F464596

General Info

Members Datasets Scaffolds Average Seq Length
568 209 563 255

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10002241|Ga0070692_100022416
Length 267
Sequence MLSAPFDHAARSRKARMSGFAWLPWLRPPPPIDEALWRDALAACPLVQRLPPDDLRQLRLLAARFVQRKRFHPIDMELDGKQRLLIAMLACLPVLRLGFRALRGWQGVVVYPGEFRVRHRHHDGSTGVVTESDQVRIGEAWQIGPLVLSWAAVEQDLAQPWDGTNVIVHEIAHKLDMLDGPPDGVPPLPRGVSWRAWIDTFQRAYDRLSLAVRRGEATPIDPYAATNPGEYFSVVSELHFSDPRRLEQAEPGVAALLRGYYGPSPAP

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
4 2928963466 Dyella japonica 1073 Isolate Unclassified
5 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 2.11
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 3.7
Rhizosphere 84.86
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000197 3300001979 Bacteria 24867
2 JGI24740J21852_10000549 3300001979 Bacteria 16049
3 JGI25162J39368_1000429 3300002737 Bacteria 33822
4 JGI25162J39368_1000457 3300002737 Bacteria 31976
5 JGI25157J39369_1000330 3300002741 Bacteria 33488
6 JGI25164J39214_1000939 3300002772 Bacteria 9471
7 JGI25164J39214_1001616 3300002772 Bacteria 4734
8 JGI25165J46597_1001059 3300003214 Bacteria 17724
9 JGI25165J46597_1002083 3300003214 Bacteria 7379
10 rootH2_10082137 3300003320 Bacteria 3531
11 Ga0055542_1001381 3300003762 Bacteria 12337
12 Ga0070658_10029596 3300005327 Bacteria 4400
13 Ga0070683_100059162 3300005329 Bacteria 3560
14 Ga0070683_100089335 3300005329 Bacteria 2891
15 Ga0070683_100098084 3300005329 Bacteria 2757
16 Ga0070670_100017467 3300005331 Bacteria 6155
17 Ga0070670_100243546 3300005331 Bacteria 1566
18 Ga0068869_100104201 3300005334 Bacteria 2150
19 Ga0070666_10093497 3300005335 Bacteria 2067
20 Ga0070680_100000374 3300005336 Bacteria 30132
21 Ga0070680_100041948 3300005336 Bacteria 3711
22 Ga0070680_100059399 3300005336 Bacteria 3128
23 Ga0070682_100002045 3300005337 Bacteria 11262
24 Ga0070682_100002308 3300005337 Bacteria 10544
25 Ga0070682_100015585 3300005337 Bacteria 4407
26 Ga0070682_100045627 3300005337 Bacteria 2717
27 Ga0070682_100077530 3300005337 Bacteria 2142
28 Ga0070660_100015288 3300005339 Bacteria 5538
29 Ga0070660_100087929 3300005339 Bacteria 2446
30 Ga0070660_100096042 3300005339 Bacteria 2343
31 Ga0070660_100103091 3300005339 Bacteria 2262
32 Ga0070660_100442536 3300005339 Bacteria 1078
33 Ga0070660_100627319 3300005339 Bacteria 900
34 Ga0070691_10045568 3300005341 Bacteria 2081
35 Ga0070691_10066731 3300005341 Bacteria 1739
36 Ga0070691_10090623 3300005341 Bacteria 1507
37 Ga0070661_100002497 3300005344 Bacteria 12610
38 Ga0070661_100020267 3300005344 Bacteria 4740
39 Ga0070661_100033645 3300005344 Bacteria 3714
40 Ga0070661_100041284 3300005344 Bacteria 3367
41 Ga0070661_100158096 3300005344 Bacteria 1715
42 Ga0070661_100212747 3300005344 Bacteria 1480
43 Ga0070661_100562143 3300005344 Bacteria 919
44 Ga0070692_10001542 3300005345 Bacteria 8457
45 Ga0070692_10002241 3300005345 Bacteria 7419
46 Ga0070692_10007409 3300005345 Bacteria 4830
47 Ga0070692_10074878 3300005345 Bacteria 1812
48 Ga0070668_100019986 3300005347 Bacteria 5049
49 Ga0070668_100337937 3300005347 Bacteria 1272
50 Ga0070659_100000049 3300005366 Bacteria 98059
51 Ga0070659_100079917 3300005366 Bacteria 2610
52 Ga0070659_100079975 3300005366 Bacteria 2609
53 Ga0070659_100100823 3300005366 Bacteria 2323
54 Ga0070659_100168206 3300005366 Bacteria 1794
55 Ga0070667_100000040 3300005367 Bacteria 170222
56 Ga0070667_100005144 3300005367 Bacteria 10943
57 Ga0070667_100036850 3300005367 Bacteria 4100
58 Ga0070667_100085225 3300005367 Bacteria 2709
59 Ga0070667_100118822 3300005367 Bacteria 2298
60 Ga0070667_100508521 3300005367 Bacteria 1105
61 Ga0070714_100000073 3300005435 Bacteria 88847
62 Ga0070714_100007926 3300005435 Bacteria 8273
63 Ga0070714_100017766 3300005435 Bacteria 5767
64 Ga0070713_100001201 3300005436 Bacteria 16544
65 Ga0070711_100050513 3300005439 Bacteria 2852
66 Ga0070694_100028090 3300005444 Bacteria 3657
67 Ga0070663_100000557 3300005455 Bacteria 19877
68 Ga0070663_100005398 3300005455 Bacteria 7595
69 Ga0070663_100073715 3300005455 Bacteria 2491
70 Ga0070663_100088925 3300005455 Bacteria 2285
71 Ga0070663_100095630 3300005455 Bacteria 2208
72 Ga0070663_100103650 3300005455 Bacteria 2127
73 Ga0070662_100005129 3300005457 Bacteria 8352
74 Ga0070681_10000251 3300005458 Bacteria 42561
75 Ga0070681_10002412 3300005458 Bacteria 17102
76 Ga0070681_10129151 3300005458 Bacteria 2459
77 Ga0070681_10198168 3300005458 Bacteria 1926
78 Ga0070685_10043638 3300005466 Bacteria 2564
79 Ga0070679_100000042 3300005530 Bacteria 95394
80 Ga0070679_100000076 3300005530 Bacteria 74528
81 Ga0070679_100071688 3300005530 Bacteria 3456
82 Ga0070679_100140959 3300005530 Bacteria 2390
83 Ga0070684_100089773 3300005535 Bacteria 2731
84 Ga0068853_100005307 3300005539 Bacteria 10087
85 Ga0068853_100014101 3300005539 Bacteria 6543
86 Ga0068853_100016628 3300005539 Bacteria 6057
87 Ga0068853_100025999 3300005539 Bacteria 4913
88 Ga0068853_100034137 3300005539 Bacteria 4317
89 Ga0068853_100063868 3300005539 Bacteria 3190
90 Ga0068853_100388464 3300005539 Bacteria 1304
91 Ga0068853_100451730 3300005539 Bacteria 1209
92 Ga0070696_100012739 3300005546 Bacteria 5648
93 Ga0070696_100049281 3300005546 Bacteria 2925
94 Ga0070696_100069161 3300005546 Bacteria 2480
95 Ga0070693_100003927 3300005547 Bacteria 6975
96 Ga0070693_100022370 3300005547 Bacteria 3360
97 Ga0070693_100048689 3300005547 Bacteria 2415
98 Ga0070665_100000065 3300005548 Bacteria 212975
99 Ga0070665_100008899 3300005548 Bacteria 10169
100 Ga0070665_100011422 3300005548 Bacteria 8978
101 Ga0070665_100098877 3300005548 Bacteria 2922
102 Ga0070665_100134486 3300005548 Bacteria 2474
103 Ga0068855_100001890 3300005563 Bacteria 26002
104 Ga0068855_100010746 3300005563 Bacteria 11050
105 Ga0068855_100065827 3300005563 Bacteria 4225
106 Ga0068855_100170961 3300005563 Bacteria 2461
107 Ga0068855_100673176 3300005563 Bacteria 1109
108 Ga0070664_100018793 3300005564 Bacteria 5683
109 Ga0070664_100155896 3300005564 Bacteria 2018
110 Ga0068857_100021406 3300005577 Bacteria 5692
111 Ga0068857_100024731 3300005577 Bacteria 5289
112 Ga0068857_100060045 3300005577 Bacteria 3378
113 Ga0068857_100118044 3300005577 Bacteria 2388
114 Ga0068857_100160729 3300005577 Bacteria 2038
115 Ga0068857_100396762 3300005577 Bacteria 1283
116 Ga0068854_100007571 3300005578 Bacteria 6941
117 Ga0068856_100054344 3300005614 Bacteria 3949
118 Ga0068856_100089816 3300005614 Bacteria 3055
119 Ga0068856_100226159 3300005614 Bacteria 1886
120 Ga0068852_100033448 3300005616 Bacteria 4268
121 Ga0068852_100043283 3300005616 Bacteria 3818
122 Ga0068852_100073271 3300005616 Bacteria 3012
123 Ga0068852_100073816 3300005616 Bacteria 3002
124 Ga0068859_100000480 3300005617 Bacteria 39308
125 Ga0068864_100073081 3300005618 Bacteria 2990
126 Ga0068861_100089726 3300005719 Bacteria 2423
127 Ga0068851_10014578 3300005834 Bacteria 3734
128 Ga0068851_10024582 3300005834 Bacteria 2950
129 Ga0068851_10053099 3300005834 Bacteria 2063
130 Ga0068863_100003295 3300005841 Bacteria 15943
131 Ga0068858_100178648 3300005842 Bacteria 2003
132 Ga0068860_100071429 3300005843 Bacteria 3299
133 Ga0068860_100821202 3300005843 Bacteria 943
134 Ga0068862_100000041 3300005844 Bacteria 166801
135 Ga0068862_100109646 3300005844 Bacteria 2422
136 Ga0081455_10137200 3300005937 Bacteria 1904
137 Ga0081540_1010827 3300005983 Bacteria 6129
138 Ga0097621_100018286 3300006237 Bacteria 5347
139 Ga0097621_100031005 3300006237 Bacteria 4238
140 Ga0097621_100067876 3300006237 Bacteria 2939
141 Ga0097621_100086367 3300006237 Bacteria 2618
142 Ga0068871_100093684 3300006358 Bacteria 2506
143 Ga0097620_100000480 3300006931 Bacteria 39308
144 Ga0105240_10161137 3300009093 Bacteria 2664
145 Ga0105240_10187918 3300009093 Bacteria 2432
146 Ga0105240_10379020 3300009093 Bacteria 1598
147 Ga0105241_10168733 3300009174 Bacteria 1806
148 Ga0105241_10211756 3300009174 Bacteria 1624
149 Ga0105248_10001590 3300009177 Bacteria 25268
150 Ga0105237_10001639 3300009545 Bacteria 29056
