0013673 3300046472 Bacteria 6186
238 Ga0495580_0068678 3300046472 Bacteria 2478
239 Ga0495582_0001203 3300046473 Bacteria 14546
240 Ga0495582_0011161 3300046473 Bacteria 4947
241 Ga0495582_0074739 3300046473 Bacteria 1876
242 Ga0495582_0107727 3300046473 Bacteria 1564
243 Ga0495605_0005788 3300046474 Bacteria 7152
244 Ga0495605_0014812 3300046474 Bacteria 4256
245 Ga0495605_0015930 3300046474 Bacteria 4079
246 Ga0495605_0076797 3300046474 Bacteria 1568
247 Ga0495662_0009608 3300046476 Bacteria 4743
248 Ga0495664_0002334 3300046477 Bacteria 10169
249 Ga0495664_0027348 3300046477 Bacteria 3324
250 Ga0495664_0069169 3300046477 Bacteria 2107
251 Ga0495584_0182575 3300046491 Bacteria 1066
252 Ga0495584_0219195 3300046491 Bacteria 967
253 Ga0495594_0422801 3300046499 Bacteria 758
254 Ga0495596_0041805 3300046500 Bacteria 1807
255 Ga0495596_0057556 3300046500 Bacteria 1517
256 Ga0495596_0087988 3300046500 Bacteria 1205
257 Ga0495607_0032552 3300046501 Bacteria 3181
258 Ga0495607_0082747 3300046501 Bacteria 1760
259 Ga0495583_0001558 3300046506 Bacteria 22670
260 Ga0495583_0016365 3300046506 Bacteria 3989
261 Ga0495606_0011910 3300046507 Bacteria 7035
262 Ga0495606_0014784 3300046507 Bacteria 6063
263 Ga0495606_0036166 3300046507 Bacteria 3366
264 Ga0495606_0136546 3300046507 Bacteria 1452
265 Ga0495606_0225939 3300046507 Bacteria 1052
266 Ga0495606_0311932 3300046507 Bacteria 848
267 Ga0495608_0004868 3300046511 Bacteria 9603
268 Ga0495608_0010226 3300046511 Bacteria 6549
269 Ga0495610_0001665 3300046512 Bacteria 19541
270 Ga0495616_0058182 3300046513 Bacteria 1904
271 Ga0495618_0005571 3300046514 Bacteria 7659
272 Ga0495618_0007713 3300046514 Bacteria 6508
273 Ga0495618_0021793 3300046514 Bacteria 3951
274 Ga0495618_0136477 3300046514 Bacteria 1569
275 Ga0495620_0016949 3300046515 Bacteria 3642
276 Ga0495628_0009663 3300046516 Bacteria 8230
277 Ga0495628_0020834 3300046516 Bacteria 5401
278 Ga0495628_0021567 3300046516 Bacteria 5296
279 Ga0495628_0039234 3300046516 Bacteria 3787
280 Ga0495630_0033169 3300046517 Bacteria 3851
281 Ga0495630_0061103 3300046517 Bacteria 2829
282 Ga0495630_0092735 3300046517 Bacteria 2282
283 Ga0495630_0145157 3300046517 Bacteria 1804
284 Ga0495648_0004213 3300046524 Bacteria 12348
285 Ga0495648_0021495 3300046524 Bacteria 4465
286 Ga0495648_0055509 3300046524 Bacteria 2387
287 Ga0495648_0142439 3300046524 Bacteria 1260
288 Ga0495648_0189858 3300046524 Bacteria 1037
289 Ga0495666_0000559 3300046526 Bacteria 16637
290 Ga0495666_0002079 3300046526 Bacteria 9919
291 Ga0495666_0003565 3300046526 Bacteria 7869
292 Ga0495666_0005638 3300046526 Bacteria 6303
293 Ga0495666_0062031 3300046526 Bacteria 1786
294 Ga0495642_0171655 3300046528 Bacteria 942
295 Ga0495652_0010532 3300046529 Bacteria 8377
296 Ga0495652_0027450 3300046529 Bacteria 5015
297 Ga0495652_0090905 3300046529 Bacteria 2496
298 Ga0495652_0150921 3300046529 Bacteria 1816
299 Ga0495654_0018564 3300046530 Bacteria 3643
300 Ga0495665_0006149 3300046531 Bacteria 6487
301 Ga0495665_0010276 3300046531 Bacteria 5066
302 Ga0495665_0022130 3300046531 Bacteria 3418
303 Ga0495665_0033391 3300046531 Bacteria 2752
304 Ga0495665_0037670 3300046531 Bacteria 2580
305 Ga0495665_0310442 3300046531 Bacteria 806
306 Ga0495640_0004697 3300046533 Bacteria 10885
307 Ga0495640_0072185 3300046533 Bacteria 2313
308 Ga0495586_0108540 3300046535 Bacteria 1543
309 Ga0495586_0323470 3300046535 Bacteria 885
310 Ga0495587_0007703 3300046536 Bacteria 6966
311 Ga0495597_0175800 3300046542 Bacteria 867
312 Ga0495645_0003525 3300046543 Bacteria 10587
313 Ga0495645_0007762 3300046543 Bacteria 7461
314 Ga0495645_0225261 3300046543 Bacteria 1259
315 Ga0495622_0000854 3300046557 Bacteria 16755
316 Ga0495622_0066779 3300046557 Bacteria 1662
317 Ga0495634_0004538 3300046642 Bacteria 10869
318 Ga0495634_0009485 3300046642 Bacteria 7177
319 Ga0495634_0355193 3300046642 Bacteria 877
320 Ga0495611_0031701 3300046648 Bacteria 2328
321 Ga0495625_0052535 3300046660 Bacteria 2918
322 Ga0495625_0379854 3300046660 Bacteria 887
323 Ga0495635_0003384 3300046663 Bacteria 11016
324 Ga0495635_0006854 3300046663 Bacteria 7959
325 Ga0495635_0044987 3300046663 Bacteria 3045
326 Ga0495635_0615629 3300046663 Bacteria 708
327 Ga0495661_0004501 3300046665 Bacteria 10041
328 Ga0495661_0006145 3300046665 Bacteria 8456
329 Ga0495661_0009109 3300046665 Bacteria 6825
330 Ga0495588_0014120 3300046674 Bacteria 3818
331 Ga0495588_0014205 3300046674 Bacteria 3808
332 Ga0495657_0044512 3300046675 Bacteria 3019
333 Ga0495599_0050779 3300046678 Bacteria 2598
334 Ga0495599_0094145 3300046678 Bacteria 1868
335 Ga0495599_0140630 3300046678 Bacteria 1497
336 Ga0495623_0002534 3300046679 Bacteria 12084
337 Ga0495623_0016504 3300046679 Bacteria 4772
338 Ga0495623_0078859 3300046679 Bacteria 2041
339 Ga0495646_0005753 3300046680 Bacteria 7858
340 Ga0495646_0011578 3300046680 Bacteria 5602
341 Ga0495646_0012975 3300046680 Bacteria 5296
342 Ga0495646_0082290 3300046680 Bacteria 1873
343 Ga0495646_0107299 3300046680 Bacteria 1593
344 Ga0495669_0020892 3300046684 Bacteria 2836
345 Ga0495613_0014182 3300046689 Bacteria 5912
346 Ga0495613_0041942 3300046689 Bacteria 3387
347 Ga0495624_0002531 3300046690 Bacteria 13833
348 Ga0495624_0013045 3300046690 Bacteria 5666
349 Ga0495624_0048299 3300046690 Bacteria 2701
350 Ga0495624_0283247 3300046690 Bacteria 1000
351 Ga0495624_0303080 3300046690 Bacteria 963
352 Ga0495670_0047586 3300046691 Bacteria 2144
353 Ga0495671_0018661 3300046692 Bacteria 3678
354 Ga0495671_0024994 3300046692 Bacteria 3107
355 Ga0495671_0077998 3300046692 Bacteria 1624
356 Ga0495649_0008350 3300046694 Bacteria 6232
357 Ga0495649_0106574 3300046694 Bacteria 1487
358 Ga0495589_0002930 3300046794 Bacteria 9420
359 Ga0495589_0026608 3300046794 Bacteria 2929
360 Ga0495589_0096473 3300046794 Bacteria 1433
361 Ga0495589_0199897 3300046794 Bacteria 944
362 Ga0495600_0001057 3300046809 Bacteria 14917
363 Ga0495600_0012661 3300046809 Bacteria 5279
364 Ga0495600_0082481 3300046809 Bacteria 2098
365 Ga0495660_0182211 3300046810 Bacteria 1015
366 Ga0495581_0001974 3300047315 Bacteria 11503
367 Ga0495581_0002786 3300047315 Bacteria 9968
368 Ga0495581_0004018 3300047315 Bacteria 8470
369 Ga0495581_0074408 3300047315 Bacteria 1965
370 Ga0495604_0005312 3300047317 Bacteria 10221
371 Ga0495604_0008280 3300047317 Bacteria 8222
372 Ga0495604_0021447 3300047317 Bacteria 5157
373 Ga0495604_0022815 3300047317 Bacteria 4996
374 Ga0495674_0008236 3300047319 Bacteria 9946
375 Ga0495674_0022346 3300047319 Bacteria 5834
376 Ga0495674_0028891 3300047319 Bacteria 5051
377 Ga0495674_0075251 3300047319 Bacteria 2906
378 Ga0495674_0079383 3300047319 Bacteria 2818
379 Ga0495674_0123657 3300047319 Bacteria 2184
380 Ga0495674_0123659 3300047319 Bacteria 2184
381 Ga0495672_0098823 3300047320 Bacteria 1587
382 Ga0495676_0005710 3300047321 Bacteria 11408
383 Ga0495676_0059196 3300047321 Bacteria 3010
384 Ga0495680_0002755 3300047322 Bacteria 17747
385 Ga0495680_0006583 3300047322 Bacteria 10779
386 Ga0495680_0028828 3300047322 Bacteria 4549
387 Ga0495680_0042400 3300047322 Bacteria 3611
388 Ga0495680_0061306 3300047322 Bacteria 2894
389 Ga0495683_0004089 3300047323 Bacteria 8355
390 Ga0495683_0004295 3300047323 Bacteria 8121
391 Ga0495683_0012429 3300047323 Bacteria 4468
392 Ga0495683_0026422 3300047323 Bacteria 2970
393 Ga0495683_0087366 3300047323 Bacteria 1514
394 Ga0495687_039245 3300047443 Bacteria 2096
395 Ga0495687_040489 3300047443 Bacteria 2052
396 Ga0495675_0003869 3300047444 Bacteria 9071
397 Ga0495675_0008761 3300047444 Bacteria 6280
398 Ga0495675_0008875 3300047444 Bacteria 6243
399 Ga0495675_0011837 3300047444 Bacteria 5482
400 Ga0495675_0061691 3300047444 Bacteria 2375
401 Ga0495675_0094302 3300047444 Bacteria 1877
402 Ga0495677_0037436 3300047445 Bacteria 1772
403 Ga0495679_000058 3300047446 Bacteria 110231
404 Ga0495679_003392 3300047446 Bacteria 7675
405 Ga0495679_006166 3300047446 Bacteria 5214
406 Ga0495679_011702 3300047446 Bacteria 3371
407 Ga0495685_060403 3300047447 Bacteria 1278
408 Ga0495673_0007598 3300047469 Bacteria 6206
409 Ga0495673_0071722 3300047469 Bacteria 1455
410 Ga0495681_0096155 3300047470 Bacteria 1301
411 Ga0495684_0008503 3300047471 Bacteria 7951
412 Ga0495684_0118808 3300047471 Bacteria 1992
413 Ga0495686_0049281 3300047472 Bacteria 2651
414 Ga0495686_0141272 3300047472 Bacteria 1421
415 Ga0495593_0003693 3300047673 Bacteria 9139
416 Ga0495593_0018621 3300047673 Bacteria 3901
417 Ga0495593_0018874 3300047673 Bacteria 3869
418 Ga0495602_0004769 3300048088 Bacteria 14179
419 Ga0495602_0009590 3300048088 Bacteria 10063
420 Ga0495602_0025076 3300048088 Bacteria 5777
421 Ga0495602_0027360 3300048088 Bacteria 5479
422 Ga0495602_0150468 3300048088 Bacteria 1830
423 Ga0495614_0001990 3300048089 Bacteria 8988
424 Ga0495614_0004629 3300048089 Bacteria 6196
425 Ga0495614_0018957 3300048089 Bacteria 2979
426 Ga0495626_0051236 3300048091 Bacteria 1904
427 Ga0496100_0000791 3300048903 Bacteria 15063
428 Ga0496100_0062130 3300048903 Bacteria 2464
429 Ga0496100_0090560 3300048903 Bacteria 2086
430 Ga0496101_0005842 3300048904 Bacteria 7871
431 Ga0496101_0269430 3300048904 Bacteria 1329
432 Ga0496101_0555976 3300048904 Bacteria 907
433 Ga0496102_0008235 3300048905 Bacteria 8926
434 Ga0496102_0021040 3300048905 Bacteria 5769
435 Ga0496102_0023086 3300048905 Bacteria 5520
436 Ga0496102_0218932 3300048905 Bacteria 1794
437 Ga0496102_0475546 3300048905 Bacteria 1171
438 Ga0496103_0002256 3300048906 Bacteria 12202
439 Ga0496103_0016291 3300048906 Bacteria 4436
440 Ga0496103_0156785 3300048906 Bacteria 1459
441 Ga0496103_0231124 3300048906 Bacteria 1190
442 Ga0496103_0421782 3300048906 Bacteria 856
443 Ga0496104_0050043 3300048907 Bacteria 3942
444 Ga0496104_0527126 3300048907 Bacteria 1092
445 Ga0496104_0893719 3300048907 Bacteria 793
446 Ga0496104_0997457 3300048907 Bacteria 741
447 Ga0496105_0040038 3300048908 Bacteria 3863
448 Ga0496105_0530145 3300048908 Bacteria 921
449 Ga0496105_0593193 3300048908 Bacteria 860
450 Ga0496106_0074774 3300048909 Bacteria 2594
451 Ga0496106_0312749 3300048909 Bacteria 1260
452 Ga0496108_0430562 3300048911 Bacteria 1152
453 Ga0496112_0011544 3300048915 Bacteria 8074
454 Ga0496112_0443309 3300048915 Bacteria 1236
455 Ga0496112_0481624 3300048915 Bacteria 1177
456 Ga0496112_0554161 3300048915 Bacteria 1083
457 Ga0496113_0024627 3300048916 Bacteria 4280
458 Ga0496114_0001299 3300048917 Bacteria 18897
459 Ga0496114_0312689 3300048917 Bacteria 1388
460 Ga0496115_0025883 3300048918 Bacteria 4572
461 Ga0496115_0036241 3300048918 Bacteria 3905
462 Ga0496115_0047431 3300048918 Bacteria 3436
463 Ga0496115_0362432 3300048918 Bacteria 1181
464 Ga0496116_0085578 3300048919 Bacteria 1937
465 Ga0496117_0002599 3300048920 Bacteria 22450
466 Ga0496117_0010750 3300048920 Bacteria 8273
467 Ga0496117_0013384 3300048920 Bacteria 7161
468 Ga0496117_0019081 3300048920 Bacteria 5648
469 Ga0496117_0106242 3300048920 Bacteria 1762
470 Ga0496117_0188882 3300048920 Bacteria 1176
471 Ga0496117_0265600 3300048920 Bacteria 927
472 Ga0496118_0001593 3300048921 Bacteria 33628
473 Ga0496118_0007293 3300048921 Bacteria 11769
474 Ga0496118_0011356 3300048921 Bacteria 8705
475 Ga0496118_0039775 3300048921 Bacteria 3747
476 Ga0496118_0215300 3300048921 Bacteria 1123
477 Ga0496118_0295962 3300048921 Bacteria 891
478 Ga0496119_0157984 3300048922 Bacteria 1208
479 Ga0496120_0134098 3300048923 Bacteria 1265
480 Ga0496121_0003743 3300048924 Bacteria 21303
481 Ga0496121_0005870 3300048924 Bacteria 15546
482 Ga0496121_0016230 3300048924 Bacteria 7706
483 Ga0496121_0062631 3300048924 Bacteria 3045
484 Ga0496121_0143402 3300048924 Bacteria 1769
485 Ga0496122_0043025 3300048925 Bacteria 3544
486 Ga0496122_0232865 3300048925 Bacteria 1046
487 Ga0496122_0327830 3300048925 Bacteria 810
488 Ga0496123_0088636 3300048926 Bacteria 1847
489 Ga0496123_0163947 3300048926 Bacteria 1181
490 Ga0496124_0219806 3300048927 Bacteria 1430
491 Ga0496124_0455464 3300048927 Bacteria 871
492 Ga0496126_0006662 3300048929 Bacteria 12845