151 Ga0105237_10027599 3300009545 Bacteria 5792
152 Ga0105237_10079760 3300009545 Bacteria 3264
153 Ga0105237_10129630 3300009545 Bacteria 2517
154 Ga0105237_10435917 3300009545 Bacteria 1316
155 Ga0105237_10458183 3300009545 Bacteria 1281
156 Ga0105238_10006112 3300009551 Bacteria 11945
157 Ga0105238_10083559 3300009551 Bacteria 3182
158 Ga0105238_10117112 3300009551 Bacteria 2644
159 Ga0105238_10220972 3300009551 Bacteria 1871
160 Ga0105249_10000250 3300009553 Bacteria 59165
161 Ga0105239_10000033 3300010375 Bacteria 223933
162 Ga0105239_10097887 3300010375 Bacteria 3242
163 Ga0105239_11180680 3300010375 Bacteria 882
164 Ga0157373_10006952 3300013100 Bacteria 8425
165 Ga0157373_10007373 3300013100 Bacteria 8185
166 Ga0157373_10014269 3300013100 Bacteria 5827
167 Ga0157373_10015069 3300013100 Bacteria 5655
168 Ga0157373_10083998 3300013100 Bacteria 2244
169 Ga0157373_10164767 3300013100 Bacteria 1560
170 Ga0157371_10051055 3300013102 Bacteria 2939
171 Ga0157371_10080661 3300013102 Bacteria 2304
172 Ga0157371_10143564 3300013102 Bacteria 1701
173 Ga0157371_10342200 3300013102 Bacteria 1088
174 Ga0157370_10002987 3300013104 Bacteria 20108
175 Ga0157370_10008905 3300013104 Bacteria 10783
176 Ga0157370_10009699 3300013104 Bacteria 10237
177 Ga0157370_10030613 3300013104 Bacteria 5273
178 Ga0157370_10074051 3300013104 Bacteria 3213
179 Ga0157370_10076373 3300013104 Bacteria 3155
180 Ga0157370_10236435 3300013104 Bacteria 1691
181 Ga0157369_10003531 3300013105 Bacteria 18583
182 Ga0157369_10119020 3300013105 Bacteria 2803
183 Ga0157369_10201698 3300013105 Bacteria 2088
184 Ga0157374_10154998 3300013296 Bacteria 2229
185 Ga0157372_10001614 3300013307 Bacteria 24489
186 Ga0157372_10001681 3300013307 Bacteria 23924
187 Ga0157372_10002772 3300013307 Bacteria 18933
188 Ga0157372_10011770 3300013307 Bacteria 9318
189 Ga0157372_10035393 3300013307 Bacteria 5497
190 Ga0157372_10113492 3300013307 Bacteria 3105
191 Ga0157372_10117219 3300013307 Bacteria 3054
192 Ga0163163_10098349 3300014325 Bacteria 2947
193 Ga0163163_10682434 3300014325 Bacteria 1091
194 Ga0182008_10019397 3300014497 Bacteria 3511
195 Ga0182008_10054974 3300014497 Bacteria 1969
196 Ga0182008_10056383 3300014497 Bacteria 1942
197 Ga0157376_10046787 3300014969 Bacteria 3570
198 Ga0157376_10095479 3300014969 Bacteria 2586
199 Ga0157376_10207832 3300014969 Bacteria 1805
200 Ga0182006_1009088 3300015261 Bacteria 4471
201 Ga0182006_1104993 3300015261 Bacteria 998
202 Ga0182007_10015215 3300015262 Bacteria 2877
203 Ga0182007_10034045 3300015262 Bacteria 1724
204 Ga0182007_10060566 3300015262 Bacteria 1241
205 Ga0197907_10546852 3300020069 Bacteria 3292
206 Ga0197907_10616062 3300020069 Bacteria 3247
207 Ga0206356_10223288 3300020070 Bacteria 12293
208 Ga0206356_10379234 3300020070 Bacteria 2755
209 Ga0206356_11587018 3300020070 Bacteria 1826
210 Ga0206352_11085077 3300020078 Bacteria 3334
211 Ga0206354_10521916 3300020081 Bacteria 7400
212 Ga0206354_11462809 3300020081 Bacteria 2609
213 Ga0206353_11179387 3300020082 Bacteria 5990
214 Ga0206353_11499556 3300020082 Bacteria 4893
215 Ga0154015_1013787 3300020610 Bacteria 5004
216 Ga0224712_10009975 3300022467 Bacteria 2885
217 Ga0207427_100049 3300025231 Bacteria 237504
218 Ga0207427_100101 3300025231 Bacteria 120866
219 Ga0209437_100083 3300025233 Bacteria 256005
220 Ga0209437_100090 3300025233 Bacteria 247138
221 Ga0209437_100162 3300025233 Bacteria 147864
222 Ga0209437_102985 3300025233 Bacteria 3140
223 Ga0209258_108425 3300025242 Bacteria 1450
224 Ga0209026_1000114 3300025250 Bacteria 136985
225 Ga0209026_1007845 3300025250 Bacteria 2321
226 Ga0209026_1012069 3300025250 Bacteria 1520
227 Ga0209148_1000005 3300025254 Bacteria 1806504
228 Ga0209759_1001788 3300025256 Bacteria 10899
229 Ga0209233_1000075 3300025261 Bacteria 356837
230 Ga0209233_1000077 3300025261 Bacteria 349570
231 Ga0209233_1000422 3300025261 Bacteria 31330
232 Ga0209233_1014868 3300025261 Bacteria 2181
233 Ga0209455_1008466 3300025272 Bacteria 2793
234 Ga0209051_1032041 3300025303 Bacteria 2011
235 Ga0207656_10013532 3300025321 Bacteria 3122
236 Ga0207656_10016411 3300025321 Bacteria 2883
237 Ga0207680_10052536 3300025903 Bacteria 2442
238 Ga0207647_10004302 3300025904 Bacteria 10560
239 Ga0207647_10011626 3300025904 Bacteria 6164
240 Ga0207647_10016537 3300025904 Bacteria 5032
241 Ga0207705_10000576 3300025909 Bacteria 30732
242 Ga0207705_10003322 3300025909 Bacteria 12231
243 Ga0207705_10049962 3300025909 Bacteria 3010
244 Ga0207705_10052922 3300025909 Bacteria 2924
245 Ga0207707_10000120 3300025912 Bacteria 80229
246 Ga0207707_10000366 3300025912 Bacteria 47348
247 Ga0207707_10000609 3300025912 Bacteria 35949
248 Ga0207707_10000708 3300025912 Bacteria 33137
249 Ga0207707_10008509 3300025912 Bacteria 8894
250 Ga0207695_10003100 3300025913 Bacteria 23792
251 Ga0207695_10005368 3300025913 Bacteria 17038
252 Ga0207695_10008399 3300025913 Bacteria 12936
253 Ga0207695_10009305 3300025913 Bacteria 12160
254 Ga0207671_10006599 3300025914 Bacteria 10299
255 Ga0207671_10022218 3300025914 Bacteria 4799
256 Ga0207671_10212605 3300025914 Bacteria 1513
257 Ga0207671_10368299 3300025914 Bacteria 1141
258 Ga0207693_10028201 3300025915 Bacteria 4436
259 Ga0207663_10080276 3300025916 Bacteria 2132
260 Ga0207660_10000315 3300025917 Bacteria 31695
261 Ga0207660_10000330 3300025917 Bacteria 30556
262 Ga0207660_10000458 3300025917 Bacteria 26881
263 Ga0207660_10000518 3300025917 Bacteria 25701
264 Ga0207660_10001799 3300025917 Bacteria 14300
265 Ga0207660_10002853 3300025917 Bacteria 11294
266 Ga0207660_10003827 3300025917 Bacteria 9806
267 Ga0207660_10105831 3300025917 Bacteria 2109
268 Ga0207657_10007839 3300025919 Bacteria 10897
269 Ga0207657_10009233 3300025919 Bacteria 9939
270 Ga0207657_10019272 3300025919 Bacteria 6483
271 Ga0207657_10043965 3300025919 Bacteria 3931
272 Ga0207657_10079240 3300025919 Bacteria 2764
273 Ga0207657_10081042 3300025919 Bacteria 2727
274 Ga0207657_10142327 3300025919 Bacteria 1959
275 Ga0207657_10218418 3300025919 Bacteria 1528
276 Ga0207657_10332730 3300025919 Bacteria 1199
277 Ga0207649_10000857 3300025920 Bacteria 19408
278 Ga0207649_10007030 3300025920 Bacteria 6114
279 Ga0207649_10028609 3300025920 Bacteria 3282
280 Ga0207649_10311580 3300025920 Bacteria 1154
281 Ga0207652_10000048 3300025921 Bacteria 124452
282 Ga0207652_10000117 3300025921 Bacteria 87807
283 Ga0207652_10000298 3300025921 Bacteria 51386
284 Ga0207652_10000893 3300025921 Bacteria 28227
285 Ga0207652_10001249 3300025921 Bacteria 22654
286 Ga0207652_10068775 3300025921 Bacteria 3073
287 Ga0207652_10077158 3300025921 Bacteria 2907
288 Ga0207694_10033608 3300025924 Bacteria 3929
289 Ga0207694_10095767 3300025924 Bacteria 2347
290 Ga0207694_10137197 3300025924 Bacteria 1965
291 Ga0207694_10269202 3300025924 Bacteria 1397
292 Ga0207664_10000041 3300025929 Bacteria 154806
293 Ga0207664_10000244 3300025929 Bacteria 40985
294 Ga0207664_10067493 3300025929 Bacteria 2870
295 Ga0207644_10033218 3300025931 Bacteria 3604
296 Ga0207690_10000124 3300025932 Bacteria 63516
297 Ga0207690_10003133 3300025932 Bacteria 9944
298 Ga0207690_10004638 3300025932 Bacteria 8128
299 Ga0207690_10009013 3300025932 Bacteria 5923
300 Ga0207690_10021089 3300025932 Bacteria 4036
301 Ga0207690_10047770 3300025932 Bacteria 2842
302 Ga0207690_10068290 3300025932 Bacteria 2441
303 Ga0207690_10179154 3300025932 Bacteria 1594
304 Ga0207706_10006338 3300025933 Bacteria 10989
305 Ga0207706_10212609 3300025933 Bacteria 1695
306 Ga0207670_10077942 3300025936 Bacteria 2310
307 Ga0207691_10006803 3300025940 Bacteria 11026
308 Ga0207711_10000924 3300025941 Bacteria 28323
309 Ga0207661_10001633 3300025944 Bacteria 15274
310 Ga0207661_10005397 3300025944 Bacteria 9003
311 Ga0207661_10007696 3300025944 Bacteria 7665
312 Ga0207679_10106695 3300025945 Bacteria 2202
313 Ga0207667_10000619 3300025949 Bacteria 45919
314 Ga0207667_10001130 3300025949 Bacteria 33641
315 Ga0207667_10001386 3300025949 Bacteria 30408