493 Ga0496126_0006962 3300048929 Bacteria 12512
494 Ga0466983_0349147 3300048986 Bacteria 1095
495 Ga0495678_017515 3300049459 Bacteria 3245
496 Ga0495655_0029767 3300053083 Bacteria 1315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0893719 Ga0496104_0893719_18_575 185
2 3300044901 Ga0466960_0358598 Ga0466960_0358598_156_716 186
3 3300046459 Ga0495629_0070929 Ga0495629_0070929_929_1648 193
4 iso_pu_bacteria 2842324504 2842330017 194
5 iso_pu_bacteria 2842348783 2842356255 194
6 iso_pu_bacteria 2842454564 2842457582 194
7 3300003758 Ga0055532_1003330 Ga0055532_10033302 196
8 3300003760 Ga0055527_1003210 Ga0055527_10032104 196
9 3300003761 Ga0055535_1001464 Ga0055535_10014645 196
10 3300003762 Ga0055542_1001437 Ga0055542_10014375 196
11 3300003763 Ga0055529_1000378 Ga0055529_100037831 196
12 3300003790 Ga0055528_1001333 Ga0055528_100133315 196
13 3300003856 Ga0058692_1033103 Ga0058692_10331031 196
14 3300015261 Ga0182006_1085182 Ga0182006_10851822 196
15 3300015262 Ga0182007_10050283 Ga0182007_100502832 196
16 3300025228 Ga0209672_100114 Ga0209672_10011434 196
17 3300025229 Ga0209147_100161 Ga0209147_10016134 196
18 3300025229 Ga0209147_100199 Ga0209147_1001995 196
19 3300025242 Ga0209258_100263 Ga0209258_10026334 196
20 3300025254 Ga0209148_1000630 Ga0209148_100063013 196
21 3300025272 Ga0209455_1000192 Ga0209455_100019234 196
22 3300025273 Ga0209673_1000332 Ga0209673_100033261 196
23 3300025295 Ga0209564_1001581 Ga0209564_10015813 196
24 3300026078 Ga0207702_10905525 Ga0207702_109055251 196
25 3300027312 Ga0209371_1000405 Ga0209371_100040531 196
26 3300030500 Ga0268256_1000345 Ga0268256_100034518 196
27 3300037418 Ga0395900_0745833 Ga0395900_0745833_163_780 196
28 3300037466 Ga0395898_0588290 Ga0395898_0588290_365_982 196
29 3300038443 Ga0395901_0000002 Ga0395901_0000002_705664_706266 196
30 3300044693 Ga0466961_0129382 Ga0466961_0129382_507_1124 196
31 3300046454 Ga0495592_0241592 Ga0495592_0241592_455_1126 197
32 3300046455 Ga0495603_0000924 Ga0495603_0000924_10884_11477 197
33 3300046458 Ga0495591_023789 Ga0495591_023789_1069_1662 197
34 3300046459 Ga0495629_0000774 Ga0495629_0000774_14626_15219 197
35 3300046471 Ga0495650_0002070 Ga0495650_0002070_14713_15306 197
36 3300046472 Ga0495580_0013673 Ga0495580_0013673_3138_3731 197
37 3300046473 Ga0495582_0074739 Ga0495582_0074739_631_1224 197
38 3300046501 Ga0495607_0082747 Ga0495607_0082747_418_1011 197
39 3300046507 Ga0495606_0036166 Ga0495606_0036166_2157_2750 197
40 3300046507 Ga0495606_0225939 Ga0495606_0225939_266_859 197
41 3300046530 Ga0495654_0018564 Ga0495654_0018564_1160_1753 197
42 3300046531 Ga0495665_0022130 Ga0495665_0022130_1497_2090 197
43 3300046543 Ga0495645_0007762 Ga0495645_0007762_3389_3982 197
44 3300046642 Ga0495634_0355193 Ga0495634_0355193_221_814 197
45 3300046674 Ga0495588_0014205 Ga0495588_0014205_752_1345 197
46 3300046679 Ga0495623_0078859 Ga0495623_0078859_355_948 197
47 3300046680 Ga0495646_0082290 Ga0495646_0082290_928_1599 197
48 3300046680 Ga0495646_0107299 Ga0495646_0107299_219_812 197
49 3300046684 Ga0495669_0020892 Ga0495669_0020892_1629_2222 197
50 3300046690 Ga0495624_0303080 Ga0495624_0303080_356_949 197
51 3300046692 Ga0495671_0018661 Ga0495671_0018661_2141_2734 197
52 3300046694 Ga0495649_0008350 Ga0495649_0008350_4187_4780 197
53 3300046809 Ga0495600_0082481 Ga0495600_0082481_1017_1610 197
54 3300047315 Ga0495581_0001974 Ga0495581_0001974_9210_9803 197
55 3300047323 Ga0495683_0012429 Ga0495683_0012429_831_1424 197
56 3300047444 Ga0495675_0061691 Ga0495675_0061691_641_1234 197
57 3300047673 Ga0495593_0018621 Ga0495593_0018621_2805_3398 197
58 3300048088 Ga0495602_0004769 Ga0495602_0004769_7463_8134 197
59 3300048089 Ga0495614_0018957 Ga0495614_0018957_762_1355 197
60 3300048903 Ga0496100_0090560 Ga0496100_0090560_990_1583 197
61 3300048907 Ga0496104_0527126 Ga0496104_0527126_267_860 197
62 3300048911 Ga0496108_0430562 Ga0496108_0430562_261_854 197
63 3300048917 Ga0496114_0001299 Ga0496114_0001299_3492_4085 197
64 3300048918 Ga0496115_0025883 Ga0496115_0025883_947_1540 197
65 3300031548 Ga0307408_100002981 Ga0307408_1000029814 198
66 3300031911 Ga0307412_10160063 Ga0307412_101600633 198
67 3300032002 Ga0307416_100099641 Ga0307416_1000996412 198
68 3300046471 Ga0495650_0004418 Ga0495650_0004418_4812_5417 198
69 3300046472 Ga0495580_0006304 Ga0495580_0006304_4871_5476 198
70 3300048905 Ga0496102_0021040 Ga0496102_0021040_1979_2638 198
71 3300048906 Ga0496103_0016291 Ga0496103_0016291_2107_2766 198
72 3300048920 Ga0496117_0010750 Ga0496117_0010750_4193_4852 198
73 3300048921 Ga0496118_0007293 Ga0496118_0007293_7499_8158 198
74 3300046507 Ga0495606_0311932 Ga0495606_0311932_218_832 199
75 3300047472 Ga0495686_0141272 Ga0495686_0141272_405_1013 199
76 iso_pu_bacteria 2599185239 2599738391 199
77 iso_pu_bacteria 2818991452 2819633482 199
78 iso_pu_bacteria 2928170801 2928174844 199
79 iso_pu_bacteria 8021120328 8021125227 199
80 3300047319 Ga0495674_0022346 Ga0495674_0022346_10_627 200
81 iso_pu_bacteria 2513237166 2514048565 200
82 iso_pu_bacteria 2515154123 2515688814 200
83 iso_pu_bacteria 2526164713 2527077127 200
84 iso_pu_bacteria 2562617112 2563062511 200
85 iso_pu_bacteria 2599185240 2599746516 200
86 iso_pu_bacteria 2599185355 2600208422 200
87 iso_pu_bacteria 2675903129 2676745382 200
88 iso_pu_bacteria 2711768613 2713477631 200
89 iso_pu_bacteria 2734482258 2735816873 200
90 iso_pu_bacteria 2738541296 2738823293 200
91 iso_pu_bacteria 2738541298 2738835605 200
92 iso_pu_bacteria 2738541306 2738877214 200
93 iso_pu_bacteria 2738543002 2739188920 200
94 iso_pu_bacteria 2738543008 2739223807 200
95 iso_pu_bacteria 2791355137 2792833782 200
96 iso_pu_bacteria 2863421361 2863425657 200
97 iso_pu_bacteria 2900634093 2900635659 200
98 iso_pu_bacteria 2904564687 2904569862 200
99 iso_pu_bacteria 2904571731 2904577118 200
100 iso_pu_bacteria 2904615490 2904619724 200
101 iso_pu_bacteria 2921643360 2921654106 200
102 iso_pu_bacteria 2928108538 2928113122 200