316 Ga0207667_10006308 3300025949 Bacteria 14380
317 Ga0207667_10013934 3300025949 Bacteria 9186
318 Ga0207667_10068444 3300025949 Bacteria 3697
319 Ga0207667_10106161 3300025949 Bacteria 2897
320 Ga0207667_10441915 3300025949 Bacteria 1322
321 Ga0207668_10057334 3300025972 Bacteria 2716
322 Ga0207640_10002929 3300025981 Bacteria 9174
323 Ga0207640_10003876 3300025981 Bacteria 8076
324 Ga0207640_10009676 3300025981 Bacteria 5405
325 Ga0207640_10037193 3300025981 Bacteria 3061
326 Ga0207658_10000020 3300025986 Bacteria 202984
327 Ga0207658_10022446 3300025986 Bacteria 4394
328 Ga0207658_10037455 3300025986 Bacteria 3486
329 Ga0207658_10322648 3300025986 Bacteria 1337
330 Ga0207658_10341190 3300025986 Bacteria 1302
331 Ga0207658_10742779 3300025986 Bacteria 888
332 Ga0207639_10001883 3300026041 Bacteria 14105
333 Ga0207639_10003939 3300026041 Bacteria 10021
334 Ga0207639_10005309 3300026041 Bacteria 8700
335 Ga0207639_10011555 3300026041 Bacteria 6136
336 Ga0207639_10013754 3300026041 Bacteria 5674
337 Ga0207639_10074274 3300026041 Bacteria 2669
338 Ga0207639_10161342 3300026041 Bacteria 1889
339 Ga0207639_10594250 3300026041 Bacteria 1020
340 Ga0207678_10000631 3300026067 Bacteria 32267
341 Ga0207678_10001671 3300026067 Bacteria 20361
342 Ga0207678_10005524 3300026067 Bacteria 11293
343 Ga0207678_10010783 3300026067 Bacteria 8029
344 Ga0207678_10012919 3300026067 Bacteria 7330
345 Ga0207678_10021457 3300026067 Bacteria 5662
346 Ga0207678_10032837 3300026067 Bacteria 4523
347 Ga0207678_10082656 3300026067 Bacteria 2748
348 Ga0207678_10082666 3300026067 Bacteria 2748
349 Ga0207678_10132193 3300026067 Bacteria 2129
350 Ga0207702_10001898 3300026078 Bacteria 20434
351 Ga0207702_10002109 3300026078 Bacteria 19154
352 Ga0207702_10007502 3300026078 Bacteria 9298
353 Ga0207702_10033751 3300026078 Bacteria 4275
354 Ga0207702_10119123 3300026078 Bacteria 2360
355 Ga0207641_10015851 3300026088 Bacteria 6171
356 Ga0207641_10041369 3300026088 Bacteria 3862
357 Ga0207641_10260438 3300026088 Bacteria 1623
358 Ga0207674_10001028 3300026116 Bacteria 36404
359 Ga0207674_10030234 3300026116 Bacteria 5696
360 Ga0207674_10047398 3300026116 Bacteria 4406
361 Ga0207674_10062334 3300026116 Bacteria 3766
362 Ga0207674_10138498 3300026116 Bacteria 2394
363 Ga0207674_10333676 3300026116 Bacteria 1466
364 Ga0207675_100128663 3300026118 Bacteria 2400
365 Ga0207683_10325745 3300026121 Bacteria 1408
366 Ga0207683_10395370 3300026121 Bacteria 1271
367 Ga0207698_10001577 3300026142 Bacteria 13308
368 Ga0207698_10005254 3300026142 Bacteria 7967
369 Ga0207698_10040132 3300026142 Bacteria 3474
370 Ga0268266_10000001 3300028379 Bacteria 4040580
371 Ga0268266_10012259 3300028379 Bacteria 7417
372 Ga0268266_10119215 3300028379 Bacteria 2347
373 Ga0268266_10180568 3300028379 Bacteria 1921
374 Ga0268266_10218855 3300028379 Bacteria 1749
375 Ga0268265_10000208 3300028380 Bacteria 68360
376 Ga0268265_10089326 3300028380 Bacteria 2457
377 Ga0268264_10039137 3300028381 Bacteria 3917
378 Ga0268264_10164286 3300028381 Bacteria 2003
379 Ga0268264_10333205 3300028381 Bacteria 1439
380 Ga0307509_10068197 3300031507 Bacteria 3723
381 Ga0307413_10136594 3300031824 Bacteria 1687
382 Ga0307507_10122110 3300033179 Bacteria 2079
383 Ga0395899_0014577 3300037312 Bacteria 6001
384 Ga0395900_0120499 3300037418 Bacteria 2692
385 Ga0395898_0051854 3300037466 Bacteria 4010
386 Ga0395901_0002598 3300038443 Bacteria 18304
387 Ga0395901_0243406 3300038443 Bacteria 1875
388 Ga0395901_0352682 3300038443 Bacteria 1518
389 Ga0451793_0372935 3300041452 Unclassified 1597
390 Ga0451793_0531026 3300041452 Bacteria 818
391 Ga0451793_1087444 3300041452 Unclassified 3377
392 Ga0451802_1322396 3300041460 Unclassified 2934
393 Ga0451807_0148272 3300041486 Bacteria 1885
394 Ga0451807_0411699 3300041486 Unclassified 2278
395 Ga0451837_0827185 3300041494 Bacteria 1251
396 Ga0451843_1738645 3300041509 Bacteria 956
397 Ga0451853_1059132 3300041512 Unclassified 3571
398 Ga0451853_1715748 3300041512 Bacteria 2775
399 Ga0439448_0018611 3300042005 Bacteria 2132
400 Ga0439455_0065832 3300042012 Bacteria 967
401 Ga0466972_0019183 3300044658 Bacteria 3420
402 Ga0466970_0002722 3300044765 Bacteria 8538
403 Ga0466959_0004578 3300045049 Bacteria 9283
404 Ga0466967_0248776 3300045976 Bacteria 1698
405 Ga0495638_0000106 3300046460 Bacteria 133921
406 Ga0495638_0000200 3300046460 Bacteria 85703
407 Ga0495638_0000315 3300046460 Bacteria 62494
408 Ga0495641_0065257 3300046461 Bacteria 1639
409 Ga0495650_0000134 3300046471 Bacteria 173331
410 Ga0495606_0001413 3300046507 Bacteria 32280
411 Ga0495622_0011757 3300046557 Bacteria 4047
412 Ga0495625_0233552 3300046660 Bacteria 1200
413 Ga0495649_0000573 3300046694 Bacteria 31036
414 Ga0496101_0003718 3300048904 Bacteria 9516
415 Ga0496102_0336298 3300048905 Bacteria 1422
416 Ga0496103_0465056 3300048906 Bacteria 811
417 Ga0496104_0053490 3300048907 Bacteria 3815
418 Ga0496105_0039280 3300048908 Bacteria 3900
419 Ga0496107_0008135 3300048910 Bacteria 7253
420 Ga0496107_0127729 3300048910 Bacteria 1876
421 Ga0496107_0132854 3300048910 Bacteria 1838
422 Ga0496107_0150555 3300048910 Bacteria 1721
423 Ga0496114_0069463 3300048917 Bacteria 2958
424 Ga0496115_0003509 3300048918 Bacteria 11266
425 Ga0496115_0008533 3300048918 Bacteria 7583
426 Ga0496115_0012293 3300048918 Bacteria 6438
427 Ga0496115_0127977 3300048918 Bacteria 2092
428 Ga0496115_0172360 3300048918 Bacteria 1789
429 Ga0496117_0010164 3300048920 Bacteria 8635
430 Ga0496117_0010985 3300048920 Bacteria 8158
431 Ga0496117_0042856 3300048920 Bacteria 3298
432 Ga0496117_0065970 3300048920 Bacteria 2458
433 Ga0496118_0000065 3300048921 Bacteria 211750
434 Ga0496118_0001505 3300048921 Bacteria 34743
435 Ga0496118_0018804 3300048921 Bacteria 6204
436 Ga0496118_0027631 3300048921 Bacteria 4795
437 Ga0496119_0000776 3300048922 Bacteria 42684
438 Ga0496120_0000874 3300048923 Bacteria 42572
439 Ga0496121_0002734 3300048924 Bacteria 26265
440 Ga0496121_0086441 3300048924 Bacteria 2464
441 Ga0496121_0189806 3300048924 Bacteria 1474
442 Ga0496122_0000037 3300048925 Bacteria 304495
443 Ga0496123_0000083 3300048926 Bacteria 188730
444 Ga0496126_0005390 3300048929 Bacteria 14603
445 Ga0496126_0058088 3300048929 Bacteria 3488
446 Ga0496126_0095388 3300048929 Bacteria 2609
447 Ga0496126_0129810 3300048929 Bacteria 2179
448 Ga0496126_0194479 3300048929 Bacteria 1716
449 Ga0496126_0408052 3300048929 Bacteria 1101
450 Ga0495682_0004117 3300049460 Bacteria 6313
451 Ga0501031_0226815 3300049568 Bacteria 1216
452 Ga0501032_0004374 3300049569 Bacteria 10658
453 Ga0501032_0008251 3300049569 Bacteria 7594
454 Ga0501033_0000263 3300049570 Bacteria 50319
455 Ga0501033_0036558 3300049570 Bacteria 3679
456 Ga0501034_0003837 3300049571 Bacteria 16937
457 Ga0501034_0014240 3300049571 Bacteria 8197
458 Ga0501034_0121721 3300049571 Bacteria 2595
459 Ga0501036_0005114 3300049572 Bacteria 10604
460 Ga0501036_0129178 3300049572 Bacteria 2134
461 Ga0501036_0129768 3300049572 Bacteria 2128
462 Ga0501037_0002129 3300049573 Bacteria 14340
463 Ga0501037_0041333 3300049573 Bacteria 3390
464 Ga0501038_0003227 3300049574 Bacteria 15208
465 Ga0501038_0003621 3300049574 Bacteria 14391
466 Ga0501038_0035813 3300049574 Bacteria 4357
467 Ga0501038_0064973 3300049574 Bacteria 3111
468 Ga0501038_0066166 3300049574 Bacteria 3078
469 Ga0501039_0013630 3300049575 Bacteria 6217
470 Ga0501039_0120171 3300049575 Bacteria 2058
471 Ga0501040_0016131 3300049576 Bacteria 4940
472 Ga0501040_0159895 3300049576 Bacteria 1592
473 Ga0501042_0146030 3300049578 Bacteria 1705
474 Ga0501043_0004589 3300049579 Bacteria 11205
475 Ga0501043_0008432 3300049579 Bacteria 8115
476 Ga0501043_0023334 3300049579 Bacteria 4851
477 Ga0501046_0010388 3300049580 Bacteria 7997
478 Ga0501046_0016960 3300049580 Bacteria 6092
479 Ga0501046_0080068 3300049580 Bacteria 2525
480 Ga0501047_0006644 3300049581 Bacteria 10873
481 Ga0501047_0006716 3300049581 Bacteria 10816
482 Ga0501047_0009723 3300049581 Bacteria 9094
483 Ga0501047_0014430 3300049581 Bacteria 7512
484 Ga0501047_0145188 3300049581 Bacteria 2250
485 Ga0501047_0146081 3300049581 Bacteria 2242
486 Ga0501048_0012744 3300049582 Bacteria 6251
487 Ga0501048_0020426 3300049582 Bacteria 4854
488 Ga0501067_0007285 3300049583 Bacteria 6141
489 Ga0501067_0034607 3300049583 Bacteria 2804
490 Ga0501068_0005227 3300049584 Bacteria 7080
491 Ga0501068_0014281 3300049584 Bacteria 4538
492 Ga0501069_0000398 3300049585 Bacteria 19639
493 Ga0501069_0002907 3300049585 Bacteria 8796
494 Ga0501069_0008353 3300049585 Bacteria 5438
495 Ga0501069_0016781 3300049585 Bacteria 3934
496 Ga0501069_0020678 3300049585 Bacteria 3568
497 Ga0501069_0033773 3300049585 Bacteria 2818
498 Ga0501069_0153641 3300049585 Bacteria 1323
499 Ga0501070_0000506 3300049586 Bacteria 35600
500 Ga0501070_0004605 3300049586 Bacteria 11824
501 Ga0501070_0014035 3300049586 Bacteria 6743
502 Ga0501070_0015796 3300049586 Bacteria 6349
503 Ga0501070_0016633 3300049586 Bacteria 6178
504 Ga0501070_0055044 3300049586 Bacteria 3298
505 Ga0501070_0103858 3300049586 Bacteria 2350
506 Ga0501070_0643455 3300049586 Bacteria 842
507 Ga0501071_0003329 3300049587 Bacteria 10039
508 Ga0501071_0015919 3300049587 Bacteria 5166
509 Ga0501071_0293187 3300049587 Bacteria 1232
510 Ga0501073_0004053 3300049589 Bacteria 11010
511 Ga0501073_0005472 3300049589 Bacteria 9515
512 Ga0501073_0011630 3300049589 Bacteria 6431
513 Ga0501073_0013584 3300049589 Bacteria 5922
514 Ga0501073_0037526 3300049589 Bacteria 3440
515 Ga0501073_0073755 3300049589 Bacteria 2376
516 Ga0501073_0097845 3300049589 Bacteria 2038
517 Ga0501073_0217973 3300049589 Bacteria 1318
518 Ga0501073_0339874 3300049589 Bacteria 1036
519 Ga0501074_0004768 3300049590 Bacteria 9724
520 Ga0501074_0012806 3300049590 Bacteria 6098
521 Ga0501074_0015090 3300049590 Bacteria 5619
522 Ga0501074_0018862 3300049590 Bacteria 5010
523 Ga0501074_0071880 3300049590 Bacteria 2486
524 Ga0501074_0181915 3300049590 Bacteria 1499
525 Ga0501076_0021194 3300049592 Bacteria 4983
526 Ga0501077_0047588 3300049593 Bacteria 2725
527 Ga0501080_0015017 3300049742 Bacteria 7133
528 Ga0501080_0019594 3300049742 Bacteria 6267
529 Ga0501080_0021033 3300049742 Bacteria 6038
530 Ga0501080_0040386 3300049742 Bacteria 4352
531 Ga0501080_0048006 3300049742 Bacteria 3975
532 Ga0501080_0095428 3300049742 Bacteria 2761
533 Ga0501080_0781477 3300049742 Bacteria 838
534 Ga0501081_0004976 3300049743 Bacteria 8554
535 Ga0501083_0000593 3300049744 Bacteria 23270
536 Ga0501083_0054368 3300049744 Bacteria 2687
537 Ga0501035_0003040 3300049822 Bacteria 16089
538 Ga0501035_0004676 3300049822 Bacteria 12997
539 Ga0501035_0009873 3300049822 Bacteria 8859
540 Ga0501035_0040349 3300049822 Bacteria 4218
541 Ga0501035_0050963 3300049822 Bacteria 3707
542 Ga0501044_0016603 3300049823 Bacteria 7902
543 Ga0501044_0021662 3300049823 Bacteria 6852
544 Ga0501044_0028353 3300049823 Bacteria 5910
545 Ga0501044_0043881 3300049823 Bacteria 4643
546 Ga0501044_0055560 3300049823 Bacteria 4067
547 Ga0501044_0091562 3300049823 Bacteria 3067
548 Ga0501044_0165678 3300049823 Bacteria 2184
549 Ga0501044_0203151 3300049823 Bacteria 1939
550 Ga0501044_0259992 3300049823 Bacteria 1674
551 Ga0500610_0000345 3300053079 Bacteria 14017
552 Ga0500643_002228 3300053087 Bacteria 10238
553 Ga0500651_0000113 3300053093 Bacteria 49604
554 Ga0500651_0001227 3300053093 Bacteria 12760
555 Ga0500651_0008164 3300053093 Bacteria 6143
556 Ga0500597_000043 3300053120 Bacteria 24657
557 Ga0500568_0000063 3300053139 Bacteria 106839
558 Ga0501084_0015794 3300054114 Bacteria 6262
559 Ga0501084_0038705 3300054114 Bacteria 3987
560 Ga0501084_0603264 3300054114 Bacteria 928
561 Ga0501082_0000051 3300060353 Bacteria 83946
562 Ga0501082_0013720 3300060353 Bacteria 6964
563 Ga0501082_0029689 3300060353 Bacteria 4711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0010985 Ga0496117_0010985_5392_6141 212
2 iso_pu_bacteria 2895395659 2895398970 221
3 3300048904 Ga0496101_0003718 Ga0496101_0003718_5763_6446 222
4 3300048906 Ga0496103_0465056 Ga0496103_0465056_60_734 222
5 3300048910 Ga0496107_0008135 Ga0496107_0008135_6093_6776 222
6 3300048910 Ga0496107_0132854 Ga0496107_0132854_1110_1793 222
7 3300048918 Ga0496115_0012293 Ga0496115_0012293_3790_4473 222
8 3300048920 Ga0496117_0010164 Ga0496117_0010164_3219_3893 222
9 3300048920 Ga0496117_0042856 Ga0496117_0042856_872_1582 222
10 3300048920 Ga0496117_0065970 Ga0496117_0065970_308_991 222
11 3300048921 Ga0496118_0000065 Ga0496118_0000065_11413_12123 222
12 3300048921 Ga0496118_0018804 Ga0496118_0018804_4026_4709 222
13 3300048921 Ga0496118_0027631 Ga0496118_0027631_4027_4701 222
14 3300048924 Ga0496121_0002734 Ga0496121_0002734_23301_23984 222
15 3300048924 Ga0496121_0189806 Ga0496121_0189806_201_884 222
16 3300048929 Ga0496126_0005390 Ga0496126_0005390_13776_14459 222
17 3300048929 Ga0496126_0194479 Ga0496126_0194479_289_999 222
18 3300049586 Ga0501070_0643455 Ga0501070_0643455_111_779 222
19 3300002741 JGI25157J39369_1000330 JGI25157J39369_100033022 226
20 3300005435 Ga0070714_100017766 Ga0070714_1000177662 226
21 3300015262 Ga0182007_10015215 Ga0182007_100152152 226
22 3300025233 Ga0209437_102985 Ga0209437_1029852 227
23 3300045049 Ga0466959_0004578 Ga0466959_0004578_5370_6155 227
24 3300025272 Ga0209455_1008466 Ga0209455_10084663 229
25 3300026067 Ga0207678_10132193 Ga0207678_101321932 229
26 3300046557 Ga0495622_0011757 Ga0495622_0011757_1197_1892 229
27 3300046660 Ga0495625_0233552 Ga0495625_0233552_226_921 229
28 3300048929 Ga0496126_0095388 Ga0496126_0095388_14_709 229
29 3300041486 Ga0451807_0148272 Ga0451807_0148272_219_971 232
30 3300041509 Ga0451843_1738645 Ga0451843_1738645_28_780 232
31 3300015261 Ga0182006_1009088 Ga0182006_10090883 235
32 3300048921 Ga0496118_0001505 Ga0496118_0001505_10081_10866 237
33 3300031507 Ga0307509_10068197 Ga0307509_100681973 239
34 3300026121 Ga0207683_10325745 Ga0207683_103257452 240
35 3300049570 Ga0501033_0000263 Ga0501033_0000263_27480_28259 240
36 3300049571 Ga0501034_0014240 Ga0501034_0014240_4160_4939 240
37 3300049573 Ga0501037_0041333 Ga0501037_0041333_2255_3034 240
38 3300049574 Ga0501038_0003227 Ga0501038_0003227_12800_13579 240
39 3300049575 Ga0501039_0013630 Ga0501039_0013630_1807_2586 240
40 3300049579 Ga0501043_0008432 Ga0501043_0008432_2888_3667 240
41 3300049580 Ga0501046_0016960 Ga0501046_0016960_3445_4224 240
42 3300049581 Ga0501047_0014430 Ga0501047_0014430_3588_4367 240
43 3300049583 Ga0501067_0034607 Ga0501067_0034607_1533_2312 240
44 3300049585 Ga0501069_0020678 Ga0501069_0020678_1850_2629 240
45 3300049589 Ga0501073_0011630 Ga0501073_0011630_4623_5402 240
46 3300049590 Ga0501074_0012806 Ga0501074_0012806_4328_5107 240
47 3300049742 Ga0501080_0095428 Ga0501080_0095428_1665_2444 240
48 3300049744 Ga0501083_0054368 Ga0501083_0054368_1132_1911 240
49 3300060353 Ga0501082_0029689 Ga0501082_0029689_998_1777 240
50 3300014969 Ga0157376_10046787 Ga0157376_100467874 241
51 3300046471 Ga0495650_0000134 Ga0495650_0000134_46756_47487 241
52 3300053079 Ga0500610_0000345 Ga0500610_0000345_9716_10474 245
53 3300002737 JGI25162J39368_1000457 JGI25162J39368_10004574 246
54 3300002772 JGI25164J39214_1001616 JGI25164J39214_10016163 246
55 3300003214 JGI25165J46597_1001059 JGI25165J46597_10010593 246
56 3300005344 Ga0070661_100562143 Ga0070661_1005621431 246
57 3300005367 Ga0070667_100036850 Ga0070667_1000368501 246
58 3300005455 Ga0070663_100073715 Ga0070663_1000737152 246
59 3300005539 Ga0068853_100025999 Ga0068853_1000259994 246
60 3300005539 Ga0068853_100451730 Ga0068853_1004517302 246
61 3300005548 Ga0070665_100011422 Ga0070665_1000114224 246
62 3300005563 Ga0068855_100065827 Ga0068855_1000658272 246
63 3300025231 Ga0207427_100101 Ga0207427_10010179 246
64 3300025233 Ga0209437_100090 Ga0209437_100090184 246
65 3300025261 Ga0209233_1000077 Ga0209233_1000077281 246
66 3300025303 Ga0209051_1032041 Ga0209051_10320411 246
67 3300025949 Ga0207667_10106161 Ga0207667_101061612 246
68 3300025986 Ga0207658_10037455 Ga0207658_100374551 246