103 iso_pu_bacteria 2928135762 2928140281 200
104 iso_pu_bacteria 2928157003 2928161601 200
105 iso_pu_bacteria 2928163908 2928168429 200
106 iso_pu_bacteria 2928503688 2928507840 200
107 iso_pu_bacteria 2928536128 2928542432 200
108 iso_pu_bacteria 2945934425 2945936106 200
109 iso_pu_bacteria 2981990288 2981993589 200
110 iso_pu_bacteria 2990703756 2990709992 200
111 iso_pu_bacteria 641736151 642422530 200
112 iso_pu_bacteria 641736154 642419010 200
113 iso_pu_bacteria 642555112 642593828 200
114 iso_pu_bacteria 642555113 642620876 200
115 iso_pu_bacteria 8018845410 8018850851 200
116 iso_pu_bacteria 8020938398 8020941020 200
117 iso_pu_bacteria 8020945358 8020952381 200
118 iso_pu_bacteria 8020953355 8020958272 200
119 iso_pu_bacteria 8039098773 8039103528 200
120 3300003323 rootH1_10016303 rootH1_100163032 201
121 3300037418 Ga0395900_0000635 Ga0395900_0000635_38051_38668 201
122 3300037418 Ga0395900_0121152 Ga0395900_0121152_770_1387 201
123 3300037418 Ga0395900_0302667 Ga0395900_0302667_941_1558 201
124 3300037466 Ga0395898_0001892 Ga0395898_0001892_7620_8237 201
125 3300038443 Ga0395901_0000079 Ga0395901_0000079_125412_126029 201
126 3300038443 Ga0395901_0062632 Ga0395901_0062632_1407_2024 201
127 3300038443 Ga0395901_0204575 Ga0395901_0204575_35_652 201
128 3300044684 Ga0466966_0003017 Ga0466966_0003017_7565_8182 201
129 3300044693 Ga0466961_0323240 Ga0466961_0323240_222_848 201
130 3300044694 Ga0466963_0001909 Ga0466963_0001909_2720_3337 201
131 3300044719 Ga0466971_0005454 Ga0466971_0005454_252_869 201
132 3300045836 Ga0466958_0087205 Ga0466958_0087205_1009_1626 201
133 3300046507 Ga0495606_0014784 Ga0495606_0014784_4294_5016 201
134 3300046694 Ga0495649_0106574 Ga0495649_0106574_132_854 201
135 3300046794 Ga0495589_0199897 Ga0495589_0199897_11_634 201
136 3300047323 Ga0495683_0004295 Ga0495683_0004295_3109_3831 201
137 3300047443 Ga0495687_040489 Ga0495687_040489_821_1432 201
138 iso_pu_bacteria 2870068957 2870070666 201
139 3300003320 rootH2_10144662 rootH2_101446622 202
140 3300003322 rootL2_10000506 rootL2_100005062 202
141 3300003354 JGI25160J50197_1001398 JGI25160J50197_10013988 202
142 3300003756 Ga0055533_1012563 Ga0055533_10125631 202
143 3300003841 Ga0055541_1009614 Ga0055541_10096142 202
144 3300005262 Ga0065165_1001568 Ga0065165_100156819 202
145 3300005455 Ga0070663_100261746 Ga0070663_1002617462 202
146 3300009093 Ga0105240_10123051 Ga0105240_101230512 202
147 3300009098 Ga0105245_10750232 Ga0105245_107502322 202
148 3300025225 Ga0209566_101237 Ga0209566_1012376 202
149 3300025226 Ga0209674_110403 Ga0209674_1104032 202
150 3300025284 Ga0209130_1014437 Ga0209130_10144372 202
151 3300025302 Ga0207426_1000168 Ga0207426_1000168138 202
152 3300037471 Ga0395905_0000012 Ga0395905_0000012_13526_14161 202
153 3300046455 Ga0495603_0017279 Ga0495603_0017279_1693_2328 202
154 3300046472 Ga0495580_0008325 Ga0495580_0008325_5809_6444 202
155 3300046474 Ga0495605_0076797 Ga0495605_0076797_658_1293 202
156 3300046491 Ga0495584_0219195 Ga0495584_0219195_95_730 202
157 3300046500 Ga0495596_0057556 Ga0495596_0057556_366_1085 202
158 3300046506 Ga0495583_0016365 Ga0495583_0016365_2933_3568 202
159 3300046513 Ga0495616_0058182 Ga0495616_0058182_987_1622 202
160 3300046524 Ga0495648_0055509 Ga0495648_0055509_247_882 202
161 3300046526 Ga0495666_0062031 Ga0495666_0062031_647_1282 202
162 3300046531 Ga0495665_0310442 Ga0495665_0310442_132_767 202
163 3300046557 Ga0495622_0066779 Ga0495622_0066779_891_1526 202
164 3300046648 Ga0495611_0031701 Ga0495611_0031701_906_1541 202
165 3300046794 Ga0495589_0096473 Ga0495589_0096473_51_686 202
166 3300047319 Ga0495674_0008236 Ga0495674_0008236_7282_7917 202
167 3300047319 Ga0495674_0079383 Ga0495674_0079383_1490_2185 202
168 3300047320 Ga0495672_0098823 Ga0495672_0098823_580_1215 202
169 3300047445 Ga0495677_0037436 Ga0495677_0037436_415_1050 202
170 3300048903 Ga0496100_0000791 Ga0496100_0000791_5801_6436 202
171 3300048904 Ga0496101_0005842 Ga0496101_0005842_2527_3162 202
172 3300048905 Ga0496102_0008235 Ga0496102_0008235_5754_6389 202
173 3300048906 Ga0496103_0002256 Ga0496103_0002256_2937_3572 202
174 3300048907 Ga0496104_0050043 Ga0496104_0050043_3086_3721 202
175 3300048908 Ga0496105_0040038 Ga0496105_0040038_2487_3122 202
176 3300048908 Ga0496105_0530145 Ga0496105_0530145_187_822 202
177 3300048909 Ga0496106_0074774 Ga0496106_0074774_217_852 202
178 3300048915 Ga0496112_0011544 Ga0496112_0011544_5802_6437 202
179 3300048915 Ga0496112_0554161 Ga0496112_0554161_402_1037 202
180 3300048916 Ga0496113_0024627 Ga0496113_0024627_1212_1847 202
181 3300048918 Ga0496115_0047431 Ga0496115_0047431_721_1356 202
182 3300048918 Ga0496115_0362432 Ga0496115_0362432_106_801 202
183 3300048920 Ga0496117_0002599 Ga0496117_0002599_19278_19913 202
184 3300048921 Ga0496118_0011356 Ga0496118_0011356_2409_3044 202
185 3300048922 Ga0496119_0157984 Ga0496119_0157984_33_668 202
186 3300048923 Ga0496120_0134098 Ga0496120_0134098_406_1041 202
187 3300048924 Ga0496121_0003743 Ga0496121_0003743_6003_6638 202
188 3300048924 Ga0496121_0016230 Ga0496121_0016230_5543_6178 202
189 3300048925 Ga0496122_0043025 Ga0496122_0043025_2445_3080 202
190 3300048927 Ga0496124_0219806 Ga0496124_0219806_642_1277 202
191 iso_pu_bacteria 2510065045 2510250468 202
192 iso_pu_bacteria 2512047030 2512347995 202
193 iso_pu_bacteria 2515154122 2515678996 202
194 iso_pu_bacteria 2718217991 2719639616 202
195 iso_pu_bacteria 2751185846 2753568025 202
196 iso_pu_bacteria 2818991450 2819622249 202
197 iso_pu_bacteria 2885270888 2885273159 202
198 iso_pu_bacteria 2902682994 2902683002 202
199 3300002705 JGI25156J39149_1002658 JGI25156J39149_10026584 203
200 3300003758 Ga0055532_1000764 Ga0055532_10007645 203
201 3300003758 Ga0055532_1003316 Ga0055532_10033162 203
202 3300003760 Ga0055527_1000596 Ga0055527_10005965 203
203 3300003761 Ga0055535_1001470 Ga0055535_10014705 203
204 3300003762 Ga0055542_1001771 Ga0055542_10017715 203
205 3300003763 Ga0055529_1003123 Ga0055529_10031234 203
206 3300005339 Ga0070660_100000045 Ga0070660_10000004534 203