69 3300026041 Ga0207639_10005309 Ga0207639_100053094 246
70 3300026041 Ga0207639_10594250 Ga0207639_105942502 246
71 3300041452 Ga0451793_0372935 Ga0451793_0372935_443_1198 246
72 3300041452 Ga0451793_1087444 Ga0451793_1087444_981_1736 246
73 3300041460 Ga0451802_1322396 Ga0451802_1322396_1155_1910 246
74 3300041486 Ga0451807_0411699 Ga0451807_0411699_620_1375 246
75 3300041512 Ga0451853_1059132 Ga0451853_1059132_1058_1813 246
76 3300041512 Ga0451853_1715748 Ga0451853_1715748_276_1031 246
77 3300049569 Ga0501032_0004374 Ga0501032_0004374_776_1537 246
78 3300049572 Ga0501036_0005114 Ga0501036_0005114_6346_7107 246
79 3300049573 Ga0501037_0002129 Ga0501037_0002129_6847_7608 246
80 3300049574 Ga0501038_0003621 Ga0501038_0003621_13311_14072 246
81 3300049576 Ga0501040_0159895 Ga0501040_0159895_419_1180 246
82 3300049579 Ga0501043_0004589 Ga0501043_0004589_2440_3201 246
83 3300049581 Ga0501047_0006716 Ga0501047_0006716_2510_3271 246
84 3300049582 Ga0501048_0020426 Ga0501048_0020426_730_1491 246
85 3300049742 Ga0501080_0040386 Ga0501080_0040386_1364_2125 246
86 3300049822 Ga0501035_0040349 Ga0501035_0040349_2364_3125 246
87 3300053093 Ga0500651_0001227 Ga0500651_0001227_4321_5079 246
88 iso_pu_bacteria 2537561836 2538834168 246
89 iso_pu_bacteria 2643221562 2643831027 246
90 iso_pu_bacteria 2939611941 2939615387 246
91 3300005719 Ga0068861_100089726 Ga0068861_1000897262 247
92 3300026118 Ga0207675_100128663 Ga0207675_1001286632 247
93 3300031824 Ga0307413_10136594 Ga0307413_101365942 247
94 iso_pu_bacteria 2928963466 2928966054 247
95 3300005331 Ga0070670_100243546 Ga0070670_1002435462 248
96 3300005337 Ga0070682_100015585 Ga0070682_1000155856 248
97 3300005347 Ga0070668_100337937 Ga0070668_1003379372 248
98 3300005366 Ga0070659_100079975 Ga0070659_1000799752 248
99 3300005444 Ga0070694_100028090 Ga0070694_1000280902 248
100 3300005455 Ga0070663_100088925 Ga0070663_1000889252 248
101 3300005539 Ga0068853_100014101 Ga0068853_10001410110 248
102 3300005548 Ga0070665_100008899 Ga0070665_1000088998 248
103 3300005563 Ga0068855_100001890 Ga0068855_10000189018 248
104 3300005563 Ga0068855_100170961 Ga0068855_1001709613 248
105 3300005577 Ga0068857_100021406 Ga0068857_1000214063 248
106 3300005577 Ga0068857_100396762 Ga0068857_1003967622 248
107 3300005841 Ga0068863_100003295 Ga0068863_1000032956 248
108 3300009174 Ga0105241_10168733 Ga0105241_101687333 248
109 3300009545 Ga0105237_10027599 Ga0105237_100275993 248
110 3300009551 Ga0105238_10006112 Ga0105238_1000611215 248
111 3300009551 Ga0105238_10083559 Ga0105238_100835591 248
112 3300013100 Ga0157373_10014269 Ga0157373_100142692 248
113 3300013102 Ga0157371_10342200 Ga0157371_103422002 248
114 3300013104 Ga0157370_10030613 Ga0157370_100306139 248
115 3300013307 Ga0157372_10035393 Ga0157372_100353932 248
116 3300014325 Ga0163163_10682434 Ga0163163_106824342 248
117 3300014497 Ga0182008_10056383 Ga0182008_100563832 248
118 3300025914 Ga0207671_10022218 Ga0207671_100222183 248
119 3300025932 Ga0207690_10179154 Ga0207690_101791542 248
120 3300025940 Ga0207691_10006803 Ga0207691_100068037 248
121 3300025949 Ga0207667_10441915 Ga0207667_104419151 248
122 3300025986 Ga0207658_10742779 Ga0207658_107427791 248
123 3300026041 Ga0207639_10011555 Ga0207639_100115553 248
124 3300026041 Ga0207639_10074274 Ga0207639_100742744 248
125 3300026067 Ga0207678_10021457 Ga0207678_100214572 248
126 3300026088 Ga0207641_10015851 Ga0207641_100158512 248
127 3300026116 Ga0207674_10047398 Ga0207674_100473982 248
128 3300026121 Ga0207683_10395370 Ga0207683_103953702 248
129 3300028379 Ga0268266_10012259 Ga0268266_100122594 248
130 3300028379 Ga0268266_10119215 Ga0268266_101192152 248
131 3300046460 Ga0495638_0000315 Ga0495638_0000315_14881_15639 248
132 3300048907 Ga0496104_0053490 Ga0496104_0053490_242_1000 248
133 3300048918 Ga0496115_0127977 Ga0496115_0127977_1157_1915 248
134 3300048924 Ga0496121_0086441 Ga0496121_0086441_237_995 248
135 3300049568 Ga0501031_0226815 Ga0501031_0226815_233_1018 248
136 3300049571 Ga0501034_0121721 Ga0501034_0121721_493_1278 248
137 3300049572 Ga0501036_0129768 Ga0501036_0129768_207_992 248
138 3300049586 Ga0501070_0055044 Ga0501070_0055044_176_961 248
139 3300049822 Ga0501035_0004676 Ga0501035_0004676_11198_11983 248
140 3300049823 Ga0501044_0028353 Ga0501044_0028353_4290_5075 248
141 3300005337 Ga0070682_100002308 Ga0070682_10000230813 249
142 3300005337 Ga0070682_100077530 Ga0070682_1000775303 249
143 3300005339 Ga0070660_100015288 Ga0070660_1000152888 249
144 3300005366 Ga0070659_100000049 Ga0070659_10000004988 249
145 3300005983 Ga0081540_1010827 Ga0081540_10108273 249
146 3300006237 Ga0097621_100018286 Ga0097621_1000182867 249
147 3300013104 Ga0157370_10074051 Ga0157370_100740513 249
148 3300013307 Ga0157372_10001614 Ga0157372_1000161412 249
149 3300025924 Ga0207694_10033608 Ga0207694_100336082 249
150 3300041494 Ga0451837_0827185 Ga0451837_0827185_421_1203 249
151 3300044658 Ga0466972_0019183 Ga0466972_0019183_190_978 249
152 3300044765 Ga0466970_0002722 Ga0466970_0002722_5264_6052 249
153 3300048905 Ga0496102_0336298 Ga0496102_0336298_639_1397 249
154 3300048910 Ga0496107_0150555 Ga0496107_0150555_198_980 249
155 3300048918 Ga0496115_0008533 Ga0496115_0008533_6327_7085 249
156 3300049569 Ga0501032_0008251 Ga0501032_0008251_4446_5228 249
157 3300049571 Ga0501034_0003837 Ga0501034_0003837_3550_4332 249
158 3300049574 Ga0501038_0066166 Ga0501038_0066166_508_1290 249
159 3300049575 Ga0501039_0120171 Ga0501039_0120171_385_1167 249
160 3300049576 Ga0501040_0016131 Ga0501040_0016131_3300_4082 249
161 3300049578 Ga0501042_0146030 Ga0501042_0146030_402_1184 249
162 3300049579 Ga0501043_0023334 Ga0501043_0023334_3641_4423 249
163 3300049580 Ga0501046_0010388 Ga0501046_0010388_3747_4529 249
164 3300049582 Ga0501048_0012744 Ga0501048_0012744_3457_4239 249
165 3300049583 Ga0501067_0007285 Ga0501067_0007285_279_1061 249
166 3300049584 Ga0501068_0005227 Ga0501068_0005227_2786_3568 249
167 3300049585 Ga0501069_0000398 Ga0501069_0000398_12414_13196 249
168 3300049587 Ga0501071_0003329 Ga0501071_0003329_3260_4042 249
169 3300049589 Ga0501073_0005472 Ga0501073_0005472_6481_7263 249
170 3300049589 Ga0501073_0097845 Ga0501073_0097845_66_833 249
171 3300049590 Ga0501074_0004768 Ga0501074_0004768_2649_3431 249
172 3300049592 Ga0501076_0021194 Ga0501076_0021194_3297_4079 249
173 3300049743 Ga0501081_0004976 Ga0501081_0004976_4320_5102 249
174 3300049744 Ga0501083_0000593 Ga0501083_0000593_13303_14085 249
175 3300049822 Ga0501035_0009873 Ga0501035_0009873_3550_4332 249
176 3300049823 Ga0501044_0021662 Ga0501044_0021662_3422_4204 249
177 3300049823 Ga0501044_0259992 Ga0501044_0259992_838_1620 249
178 3300054114 Ga0501084_0015794 Ga0501084_0015794_5111_5893 249
179 3300060353 Ga0501082_0013720 Ga0501082_0013720_3211_3993 249
180 3300002737 JGI25162J39368_1000429 JGI25162J39368_100042932 250
181 3300002772 JGI25164J39214_1000939 JGI25164J39214_100093911 250
182 3300003214 JGI25165J46597_1002083 JGI25165J46597_10020831 250
183 3300005339 Ga0070660_100087929 Ga0070660_1000879293 250
184 3300005339 Ga0070660_100627319 Ga0070660_1006273191 250
185 3300005345 Ga0070692_10007409 Ga0070692_100074094 250
186 3300005366 Ga0070659_100100823 Ga0070659_1001008233 250
187 3300005366 Ga0070659_100168206 Ga0070659_1001682062 250
188 3300005367 Ga0070667_100000040 Ga0070667_10000004073 250
189 3300005435 Ga0070714_100000073 Ga0070714_10000007377 250
190 3300005435 Ga0070714_100007926 Ga0070714_1000079265 250
191 3300005436 Ga0070713_100001201 Ga0070713_10000120122 250
192 3300005455 Ga0070663_100000557 Ga0070663_1000005575 250
193 3300005457 Ga0070662_100005129 Ga0070662_10000512910 250
194 3300005458 Ga0070681_10198168 Ga0070681_101981682 250
195 3300005530 Ga0070679_100071688 Ga0070679_1000716883 250
196 3300005539 Ga0068853_100005307 Ga0068853_1000053075 250
197 3300005539 Ga0068853_100388464 Ga0068853_1003884642 250
198 3300005546 Ga0070696_100069161 Ga0070696_1000691612 250
199 3300005547 Ga0070693_100048689 Ga0070693_1000486893 250
200 3300005614 Ga0068856_100054344 Ga0068856_1000543445 250
201 3300009177 Ga0105248_10001590 Ga0105248_100015902 250
202 3300009545 Ga0105237_10001639 Ga0105237_1000163917 250
203 3300009545 Ga0105237_10079760 Ga0105237_100797604 250
204 3300009553 Ga0105249_10000250 Ga0105249_100002508 250
205 3300010375 Ga0105239_10097887 Ga0105239_100978873 250
206 3300013100 Ga0157373_10006952 Ga0157373_1000695210 250
207 3300013100 Ga0157373_10083998 Ga0157373_100839983 250
208 3300013102 Ga0157371_10051055 Ga0157371_100510553 250
209 3300013102 Ga0157371_10143564 Ga0157371_101435642 250
210 3300013104 Ga0157370_10008905 Ga0157370_100089056 250
211 3300013105 Ga0157369_10201698 Ga0157369_102016983 250
212 3300013307 Ga0157372_10117219 Ga0157372_101172193 250
213 3300014497 Ga0182008_10019397 Ga0182008_100193972 250
214 3300014497 Ga0182008_10054974 Ga0182008_100549742 250
215 3300015261 Ga0182006_1104993 Ga0182006_11049931 250
216 3300015262 Ga0182007_10034045 Ga0182007_100340452 250
217 3300015262 Ga0182007_10060566 Ga0182007_100605662 250
218 3300025231 Ga0207427_100049 Ga0207427_100049157 250
219 3300025233 Ga0209437_100083 Ga0209437_10008385 250
220 3300025250 Ga0209026_1000114 Ga0209026_100011453 250
221 3300025250 Ga0209026_1012069 Ga0209026_10120693 250
222 3300025261 Ga0209233_1000075 Ga0209233_1000075239 250
223 3300025261 Ga0209233_1000422 Ga0209233_100042215 250
224 3300025904 Ga0207647_10011626 Ga0207647_100116265 250
225 3300025914 Ga0207671_10006599 Ga0207671_100065997 250
226 3300025915 Ga0207693_10028201 Ga0207693_100282013 250
227 3300025919 Ga0207657_10019272 Ga0207657_100192724 250
228 3300025919 Ga0207657_10043965 Ga0207657_100439652 250
229 3300025919 Ga0207657_10218418 Ga0207657_102184182 250
230 3300025919 Ga0207657_10332730 Ga0207657_103327302 250
231 3300025929 Ga0207664_10000041 Ga0207664_10000041128 250
232 3300025929 Ga0207664_10000244 Ga0207664_1000024446 250
233 3300025929 Ga0207664_10067493 Ga0207664_100674933 250
234 3300025932 Ga0207690_10000124 Ga0207690_1000012423 250
235 3300025932 Ga0207690_10009013 Ga0207690_100090135 250
236 3300025932 Ga0207690_10021089 Ga0207690_100210892 250
237 3300025932 Ga0207690_10047770 Ga0207690_100477702 250
238 3300025933 Ga0207706_10006338 Ga0207706_1000633814 250
239 3300025933 Ga0207706_10212609 Ga0207706_102126092 250
240 3300025941 Ga0207711_10000924 Ga0207711_100009242 250
241 3300025986 Ga0207658_10000020 Ga0207658_10000020147 250
242 3300026041 Ga0207639_10161342 Ga0207639_101613423 250
243 3300026067 Ga0207678_10000631 Ga0207678_1000063117 250
244 3300026116 Ga0207674_10333676 Ga0207674_103336762 250
245 3300037466 Ga0395898_0051854 Ga0395898_0051854_2504_3298 250
246 3300038443 Ga0395901_0002598 Ga0395901_0002598_12975_13769 250
247 3300038443 Ga0395901_0352682 Ga0395901_0352682_173_967 250
248 3300042005 Ga0439448_0018611 Ga0439448_0018611_830_1624 250
249 3300042012 Ga0439455_0065832 Ga0439455_0065832_68_862 250
250 3300048925 Ga0496122_0000037 Ga0496122_0000037_233937_234734 250
251 3300048926 Ga0496123_0000083 Ga0496123_0000083_33254_34051 250
252 3300048929 Ga0496126_0408052 Ga0496126_0408052_106_903 250
253 3300049581 Ga0501047_0145188 Ga0501047_0145188_825_1598 250
254 3300049584 Ga0501068_0014281 Ga0501068_0014281_1126_1905 250
255 3300049587 Ga0501071_0293187 Ga0501071_0293187_425_1204 250
256 3300049589 Ga0501073_0073755 Ga0501073_0073755_110_883 250
257 3300049590 Ga0501074_0181915 Ga0501074_0181915_248_1018 250
258 3300049742 Ga0501080_0021033 Ga0501080_0021033_2767_3537 250
259 3300049823 Ga0501044_0016603 Ga0501044_0016603_5278_6048 250
260 3300053087 Ga0500643_002228 Ga0500643_002228_4312_5109 250
261 3300053120 Ga0500597_000043 Ga0500597_000043_18845_19642 250
262 3300001979 JGI24740J21852_10000197 JGI24740J21852_1000019715 251
263 3300001979 JGI24740J21852_10000549 JGI24740J21852_1000054915 251
264 3300003320 rootH2_10082137 rootH2_100821372 251
265 3300003762 Ga0055542_1001381 Ga0055542_100138114 251
266 3300005327 Ga0070658_10029596 Ga0070658_100295962 251
267 3300005329 Ga0070683_100059162 Ga0070683_1000591623 251
268 3300005329 Ga0070683_100089335 Ga0070683_1000893351 251
269 3300005329 Ga0070683_100098084 Ga0070683_1000980841 251
270 3300005331 Ga0070670_100017467 Ga0070670_1000174676 251
271 3300005334 Ga0068869_100104201 Ga0068869_1001042013 251
272 3300005335 Ga0070666_10093497 Ga0070666_100934972 251
273 3300005336 Ga0070680_100000374 Ga0070680_10000037416 251
274 3300005336 Ga0070680_100041948 Ga0070680_1000419482 251
275 3300005336 Ga0070680_100059399 Ga0070680_1000593994 251
276 3300005337 Ga0070682_100002045 Ga0070682_1000020452 251
277 3300005337 Ga0070682_100045627 Ga0070682_1000456271 251
278 3300005339 Ga0070660_100096042 Ga0070660_1000960421 251
279 3300005339 Ga0070660_100103091 Ga0070660_1001030911 251
280 3300005339 Ga0070660_100442536 Ga0070660_1004425361 251
281 3300005341 Ga0070691_10045568 Ga0070691_100455681 251
282 3300005341 Ga0070691_10066731 Ga0070691_100667311 251
283 3300005341 Ga0070691_10090623 Ga0070691_100906232 251
284 3300005344 Ga0070661_100002497 Ga0070661_1000024973 251
285 3300005344 Ga0070661_100020267 Ga0070661_1000202673 251
286 3300005344 Ga0070661_100033645 Ga0070661_1000336453 251
287 3300005344 Ga0070661_100041284 Ga0070661_1000412841 251
288 3300005344 Ga0070661_100158096 Ga0070661_1001580962 251
289 3300005344 Ga0070661_100212747 Ga0070661_1002127472 251
290 3300005345 Ga0070692_10001542 Ga0070692_100015428 251
291 3300005345 Ga0070692_10002241 Ga0070692_100022416 251
292 3300005345 Ga0070692_10074878 Ga0070692_100748782 251
293 3300005347 Ga0070668_100019986 Ga0070668_1000199862 251
294 3300005366 Ga0070659_100079917 Ga0070659_1000799172 251
295 3300005367 Ga0070667_100005144 Ga0070667_10000514411 251
296 3300005367 Ga0070667_100085225 Ga0070667_1000852252 251
297 3300005367 Ga0070667_100118822 Ga0070667_1001188223 251
298 3300005367 Ga0070667_100508521 Ga0070667_1005085211 251
299 3300005439 Ga0070711_100050513 Ga0070711_1000505132 251
300 3300005455 Ga0070663_100005398 Ga0070663_1000053983 251
301 3300005455 Ga0070663_100095630 Ga0070663_1000956302 251
302 3300005455 Ga0070663_100103650 Ga0070663_1001036503 251
303 3300005458 Ga0070681_10000251 Ga0070681_1000025124 251
304 3300005458 Ga0070681_10002412 Ga0070681_1000241211 251
305 3300005458 Ga0070681_10129151 Ga0070681_101291511 251
306 3300005466 Ga0070685_10043638 Ga0070685_100436383 251
307 3300005530 Ga0070679_100000042 Ga0070679_10000004237 251
308 3300005530 Ga0070679_100000076 Ga0070679_10000007648 251
309 3300005530 Ga0070679_100140959 Ga0070679_1001409593 251
310 3300005535 Ga0070684_100089773 Ga0070684_1000897733 251
311 3300005539 Ga0068853_100016628 Ga0068853_1000166283 251
312 3300005539 Ga0068853_100034137 Ga0068853_1000341374 251
313 3300005539 Ga0068853_100063868 Ga0068853_1000638683 251
314 3300005546 Ga0070696_100012739 Ga0070696_1000127394 251
315 3300005546 Ga0070696_100049281 Ga0070696_1000492813 251
316 3300005547 Ga0070693_100003927 Ga0070693_10000392710 251
317 3300005547 Ga0070693_100022370 Ga0070693_1000223703 251
318 3300005548 Ga0070665_100000065 Ga0070665_100000065131 251
319 3300005548 Ga0070665_100098877 Ga0070665_1000988773 251
320 3300005548 Ga0070665_100134486 Ga0070665_1001344863 251
321 3300005563 Ga0068855_100010746 Ga0068855_1000107465 251
322 3300005563 Ga0068855_100673176 Ga0068855_1006731761 251
323 3300005564 Ga0070664_100018793 Ga0070664_1000187936 251
324 3300005564 Ga0070664_100155896 Ga0070664_1001558962 251
325 3300005577 Ga0068857_100024731 Ga0068857_1000247315 251
326 3300005577 Ga0068857_100060045 Ga0068857_1000600452 251
327 3300005577 Ga0068857_100118044 Ga0068857_1001180442 251
328 3300005577 Ga0068857_100160729 Ga0068857_1001607293 251
329 3300005578 Ga0068854_100007571 Ga0068854_1000075711 251
330 3300005614 Ga0068856_100089816 Ga0068856_1000898163 251
331 3300005614 Ga0068856_100226159 Ga0068856_1002261591 251
332 3300005616 Ga0068852_100033448 Ga0068852_1000334484 251