207 3300005366 Ga0070659_100000069 Ga0070659_10000006921 203
208 3300005455 Ga0070663_100084874 Ga0070663_1000848742 203
209 3300005563 Ga0068855_100261509 Ga0068855_1002615092 203
210 3300005564 Ga0070664_100192463 Ga0070664_1001924632 203
211 3300005616 Ga0068852_100062860 Ga0068852_1000628604 203
212 3300009092 Ga0105250_10010724 Ga0105250_100107242 203
213 3300009093 Ga0105240_10006999 Ga0105240_1000699911 203
214 3300009093 Ga0105240_10060794 Ga0105240_100607942 203
215 3300009545 Ga0105237_10087138 Ga0105237_100871383 203
216 3300009551 Ga0105238_10054313 Ga0105238_100543132 203
217 3300010375 Ga0105239_10002651 Ga0105239_100026512 203
218 3300013104 Ga0157370_10291969 Ga0157370_102919692 203
219 3300015261 Ga0182006_1021318 Ga0182006_10213182 203
220 3300016635 Ga0183361_10010 Ga0183361_10010142 203
221 3300025228 Ga0209672_100033 Ga0209672_10003360 203
222 3300025229 Ga0209147_100168 Ga0209147_10016873 203
223 3300025242 Ga0209258_100100 Ga0209258_10010060 203
224 3300025254 Ga0209148_1001267 Ga0209148_100126711 203
225 3300025256 Ga0209759_1000250 Ga0209759_100025070 203
226 3300025256 Ga0209759_1002552 Ga0209759_10025528 203
227 3300025272 Ga0209455_1002064 Ga0209455_10020645 203
228 3300025904 Ga0207647_10000590 Ga0207647_1000059010 203
229 3300025909 Ga0207705_10542494 Ga0207705_105424942 203
230 3300025913 Ga0207695_10004347 Ga0207695_1000434715 203
231 3300025913 Ga0207695_10036589 Ga0207695_100365893 203
232 3300025914 Ga0207671_10301082 Ga0207671_103010821 203
233 3300025919 Ga0207657_10000068 Ga0207657_1000006860 203
234 3300025932 Ga0207690_10000027 Ga0207690_1000002760 203
235 3300025945 Ga0207679_10176225 Ga0207679_101762252 203
236 3300026067 Ga0207678_10000386 Ga0207678_1000038616 203
237 3300026142 Ga0207698_10019463 Ga0207698_100194631 203
238 3300037312 Ga0395899_0041605 Ga0395899_0041605_31_675 203
239 3300037418 Ga0395900_0056050 Ga0395900_0056050_35_679 203
240 3300039447 Ga0436361_0723959 Ga0436361_0723959_2836_3465 203
241 3300044684 Ga0466966_0378589 Ga0466966_0378589_106_723 203
242 3300044719 Ga0466971_0271204 Ga0466971_0271204_27_644 203
243 3300046462 Ga0495651_0066028 Ga0495651_0066028_714_1367 203
244 3300046678 Ga0495599_0140630 Ga0495599_0140630_528_1181 203
245 3300046679 Ga0495623_0002534 Ga0495623_0002534_1376_2029 203
246 3300047317 Ga0495604_0005312 Ga0495604_0005312_4313_4966 203
247 3300047322 Ga0495680_0061306 Ga0495680_0061306_1596_2249 203
248 3300047444 Ga0495675_0011837 Ga0495675_0011837_1990_2643 203
249 3300048088 Ga0495602_0009590 Ga0495602_0009590_8479_9132 203
250 3300048904 Ga0496101_0269430 Ga0496101_0269430_452_1069 203
251 3300048905 Ga0496102_0475546 Ga0496102_0475546_406_1023 203
252 3300048907 Ga0496104_0997457 Ga0496104_0997457_103_720 203
253 3300048908 Ga0496105_0593193 Ga0496105_0593193_57_674 203
254 3300048915 Ga0496112_0443309 Ga0496112_0443309_50_667 203
255 3300048915 Ga0496112_0481624 Ga0496112_0481624_474_1091 203
256 3300048919 Ga0496116_0085578 Ga0496116_0085578_160_777 203
257 3300048920 Ga0496117_0106242 Ga0496117_0106242_864_1481 203
258 3300048920 Ga0496117_0265600 Ga0496117_0265600_83_700 203
259 3300048921 Ga0496118_0215300 Ga0496118_0215300_227_844 203
260 3300048924 Ga0496121_0143402 Ga0496121_0143402_579_1196 203
261 3300048925 Ga0496122_0327830 Ga0496122_0327830_53_670 203
262 3300048926 Ga0496123_0163947 Ga0496123_0163947_478_1095 203
263 3300048927 Ga0496124_0455464 Ga0496124_0455464_67_684 203
264 3300048986 Ga0466983_0349147 Ga0466983_0349147_185_802 203
265 iso_pu_bacteria 8055266321 8055271397 203
266 3300001989 JGI24739J22299_10027392 JGI24739J22299_100273923 204
267 3300001990 JGI24737J22298_10064811 JGI24737J22298_100648111 204
268 3300002067 JGI24735J21928_10027698 JGI24735J21928_100276983 204
269 3300002075 JGI24738J21930_10011286 JGI24738J21930_100112862 204
270 3300002705 JGI25156J39149_1007191 JGI25156J39149_10071913 204
271 3300013105 Ga0157369_10173413 Ga0157369_101734133 204
272 3300014497 Ga0182008_10074420 Ga0182008_100744202 204
273 3300025226 Ga0209674_100174 Ga0209674_10017412 204
274 3300025256 Ga0209759_1001096 Ga0209759_100109615 204
275 3300025904 Ga0207647_10047469 Ga0207647_100474692 204
276 3300027312 Ga0209371_1013475 Ga0209371_10134753 204
277 3300030500 Ga0268256_1014857 Ga0268256_10148571 204
278 3300031911 Ga0307412_10000005 Ga0307412_10000005413 204
279 3300044668 Ga0466980_0079820 Ga0466980_0079820_42_656 204
280 3300044693 Ga0466961_0004320 Ga0466961_0004320_6449_7063 204
281 3300044842 Ga0466957_0248295 Ga0466957_0248295_334_957 204
282 3300045049 Ga0466959_0001316 Ga0466959_0001316_6219_6833 204
283 3300046455 Ga0495603_0011446 Ga0495603_0011446_3383_4030 204
284 3300046457 Ga0495590_0086144 Ga0495590_0086144_335_1015 204
285 3300046459 Ga0495629_0004019 Ga0495629_0004019_3679_4326 204
286 3300046461 Ga0495641_0017923 Ga0495641_0017923_50_697 204
287 3300046463 Ga0495653_0004233 Ga0495653_0004233_3327_3974 204
288 3300046463 Ga0495653_0267064 Ga0495653_0267064_46_705 204
289 3300046472 Ga0495580_0004862 Ga0495580_0004862_3065_3712 204
290 3300046473 Ga0495582_0001203 Ga0495582_0001203_8061_8708 204
291 3300046474 Ga0495605_0015930 Ga0495605_0015930_2714_3394 204
292 3300046476 Ga0495662_0009608 Ga0495662_0009608_2352_2999 204
293 3300046477 Ga0495664_0002334 Ga0495664_0002334_7700_8347 204
294 3300046500 Ga0495596_0087988 Ga0495596_0087988_402_1079 204
295 3300046512 Ga0495610_0001665 Ga0495610_0001665_16110_16790 204
296 3300046514 Ga0495618_0007713 Ga0495618_0007713_3385_4032 204
297 3300046516 Ga0495628_0020834 Ga0495628_0020834_3287_3934 204
298 3300046517 Ga0495630_0061103 Ga0495630_0061103_2108_2755 204
299 3300046524 Ga0495648_0004213 Ga0495648_0004213_6578_7225 204
300 3300046524 Ga0495648_0021495 Ga0495648_0021495_3654_4301 204
301 3300046526 Ga0495666_0002079 Ga0495666_0002079_2904_3551 204
302 3300046529 Ga0495652_0090905 Ga0495652_0090905_715_1362 204
303 3300046531 Ga0495665_0006149 Ga0495665_0006149_2764_3411 204