333 3300005616 Ga0068852_100043283 Ga0068852_1000432832 251
334 3300005616 Ga0068852_100073271 Ga0068852_1000732712 251
335 3300005616 Ga0068852_100073816 Ga0068852_1000738163 251
336 3300005617 Ga0068859_100000480 Ga0068859_1000004809 251
337 3300005618 Ga0068864_100073081 Ga0068864_1000730812 251
338 3300005834 Ga0068851_10014578 Ga0068851_100145783 251
339 3300005834 Ga0068851_10024582 Ga0068851_100245823 251
340 3300005834 Ga0068851_10053099 Ga0068851_100530993 251
341 3300005842 Ga0068858_100178648 Ga0068858_1001786482 251
342 3300005843 Ga0068860_100071429 Ga0068860_1000714293 251
343 3300005843 Ga0068860_100821202 Ga0068860_1008212022 251
344 3300005844 Ga0068862_100000041 Ga0068862_100000041119 251
345 3300005844 Ga0068862_100109646 Ga0068862_1001096463 251
346 3300005937 Ga0081455_10137200 Ga0081455_101372001 251
347 3300006237 Ga0097621_100031005 Ga0097621_1000310053 251
348 3300006237 Ga0097621_100067876 Ga0097621_1000678763 251
349 3300006237 Ga0097621_100086367 Ga0097621_1000863672 251
350 3300006358 Ga0068871_100093684 Ga0068871_1000936842 251
351 3300006931 Ga0097620_100000480 Ga0097620_1000004809 251
352 3300009093 Ga0105240_10161137 Ga0105240_101611373 251
353 3300009093 Ga0105240_10187918 Ga0105240_101879183 251
354 3300009093 Ga0105240_10379020 Ga0105240_103790202 251
355 3300009174 Ga0105241_10211756 Ga0105241_102117562 251
356 3300009545 Ga0105237_10129630 Ga0105237_101296302 251
357 3300009545 Ga0105237_10435917 Ga0105237_104359172 251
358 3300009545 Ga0105237_10458183 Ga0105237_104581832 251
359 3300009551 Ga0105238_10117112 Ga0105238_101171122 251
360 3300009551 Ga0105238_10220972 Ga0105238_102209722 251
361 3300010375 Ga0105239_10000033 Ga0105239_10000033190 251
362 3300010375 Ga0105239_11180680 Ga0105239_111806801 251
363 3300013100 Ga0157373_10007373 Ga0157373_100073734 251
364 3300013100 Ga0157373_10015069 Ga0157373_100150693 251
365 3300013100 Ga0157373_10164767 Ga0157373_101647671 251
366 3300013102 Ga0157371_10080661 Ga0157371_100806613 251
367 3300013104 Ga0157370_10002987 Ga0157370_1000298712 251
368 3300013104 Ga0157370_10009699 Ga0157370_1000969910 251
369 3300013104 Ga0157370_10076373 Ga0157370_100763734 251
370 3300013104 Ga0157370_10236435 Ga0157370_102364352 251
371 3300013105 Ga0157369_10003531 Ga0157369_100035318 251
372 3300013105 Ga0157369_10119020 Ga0157369_101190203 251
373 3300013296 Ga0157374_10154998 Ga0157374_101549983 251
374 3300013307 Ga0157372_10001681 Ga0157372_1000168119 251
375 3300013307 Ga0157372_10002772 Ga0157372_1000277213 251
376 3300013307 Ga0157372_10011770 Ga0157372_100117709 251
377 3300013307 Ga0157372_10113492 Ga0157372_101134924 251
378 3300014325 Ga0163163_10098349 Ga0163163_100983492 251
379 3300014969 Ga0157376_10095479 Ga0157376_100954792 251
380 3300014969 Ga0157376_10207832 Ga0157376_102078322 251
381 3300020069 Ga0197907_10546852 Ga0197907_105468523 251
382 3300020069 Ga0197907_10616062 Ga0197907_106160623 251
383 3300020070 Ga0206356_10223288 Ga0206356_102232889 251
384 3300020070 Ga0206356_10379234 Ga0206356_103792342 251
385 3300020070 Ga0206356_11587018 Ga0206356_115870181 251
386 3300020078 Ga0206352_11085077 Ga0206352_110850773 251
387 3300020081 Ga0206354_10521916 Ga0206354_105219168 251
388 3300020081 Ga0206354_11462809 Ga0206354_114628092 251
389 3300020082 Ga0206353_11179387 Ga0206353_111793874 251
390 3300020082 Ga0206353_11499556 Ga0206353_114995564 251
391 3300020610 Ga0154015_1013787 Ga0154015_10137875 251
392 3300022467 Ga0224712_10009975 Ga0224712_100099752 251
393 3300025233 Ga0209437_100162 Ga0209437_100162117 251
394 3300025242 Ga0209258_108425 Ga0209258_1084252 251
395 3300025250 Ga0209026_1007845 Ga0209026_10078452 251
396 3300025254 Ga0209148_1000005 Ga0209148_10000051496 251
397 3300025256 Ga0209759_1001788 Ga0209759_100178813 251
398 3300025261 Ga0209233_1014868 Ga0209233_10148683 251
399 3300025321 Ga0207656_10013532 Ga0207656_100135323 251
400 3300025321 Ga0207656_10016411 Ga0207656_100164113 251
401 3300025903 Ga0207680_10052536 Ga0207680_100525362 251
402 3300025904 Ga0207647_10004302 Ga0207647_100043029 251
403 3300025904 Ga0207647_10016537 Ga0207647_100165374 251
404 3300025909 Ga0207705_10000576 Ga0207705_1000057614 251
405 3300025909 Ga0207705_10003322 Ga0207705_100033226 251
406 3300025909 Ga0207705_10049962 Ga0207705_100499622 251
407 3300025909 Ga0207705_10052922 Ga0207705_100529222 251
408 3300025912 Ga0207707_10000120 Ga0207707_1000012048 251
409 3300025912 Ga0207707_10000366 Ga0207707_1000036650 251
410 3300025912 Ga0207707_10000609 Ga0207707_1000060921 251
411 3300025912 Ga0207707_10000708 Ga0207707_1000070832 251
412 3300025912 Ga0207707_10008509 Ga0207707_100085099 251
413 3300025913 Ga0207695_10003100 Ga0207695_1000310010 251
414 3300025913 Ga0207695_10005368 Ga0207695_1000536817 251
415 3300025913 Ga0207695_10008399 Ga0207695_100083993 251
416 3300025913 Ga0207695_10009305 Ga0207695_100093052 251
417 3300025914 Ga0207671_10212605 Ga0207671_102126052 251
418 3300025914 Ga0207671_10368299 Ga0207671_103682991 251
419 3300025916 Ga0207663_10080276 Ga0207663_100802762 251
420 3300025917 Ga0207660_10000315 Ga0207660_1000031516 251
421 3300025917 Ga0207660_10000330 Ga0207660_1000033016 251
422 3300025917 Ga0207660_10000458 Ga0207660_100004589 251
423 3300025917 Ga0207660_10000518 Ga0207660_1000051814 251
424 3300025917 Ga0207660_10001799 Ga0207660_100017998 251
425 3300025917 Ga0207660_10002853 Ga0207660_100028533 251
426 3300025917 Ga0207660_10003827 Ga0207660_100038276 251
427 3300025917 Ga0207660_10105831 Ga0207660_101058312 251
428 3300025919 Ga0207657_10007839 Ga0207657_100078396 251
429 3300025919 Ga0207657_10009233 Ga0207657_100092337 251
430 3300025919 Ga0207657_10079240 Ga0207657_100792403 251
431 3300025919 Ga0207657_10081042 Ga0207657_100810421 251
432 3300025919 Ga0207657_10142327 Ga0207657_101423272 251
433 3300025920 Ga0207649_10000857 Ga0207649_100008579 251
434 3300025920 Ga0207649_10007030 Ga0207649_100070302 251
435 3300025920 Ga0207649_10028609 Ga0207649_100286091 251
436 3300025920 Ga0207649_10311580 Ga0207649_103115802 251
437 3300025921 Ga0207652_10000048 Ga0207652_1000004861 251
438 3300025921 Ga0207652_10000117 Ga0207652_1000011763 251
439 3300025921 Ga0207652_10000298 Ga0207652_1000029825 251
440 3300025921 Ga0207652_10000893 Ga0207652_1000089318 251
441 3300025921 Ga0207652_10001249 Ga0207652_100012493 251
442 3300025921 Ga0207652_10068775 Ga0207652_100687753 251
443 3300025921 Ga0207652_10077158 Ga0207652_100771582 251
444 3300025924 Ga0207694_10095767 Ga0207694_100957671 251
445 3300025924 Ga0207694_10137197 Ga0207694_101371972 251
446 3300025924 Ga0207694_10269202 Ga0207694_102692022 251
447 3300025931 Ga0207644_10033218 Ga0207644_100332182 251
448 3300025932 Ga0207690_10003133 Ga0207690_100031339 251
449 3300025932 Ga0207690_10004638 Ga0207690_100046388 251
450 3300025932 Ga0207690_10068290 Ga0207690_100682902 251
451 3300025936 Ga0207670_10077942 Ga0207670_100779423 251
452 3300025944 Ga0207661_10001633 Ga0207661_1000163315 251
453 3300025944 Ga0207661_10005397 Ga0207661_100053979 251
454 3300025944 Ga0207661_10007696 Ga0207661_100076967 251
455 3300025945 Ga0207679_10106695 Ga0207679_101066952 251
456 3300025949 Ga0207667_10000619 Ga0207667_1000061928 251
457 3300025949 Ga0207667_10001130 Ga0207667_1000113019 251
458 3300025949 Ga0207667_10001386 Ga0207667_1000138620 251
459 3300025949 Ga0207667_10006308 Ga0207667_100063086 251
460 3300025949 Ga0207667_10013934 Ga0207667_100139343 251
461 3300025949 Ga0207667_10068444 Ga0207667_100684443 251
462 3300025972 Ga0207668_10057334 Ga0207668_100573343 251
463 3300025981 Ga0207640_10002929 Ga0207640_100029299 251
464 3300025981 Ga0207640_10003876 Ga0207640_100038768 251
465 3300025981 Ga0207640_10009676 Ga0207640_100096765 251
466 3300025981 Ga0207640_10037193 Ga0207640_100371931 251
467 3300025986 Ga0207658_10022446 Ga0207658_100224463 251
468 3300025986 Ga0207658_10322648 Ga0207658_103226482 251
469 3300025986 Ga0207658_10341190 Ga0207658_103411901 251