304 3300046533 Ga0495640_0072185 Ga0495640_0072185_769_1416 204
305 3300046536 Ga0495587_0007703 Ga0495587_0007703_4486_5133 204
306 3300046543 Ga0495645_0003525 Ga0495645_0003525_6039_6686 204
307 3300046642 Ga0495634_0004538 Ga0495634_0004538_4502_5149 204
308 3300046660 Ga0495625_0379854 Ga0495625_0379854_61_741 204
309 3300046663 Ga0495635_0044987 Ga0495635_0044987_932_1579 204
310 3300046665 Ga0495661_0004501 Ga0495661_0004501_6368_7015 204
311 3300046674 Ga0495588_0014120 Ga0495588_0014120_2100_2747 204
312 3300046678 Ga0495599_0050779 Ga0495599_0050779_1092_1739 204
313 3300046679 Ga0495623_0016504 Ga0495623_0016504_1669_2316 204
314 3300046680 Ga0495646_0012975 Ga0495646_0012975_2955_3602 204
315 3300046689 Ga0495613_0014182 Ga0495613_0014182_3571_4218 204
316 3300046690 Ga0495624_0048299 Ga0495624_0048299_715_1362 204
317 3300047315 Ga0495581_0004018 Ga0495581_0004018_1263_1910 204
318 3300047317 Ga0495604_0008280 Ga0495604_0008280_5468_6115 204
319 3300047319 Ga0495674_0028891 Ga0495674_0028891_1955_2602 204
320 3300047321 Ga0495676_0005710 Ga0495676_0005710_6288_6935 204
321 3300047322 Ga0495680_0006583 Ga0495680_0006583_7068_7715 204
322 3300047323 Ga0495683_0087366 Ga0495683_0087366_176_856 204
323 3300047443 Ga0495687_039245 Ga0495687_039245_97_777 204
324 3300047444 Ga0495675_0008875 Ga0495675_0008875_3489_4136 204
325 3300047446 Ga0495679_003392 Ga0495679_003392_4579_5226 204
326 3300047446 Ga0495679_011702 Ga0495679_011702_32_679 204
327 3300047470 Ga0495681_0096155 Ga0495681_0096155_423_1070 204
328 3300047471 Ga0495684_0008503 Ga0495684_0008503_3125_3772 204
329 3300048088 Ga0495602_0027360 Ga0495602_0027360_3901_4548 204
330 3300048089 Ga0495614_0004629 Ga0495614_0004629_1458_2105 204
331 3300048920 Ga0496117_0013384 Ga0496117_0013384_3581_4261 204
332 3300048921 Ga0496118_0295962 Ga0496118_0295962_35_715 204
333 3300053083 Ga0495655_0029767 Ga0495655_0029767_479_1126 204
334 iso_pu_bacteria 2508501125 2509130389 204
335 iso_pu_bacteria 2513237151 2513963205 204
336 iso_pu_bacteria 2519103095 2519459345 204
337 iso_pu_bacteria 2582581311 2585294261 204
338 iso_pu_bacteria 2600255067 2600813028 204
339 iso_pu_bacteria 2744054900 2746091817 204
340 iso_pu_bacteria 2744054901 2746097077 204
341 iso_pu_bacteria 2816332253 2817261632 204
342 iso_pu_bacteria 2816332256 2817279314 204
343 iso_pu_bacteria 2816332286 2817454487 204
344 iso_pu_bacteria 8020807995 8020810031 204
345 iso_pu_bacteria 8040167225 8040170375 204
346 iso_pu_bacteria 8040173305 8040175829 204
347 3300002705 JGI25156J39149_1025774 JGI25156J39149_10257741 205
348 3300005335 Ga0070666_10034521 Ga0070666_100345212 205
349 3300009093 Ga0105240_10009057 Ga0105240_1000905714 205
350 3300009545 Ga0105237_10015869 Ga0105237_100158696 205
351 3300010375 Ga0105239_10001236 Ga0105239_100012369 205
352 3300013100 Ga0157373_10004810 Ga0157373_100048106 205
353 3300013105 Ga0157369_10000915 Ga0157369_100009154 205
354 3300013296 Ga0157374_10000318 Ga0157374_1000031832 205
355 3300013297 Ga0157378_10434723 Ga0157378_104347232 205
356 3300013306 Ga0163162_10006007 Ga0163162_1000600712 205
357 3300013307 Ga0157372_10029152 Ga0157372_100291523 205
358 3300025256 Ga0209759_1000690 Ga0209759_100069017 205
359 3300025903 Ga0207680_10067424 Ga0207680_100674242 205
360 3300037312 Ga0395899_0000038 Ga0395899_0000038_55040_55702 205
361 3300037418 Ga0395900_0000030 Ga0395900_0000030_216929_217591 205
362 3300037418 Ga0395900_0115375 Ga0395900_0115375_1127_1744 205
363 3300037466 Ga0395898_0000409 Ga0395898_0000409_77390_78052 205
364 3300037466 Ga0395898_0043167 Ga0395898_0043167_1158_1775 205
365 3300038443 Ga0395901_0425537 Ga0395901_0425537_10_627 205
366 3300042005 Ga0439448_0001158 Ga0439448_0001158_4684_5301 205
367 3300046454 Ga0495592_0012309 Ga0495592_0012309_3711_4370 205
368 3300046458 Ga0495591_001281 Ga0495591_001281_6764_7423 205
369 3300046458 Ga0495591_064372 Ga0495591_064372_24_665 205
370 3300046460 Ga0495638_0004983 Ga0495638_0004983_8149_8790 205
371 3300046462 Ga0495651_0001916 Ga0495651_0001916_6677_7336 205
372 3300046463 Ga0495653_0005707 Ga0495653_0005707_7441_8082 205
373 3300046471 Ga0495650_0021878 Ga0495650_0021878_263_904 205
374 3300046471 Ga0495650_0058035 Ga0495650_0058035_908_1549 205
375 3300046472 Ga0495580_0004489 Ga0495580_0004489_1939_2574 205
376 3300046473 Ga0495582_0011161 Ga0495582_0011161_989_1630 205
377 3300046474 Ga0495605_0005788 Ga0495605_0005788_5664_6305 205
378 3300046474 Ga0495605_0014812 Ga0495605_0014812_1676_2317 205
379 3300046477 Ga0495664_0069169 Ga0495664_0069169_249_908 205
380 3300046491 Ga0495584_0182575 Ga0495584_0182575_238_879 205
381 3300046499 Ga0495594_0422801 Ga0495594_0422801_65_706 205
382 3300046500 Ga0495596_0041805 Ga0495596_0041805_618_1259 205
383 3300046501 Ga0495607_0032552 Ga0495607_0032552_528_1169 205
384 3300046506 Ga0495583_0001558 Ga0495583_0001558_12750_13391 205
385 3300046507 Ga0495606_0011910 Ga0495606_0011910_680_1321 205
386 3300046507 Ga0495606_0136546 Ga0495606_0136546_101_760 205
387 3300046511 Ga0495608_0004868 Ga0495608_0004868_4079_4738 205
388 3300046514 Ga0495618_0021793 Ga0495618_0021793_2145_2804 205
389 3300046514 Ga0495618_0136477 Ga0495618_0136477_292_933 205
390 3300046515 Ga0495620_0016949 Ga0495620_0016949_722_1363 205
391 3300046516 Ga0495628_0009663 Ga0495628_0009663_1430_2071 205
392 3300046516 Ga0495628_0021567 Ga0495628_0021567_1811_2446 205
393 3300046517 Ga0495630_0033169 Ga0495630_0033169_1938_2579 205
394 3300046517 Ga0495630_0145157 Ga0495630_0145157_189_824 205
395 3300046524 Ga0495648_0142439 Ga0495648_0142439_204_845 205
396 3300046524 Ga0495648_0189858 Ga0495648_0189858_329_970 205
397 3300046526 Ga0495666_0003565 Ga0495666_0003565_4420_5079 205
398 3300046526 Ga0495666_0005638 Ga0495666_0005638_1096_1731 205
399 3300046528 Ga0495642_0171655 Ga0495642_0171655_256_897 205
400 3300046529 Ga0495652_0027450 Ga0495652_0027450_4152_4811 205
401 3300046529 Ga0495652_0150921 Ga0495652_0150921_839_1474 205
402 3300046531 Ga0495665_0010276 Ga0495665_0010276_2156_2815 205
403 3300046531 Ga0495665_0037670 Ga0495665_0037670_422_1063 205
404 3300046533 Ga0495640_0004697 Ga0495640_0004697_3920_4579 205
405 3300046535 Ga0495586_0323470 Ga0495586_0323470_93_734 205
406 3300046542 Ga0495597_0175800 Ga0495597_0175800_44_685 205
407 3300046543 Ga0495645_0225261 Ga0495645_0225261_267_926 205
408 3300046557 Ga0495622_0000854 Ga0495622_0000854_8580_9251 205
409 3300046660 Ga0495625_0052535 Ga0495625_0052535_950_1591 205
410 3300046663 Ga0495635_0003384 Ga0495635_0003384_4636_5295 205
411 3300046663 Ga0495635_0615629 Ga0495635_0615629_10_651 205
412 3300046665 Ga0495661_0006145 Ga0495661_0006145_5672_6331 205
413 3300046665 Ga0495661_0009109 Ga0495661_0009109_5820_6461 205
414 3300046678 Ga0495599_0094145 Ga0495599_0094145_321_956 205
415 3300046680 Ga0495646_0005753 Ga0495646_0005753_5065_5724 205
416 3300046689 Ga0495613_0041942 Ga0495613_0041942_2501_3142 205
417 3300046690 Ga0495624_0002531 Ga0495624_0002531_11103_11744 205
418 3300046690 Ga0495624_0013045 Ga0495624_0013045_4289_4924 205
419 3300046690 Ga0495624_0283247 Ga0495624_0283247_205_864 205
420 3300046691 Ga0495670_0047586 Ga0495670_0047586_450_1091 205
421 3300046692 Ga0495671_0024994 Ga0495671_0024994_2010_2651 205
422 3300046692 Ga0495671_0077998 Ga0495671_0077998_889_1530 205
423 3300046794 Ga0495589_0002930 Ga0495589_0002930_4357_5016 205
424 3300046794 Ga0495589_0026608 Ga0495589_0026608_526_1167 205
425 3300046809 Ga0495600_0012661 Ga0495600_0012661_3598_4257 205
426 3300047315 Ga0495581_0074408 Ga0495581_0074408_1053_1712 205
427 3300047317 Ga0495604_0022815 Ga0495604_0022815_4340_4975 205
428 3300047319 Ga0495674_0075251 Ga0495674_0075251_1043_1702 205
429 3300047319 Ga0495674_0123657 Ga0495674_0123657_1431_2072 205
430 3300047319 Ga0495674_0123659 Ga0495674_0123659_113_754 205
431 3300047321 Ga0495676_0059196 Ga0495676_0059196_2055_2714 205
432 3300047322 Ga0495680_0028828 Ga0495680_0028828_1228_1887 205
433 3300047322 Ga0495680_0042400 Ga0495680_0042400_971_1606 205
434 3300047323 Ga0495683_0004089 Ga0495683_0004089_148_807 205
435 3300047323 Ga0495683_0026422 Ga0495683_0026422_1766_2407 205
436 3300047444 Ga0495675_0008761 Ga0495675_0008761_23_682 205
437 3300047444 Ga0495675_0094302 Ga0495675_0094302_974_1609 205
438 3300047446 Ga0495679_000058 Ga0495679_000058_10246_10887 205
439 3300047446 Ga0495679_006166 Ga0495679_006166_1735_2394 205
440 3300047447 Ga0495685_060403 Ga0495685_060403_220_861 205
441 3300047469 Ga0495673_0007598 Ga0495673_0007598_4606_5265 205
442 3300047469 Ga0495673_0071722 Ga0495673_0071722_507_1148 205
443 3300047472 Ga0495686_0049281 Ga0495686_0049281_374_1015 205
444 3300047673 Ga0495593_0003693 Ga0495593_0003693_5238_5879 205
445 3300048088 Ga0495602_0150468 Ga0495602_0150468_278_913 205
446 3300048089 Ga0495614_0001990 Ga0495614_0001990_6185_6844 205
447 3300048091 Ga0495626_0051236 Ga0495626_0051236_91_732 205
448 3300048903 Ga0496100_0062130 Ga0496100_0062130_1598_2239 205
449 3300048904 Ga0496101_0555976 Ga0496101_0555976_152_793 205
450 3300048905 Ga0496102_0023086 Ga0496102_0023086_1582_2223 205
451 3300048905 Ga0496102_0218932 Ga0496102_0218932_921_1562 205
452 3300048906 Ga0496103_0156785 Ga0496103_0156785_289_930 205
453 3300048906 Ga0496103_0421782 Ga0496103_0421782_37_678 205
454 3300048909 Ga0496106_0312749 Ga0496106_0312749_466_1107 205
455 3300048917 Ga0496114_0312689 Ga0496114_0312689_736_1377 205
456 3300048918 Ga0496115_0036241 Ga0496115_0036241_2419_3060 205
457 3300048920 Ga0496117_0019081 Ga0496117_0019081_485_1126 205
458 3300048921 Ga0496118_0039775 Ga0496118_0039775_1925_2566 205
459 3300048924 Ga0496121_0005870 Ga0496121_0005870_2441_3088 205
460 3300048924 Ga0496121_0062631 Ga0496121_0062631_348_989 205
461 3300048929 Ga0496126_0006662 Ga0496126_0006662_5942_6589 205
462 3300048929 Ga0496126_0006962 Ga0496126_0006962_10992_11627 205
463 3300049459 Ga0495678_017515 Ga0495678_017515_1301_1942 205
464 3300001989 JGI24739J22299_10019408 JGI24739J22299_100194083 206
465 3300001990 JGI24737J22298_10080417 JGI24737J22298_100804172 206
466 3300003214 JGI25165J46597_1001112 JGI25165J46597_100111213 206
467 3300005367 Ga0070667_100098377 Ga0070667_1000983772 206
468 3300009011 Ga0105251_10000613 Ga0105251_1000061322 206
469 3300013102 Ga0157371_10077746 Ga0157371_100777463 206
470 3300013104 Ga0157370_10251875 Ga0157370_102518752 206
471 3300013105 Ga0157369_10001268 Ga0157369_1000126827 206
472 3300013105 Ga0157369_10004199 Ga0157369_100041999 206
473 3300013307 Ga0157372_10149106 Ga0157372_101491063 206
474 3300014497 Ga0182008_10351219 Ga0182008_103512191 206
475 3300015262 Ga0182007_10019572 Ga0182007_100195722 206
476 3300022467 Ga0224712_10000188 Ga0224712_100001884 206
477 3300025261 Ga0209233_1000171 Ga0209233_100017167 206
478 3300025735 Ga0207713_1000221 Ga0207713_100022110 206
479 3300025904 Ga0207647_10028180 Ga0207647_100281802 206
480 3300037312 Ga0395899_0009113 Ga0395899_0009113_451_1143 206
481 3300048906 Ga0496103_0231124 Ga0496103_0231124_488_1135 206
482 3300048920 Ga0496117_0188882 Ga0496117_0188882_132_779 206
483 3300048921 Ga0496118_0001593 Ga0496118_0001593_11075_11722 206
484 3300048925 Ga0496122_0232865 Ga0496122_0232865_291_1031 206
485 3300048926 Ga0496123_0088636 Ga0496123_0088636_1075_1809 206
486 iso_pu_bacteria 8055301274 8055306105 206
487 3300044656 Ga0466969_0056006 Ga0466969_0056006_921_1601 207
488 3300044683 Ga0466965_0009422 Ga0466965_0009422_882_1562 207
489 3300044735 Ga0466968_0011694 Ga0466968_0011694_261_941 207
490 3300045049 Ga0466959_0021478 Ga0466959_0021478_2228_2908 207
491 3300045836 Ga0466958_0056037 Ga0466958_0056037_878_1558 207
492 iso_pu_bacteria 2904483920 2904487198 207
493 iso_pu_bacteria 2919527303 2919528504 207
494 3300003756 Ga0055533_1000415 Ga0055533_10004154 208
495 3300003758 Ga0055532_1000063 Ga0055532_100006368 208
496 3300003760 Ga0055527_1000049 Ga0055527_100004938 208
497 3300003761 Ga0055535_1000042 Ga0055535_100004268 208