470 3300026041 Ga0207639_10001883 Ga0207639_1000188310 251
471 3300026041 Ga0207639_10003939 Ga0207639_100039392 251
472 3300026041 Ga0207639_10013754 Ga0207639_100137544 251
473 3300026067 Ga0207678_10001671 Ga0207678_100016713 251
474 3300026067 Ga0207678_10005524 Ga0207678_100055247 251
475 3300026067 Ga0207678_10010783 Ga0207678_100107838 251
476 3300026067 Ga0207678_10012919 Ga0207678_100129192 251
477 3300026067 Ga0207678_10032837 Ga0207678_100328374 251
478 3300026067 Ga0207678_10082656 Ga0207678_100826561 251
479 3300026067 Ga0207678_10082666 Ga0207678_100826663 251
480 3300026078 Ga0207702_10001898 Ga0207702_100018983 251
481 3300026078 Ga0207702_10002109 Ga0207702_1000210918 251
482 3300026078 Ga0207702_10007502 Ga0207702_100075029 251
483 3300026078 Ga0207702_10033751 Ga0207702_100337512 251
484 3300026078 Ga0207702_10119123 Ga0207702_101191233 251
485 3300026088 Ga0207641_10041369 Ga0207641_100413692 251
486 3300026088 Ga0207641_10260438 Ga0207641_102604381 251
487 3300026116 Ga0207674_10001028 Ga0207674_1000102823 251
488 3300026116 Ga0207674_10030234 Ga0207674_100302344 251
489 3300026116 Ga0207674_10062334 Ga0207674_100623342 251
490 3300026116 Ga0207674_10138498 Ga0207674_101384982 251
491 3300026142 Ga0207698_10001577 Ga0207698_1000157715 251
492 3300026142 Ga0207698_10005254 Ga0207698_100052548 251
493 3300026142 Ga0207698_10040132 Ga0207698_100401322 251
494 3300028379 Ga0268266_10000001 Ga0268266_10000001257 251
495 3300028379 Ga0268266_10180568 Ga0268266_101805682 251
496 3300028379 Ga0268266_10218855 Ga0268266_102188552 251
497 3300028380 Ga0268265_10000208 Ga0268265_1000020823 251
498 3300028380 Ga0268265_10089326 Ga0268265_100893262 251
499 3300028381 Ga0268264_10039137 Ga0268264_100391372 251
500 3300028381 Ga0268264_10164286 Ga0268264_101642863 251
501 3300028381 Ga0268264_10333205 Ga0268264_103332052 251
502 3300033179 Ga0307507_10122110 Ga0307507_101221102 251
503 3300037312 Ga0395899_0014577 Ga0395899_0014577_1938_2693 251
504 3300037418 Ga0395900_0120499 Ga0395900_0120499_1332_2087 251
505 3300038443 Ga0395901_0243406 Ga0395901_0243406_326_1081 251
506 3300041452 Ga0451793_0531026 Ga0451793_0531026_35_808 251
507 3300045976 Ga0466967_0248776 Ga0466967_0248776_302_1081 251
508 3300046460 Ga0495638_0000106 Ga0495638_0000106_28839_29603 251
509 3300046460 Ga0495638_0000200 Ga0495638_0000200_52632_53399 251
510 3300046461 Ga0495641_0065257 Ga0495641_0065257_636_1409 251
511 3300046507 Ga0495606_0001413 Ga0495606_0001413_19615_20382 251
512 3300046694 Ga0495649_0000573 Ga0495649_0000573_18528_19295 251
513 3300048908 Ga0496105_0039280 Ga0496105_0039280_80_847 251
514 3300048910 Ga0496107_0127729 Ga0496107_0127729_1067_1840 251
515 3300048917 Ga0496114_0069463 Ga0496114_0069463_1884_2657 251
516 3300048918 Ga0496115_0003509 Ga0496115_0003509_236_1003 251
517 3300048918 Ga0496115_0172360 Ga0496115_0172360_747_1514 251
518 3300048922 Ga0496119_0000776 Ga0496119_0000776_27433_28200 251
519 3300048923 Ga0496120_0000874 Ga0496120_0000874_27433_28200 251
520 3300048929 Ga0496126_0058088 Ga0496126_0058088_2485_3252 251
521 3300048929 Ga0496126_0129810 Ga0496126_0129810_399_1172 251
522 3300049460 Ga0495682_0004117 Ga0495682_0004117_236_1003 251
523 3300049570 Ga0501033_0036558 Ga0501033_0036558_1918_2724 251
524 3300049572 Ga0501036_0129178 Ga0501036_0129178_215_970 251
525 3300049574 Ga0501038_0035813 Ga0501038_0035813_2493_3299 251
526 3300049574 Ga0501038_0064973 Ga0501038_0064973_2204_2977 251
527 3300049580 Ga0501046_0080068 Ga0501046_0080068_1135_1908 251
528 3300049581 Ga0501047_0006644 Ga0501047_0006644_2671_3426 251
529 3300049581 Ga0501047_0009723 Ga0501047_0009723_6149_6907 251
530 3300049581 Ga0501047_0146081 Ga0501047_0146081_392_1198 251
531 3300049585 Ga0501069_0002907 Ga0501069_0002907_512_1267 251
532 3300049585 Ga0501069_0008353 Ga0501069_0008353_2041_2796 251
533 3300049585 Ga0501069_0016781 Ga0501069_0016781_574_1380 251
534 3300049585 Ga0501069_0033773 Ga0501069_0033773_1861_2616 251
535 3300049585 Ga0501069_0153641 Ga0501069_0153641_163_918 251
536 3300049586 Ga0501070_0000506 Ga0501070_0000506_17055_17810 251
537 3300049586 Ga0501070_0004605 Ga0501070_0004605_4631_5386 251
538 3300049586 Ga0501070_0014035 Ga0501070_0014035_1077_1883 251
539 3300049586 Ga0501070_0015796 Ga0501070_0015796_2537_3292 251
540 3300049586 Ga0501070_0016633 Ga0501070_0016633_956_1711 251
541 3300049586 Ga0501070_0103858 Ga0501070_0103858_30_785 251
542 3300049587 Ga0501071_0015919 Ga0501071_0015919_4358_5113 251
543 3300049589 Ga0501073_0004053 Ga0501073_0004053_1175_1930 251
544 3300049589 Ga0501073_0013584 Ga0501073_0013584_3459_4265 251
545 3300049589 Ga0501073_0037526 Ga0501073_0037526_248_1006 251
546 3300049589 Ga0501073_0217973 Ga0501073_0217973_224_997 251
547 3300049589 Ga0501073_0339874 Ga0501073_0339874_139_894 251
548 3300049590 Ga0501074_0015090 Ga0501074_0015090_4715_5473 251
549 3300049590 Ga0501074_0018862 Ga0501074_0018862_2341_3096 251
550 3300049590 Ga0501074_0071880 Ga0501074_0071880_44_802 251
551 3300049593 Ga0501077_0047588 Ga0501077_0047588_1355_2110 251
552 3300049742 Ga0501080_0015017 Ga0501080_0015017_2875_3633 251
553 3300049742 Ga0501080_0019594 Ga0501080_0019594_2924_3679 251
554 3300049742 Ga0501080_0048006 Ga0501080_0048006_2636_3409 251
555 3300049742 Ga0501080_0781477 Ga0501080_0781477_64_828 251
556 3300049822 Ga0501035_0003040 Ga0501035_0003040_9500_10258 251
557 3300049822 Ga0501035_0050963 Ga0501035_0050963_1516_2322 251
558 3300049823 Ga0501044_0043881 Ga0501044_0043881_490_1248 251
559 3300049823 Ga0501044_0055560 Ga0501044_0055560_2151_2924 251
560 3300049823 Ga0501044_0091562 Ga0501044_0091562_34_792 251
561 3300049823 Ga0501044_0165678 Ga0501044_0165678_846_1601 251
562 3300049823 Ga0501044_0203151 Ga0501044_0203151_68_871 251
563 3300053093 Ga0500651_0000113 Ga0500651_0000113_8997_9776 251
564 3300053093 Ga0500651_0008164 Ga0500651_0008164_5096_5863 251
565 3300053139 Ga0500568_0000063 Ga0500568_0000063_13441_14214 251
566 3300054114 Ga0501084_0038705 Ga0501084_0038705_3196_3969 251
567 3300054114 Ga0501084_0603264 Ga0501084_0603264_135_890 251
568 3300060353 Ga0501082_0000051 Ga0501082_0000051_31735_32508 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06167

Peptidase_M90

Glucose-regulated metallo-peptidase M90

22

262

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dl1-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution 0.8864 21 249
3dl1-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution 0.8469 21 249
3khi-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution 0.8323 21 249
3khi-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution 0.7941 21 249
1zxv-assembly2.cif.gz_B x-ray crystal structure of the anthrax lethal factor bound to a small molecule inhibitor, bi-mfm3, 3-{5-[5-(4-chloro-phenyl)-furan-2-ylmethylene]-4-oxo-2-thioxo-thiazolidin-3-yl}-propionic acid. 0.6334 151 245
ID Description Score Start End Superfamily
3dl1A01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.9107 21 141 1.10.472.150
af_P76346_16_139_1.10.472.150 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.8997 21 141 1.10.472.150
af_P76346_140_265_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8812 147 249 3.40.390.10
3dl1A01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.8748 21 141 1.10.472.150
af_P76346_16_139_1.10.472.150 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.8658 21 141 1.10.472.150
ID Description Score Start End GO Terms
AF-A0A7C3H7D3-F1-model_v4 Uncharacterized protein 0.9818 183 245 GO:0004177
GO:0005829
GO:0008237
AF-A0A2N2SDL2-F1-model_v4 Zinc-dependent peptidase 0.9787 153 249 GO:0004177
GO:0005829
GO:0008237
AF-A0A536TKS0-F1-model_v4 Zinc-dependent peptidase 0.9754 169 249 GO:0004177
GO:0005829
GO:0008237
AF-A0A7V0ZPK0-F1-model_v4 Zinc-dependent peptidase 0.9751 150 249 GO:0004177
GO:0005829
GO:0008237
AF-A0A356HDC0-F1-model_v4 deleted 0.9639 16 97

Feature Viewer

pLDDT pTM Quality
87.19 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map