498 3300003762 Ga0055542_1000071 Ga0055542_100007168 208
499 3300003763 Ga0055529_1000081 Ga0055529_100008168 208
500 3300005327 Ga0070658_10010842 Ga0070658_100108429 208
501 3300005563 Ga0068855_100012359 Ga0068855_10001235910 208
502 3300009011 Ga0105251_10121131 Ga0105251_101211312 208
503 3300009093 Ga0105240_10068460 Ga0105240_100684603 208
504 3300013104 Ga0157370_10001406 Ga0157370_1000140613 208
505 3300025226 Ga0209674_100013 Ga0209674_10001332 208
506 3300025228 Ga0209672_100010 Ga0209672_10001068 208
507 3300025229 Ga0209147_100006 Ga0209147_10000668 208
508 3300025230 Ga0209563_106181 Ga0209563_1061811 208
509 3300025242 Ga0209258_100010 Ga0209258_10001068 208
510 3300025254 Ga0209148_1000018 Ga0209148_100001868 208
511 3300025272 Ga0209455_1000015 Ga0209455_100001568 208
512 3300025904 Ga0207647_10022276 Ga0207647_100222763 208
513 3300025909 Ga0207705_10010221 Ga0207705_100102218 208
514 3300025949 Ga0207667_10010187 Ga0207667_1001018713 208
515 3300038443 Ga0395901_0000417 Ga0395901_0000417_17095_17784 208
516 3300044656 Ga0466969_0024770 Ga0466969_0024770_1517_2176 208
517 3300044659 Ga0466973_0042623 Ga0466973_0042623_2597_3256 208
518 3300044683 Ga0466965_0000552 Ga0466965_0000552_2624_3283 208
519 3300044684 Ga0466966_0005413 Ga0466966_0005413_581_1240 208
520 3300044693 Ga0466961_0005705 Ga0466961_0005705_3765_4424 208
521 3300044694 Ga0466963_0000989 Ga0466963_0000989_3771_4430 208
522 3300044735 Ga0466968_0094149 Ga0466968_0094149_128_787 208
523 3300044765 Ga0466970_0035633 Ga0466970_0035633_1018_1677 208
524 3300044842 Ga0466957_0000377 Ga0466957_0000377_12617_13276 208
525 3300045049 Ga0466959_0072598 Ga0466959_0072598_1545_2204 208
526 3300045836 Ga0466958_0003652 Ga0466958_0003652_6053_6712 208
527 3300046459 Ga0495629_0012033 Ga0495629_0012033_5248_5967 208
528 3300046463 Ga0495653_0010517 Ga0495653_0010517_3703_4422 208
529 3300046471 Ga0495650_0007548 Ga0495650_0007548_900_1619 208
530 3300046472 Ga0495580_0068678 Ga0495580_0068678_461_1180 208
531 3300046473 Ga0495582_0107727 Ga0495582_0107727_351_1070 208
532 3300046477 Ga0495664_0027348 Ga0495664_0027348_1618_2337 208
533 3300046511 Ga0495608_0010226 Ga0495608_0010226_547_1266 208
534 3300046514 Ga0495618_0005571 Ga0495618_0005571_1619_2338 208
535 3300046516 Ga0495628_0039234 Ga0495628_0039234_560_1279 208
536 3300046517 Ga0495630_0092735 Ga0495630_0092735_397_1116 208
537 3300046526 Ga0495666_0000559 Ga0495666_0000559_11370_12089 208
538 3300046529 Ga0495652_0010532 Ga0495652_0010532_1418_2137 208
539 3300046531 Ga0495665_0033391 Ga0495665_0033391_496_1215 208
540 3300046535 Ga0495586_0108540 Ga0495586_0108540_309_1028 208
541 3300046642 Ga0495634_0009485 Ga0495634_0009485_2163_2882 208
542 3300046663 Ga0495635_0006854 Ga0495635_0006854_4087_4806 208
543 3300046675 Ga0495657_0044512 Ga0495657_0044512_885_1604 208
544 3300046680 Ga0495646_0011578 Ga0495646_0011578_1009_1728 208
545 3300046809 Ga0495600_0001057 Ga0495600_0001057_11856_12575 208
546 3300046810 Ga0495660_0182211 Ga0495660_0182211_163_891 208
547 3300047315 Ga0495581_0002786 Ga0495581_0002786_4111_4830 208
548 3300047317 Ga0495604_0021447 Ga0495604_0021447_1538_2257 208
549 3300047322 Ga0495680_0002755 Ga0495680_0002755_2696_3415 208
550 3300047444 Ga0495675_0003869 Ga0495675_0003869_5311_6030 208
551 3300047471 Ga0495684_0118808 Ga0495684_0118808_923_1642 208
552 3300047673 Ga0495593_0018874 Ga0495593_0018874_1511_2230 208
553 3300048088 Ga0495602_0025076 Ga0495602_0025076_3521_4240 208
554 3300001904 JGI24736J21556_1004308 JGI24736J21556_10043083 210
555 3300002067 JGI24735J21928_10015357 JGI24735J21928_100153574 210
556 3300002067 JGI24735J21928_10015804 JGI24735J21928_100158042 210
557 3300005327 Ga0070658_10018941 Ga0070658_100189414 210
558 3300005339 Ga0070660_100000404 Ga0070660_10000040420 210
559 3300005563 Ga0068855_100027446 Ga0068855_1000274462 210
560 3300013104 Ga0157370_10003087 Ga0157370_1000308715 210
561 3300025228 Ga0209672_100224 Ga0209672_10022418 210
562 3300025904 Ga0207647_10000235 Ga0207647_1000023523 210
563 3300025909 Ga0207705_10184461 Ga0207705_101844612 210
564 3300025913 Ga0207695_10051646 Ga0207695_100516463 210
565 3300025914 Ga0207671_10047271 Ga0207671_100472714 210
566 3300025919 Ga0207657_10001021 Ga0207657_100010216 210
567 3300025949 Ga0207667_10008611 Ga0207667_1000861112 210
568 3300026142 Ga0207698_10316202 Ga0207698_103162022 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06041

DUF924

Bacterial protein of unknown function (DUF924)

55

240

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.9266 12 202
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.9062 12 202
7o6j-assembly1.cif.gz_A-2 14-3-3 sigma with rela/p65 binding site ps45 and covalently bound tcf521-083 0.5185 77 177
7nnd-assembly1.cif.gz_A-2 crystal structure of 14-3-3 sigma in complex with 13mer amot-p130 peptide and fragment 09 0.5176 76 177
6s39-assembly1.cif.gz_A-2 fragment az-018 binding at the p53pt387/14-3-3 sigma interface 0.5163 75 177
ID Description Score Start End Superfamily
af_A0A0R0IF73_156_271_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6577 60 174 1.25.40.10
af_B6SZD1_1_154_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.625 51 181 1.25.40.10
af_A0A0R0IF73_156_271_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6045 60 174 1.25.40.10
af_K7M7X0_144_258_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5831 76 179 1.25.40.10
af_A0A1D6IPQ0_408_508_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5776 76 179 1.25.40.10
ID Description Score Start End GO Terms
AF-I0HK39-F1-model_v4 DUF924 domain-containing protein 0.9965 81 206
AF-A0A2N7WFE2-F1-model_v4 DUF924 domain-containing protein 0.9921 10 210
AF-K0DK59-F1-model_v4 Transmembrane protein 0.9918 13 209
AF-A0A257JHC2-F1-model_v4 DUF924 domain-containing protein 0.9912 127 207
AF-A0A4R6QJ79-F1-model_v4 Uncharacterized protein (DUF924 family) 0.989 20 207

Feature Viewer

pLDDT pTM Quality
91.99 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map