F464549

General Info

Members Datasets Scaffolds Average Seq Length
567 275 1134 122

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0450214|Ga0495684_0450214_113_475
Length 114
Sequence MNKKTVVLGASANPSRYSFLAVNRLIAHGHGVIPIGKKKGTINTEQIITEPDTVTLYLNAQNQKQYYDYILSLHPKRIIFNPGAENDELAKLAAKNNIQSLEACTLVLLSTNQY

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
187 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
188 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
191 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
192 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
245 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
246 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
249 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
250 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
251 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
252 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
253 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
256 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
257 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
258 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
259 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
267 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
270 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
271 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
272 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
273 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
274 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
275 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 0
Rhizoplane 1.41
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 12.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_0450214 3300047471 Bacteria 895
2 JGI24744J21845_10036188 3300002077 Unclassified 932
3 JGI25158J39367_1035557 3300002739 Bacteria 545
4 JGI25153J46596_10005223 3300003215 Bacteria 6833
5 rootH2_10092971 3300003320 Bacteria 3688
6 rootH2_10139917 3300003320 Bacteria 2609
7 rootL2_10002814 3300003322 Bacteria 13497
8 rootL2_10002815 3300003322 Bacteria 1246
9 rootL2_10038550 3300003322 Bacteria 1959
10 rootL2_10141830 3300003322 Bacteria 2594
11 rootL2_10187862 3300003322 Unclassified 1507
12 rootL2_10350863 3300003322 Unclassified 1041
13 rootH1_10011487 3300003323 Bacteria 4598
14 rootH1_10176919 3300003323 Bacteria 1545
15 rootH1_10232739 3300003323 Bacteria 1614
16 Ga0055535_1007611 3300003761 Bacteria 2044
17 Ga0055542_1008713 3300003762 Bacteria 1964
18 Ga0055531_10000177 3300003794 Bacteria 72193
19 Ga0065165_1011946 3300005262 Bacteria 3573
20 Ga0065712_10807747 3300005290 Bacteria 502
21 Ga0070676_10015287 3300005328 Bacteria 4234
22 Ga0070683_100002331 3300005329 Bacteria 15055
23 Ga0070683_100014609 3300005329 Bacteria 6875
24 Ga0070683_100033730 3300005329 Bacteria 4669
25 Ga0070683_100055746 3300005329 Bacteria 3668
26 Ga0070683_100204993 3300005329 Bacteria 1873
27 Ga0070690_100282418 3300005330 Bacteria 1185
28 Ga0070670_100670155 3300005331 Bacteria 931
29 Ga0070670_101040234 3300005331 Bacteria 745
30 Ga0070670_101936128 3300005331 Bacteria 543
31 Ga0070670_102203316 3300005331 Unclassified 508
32 Ga0070677_10481309 3300005333 Bacteria 669
33 Ga0068869_100042970 3300005334 Unclassified 3244
34 Ga0068869_100059529 3300005334 Bacteria 2797
35 Ga0068869_100111674 3300005334 Bacteria 2080
36 Ga0068869_100339241 3300005334 Bacteria 1223
37 Ga0070666_10060939 3300005335 Bacteria 2554
38 Ga0070666_10749665 3300005335 Bacteria 718
39 Ga0070680_100140146 3300005336 Bacteria 2028
40 Ga0070682_100040200 3300005337 Bacteria 2877
41 Ga0070682_100173722 3300005337 Bacteria 1499
42 Ga0070682_100345569 3300005337 Bacteria 1107
43 Ga0070682_100436175 3300005337 Bacteria 1000
44 Ga0068868_100000427 3300005338 Bacteria 28309
45 Ga0068868_100038018 3300005338 Bacteria 3734
46 Ga0068868_100195606 3300005338 Bacteria 1683
47 Ga0068868_101059708 3300005338 Unclassified 744
48 Ga0070689_100063778 3300005340 Bacteria 2866
49 Ga0070691_10060628 3300005341 Bacteria 1819
50 Ga0070661_100048180 3300005344 Bacteria 3119
51 Ga0070661_100127711 3300005344 Bacteria 1908
52 Ga0070668_100214957 3300005347 Bacteria 1583
53 Ga0070668_100287958 3300005347 Bacteria 1374
54 Ga0070669_100199546 3300005353 Bacteria 1573
55 Ga0070669_100271669 3300005353 Bacteria 1356
56 Ga0070669_100650566 3300005353 Bacteria 887
57 Ga0070669_101449157 3300005353 Unclassified 596
58 Ga0070675_100080687 3300005354 Unclassified 2712
59 Ga0070675_100573258 3300005354 Bacteria 1022
60 Ga0070675_100728577 3300005354 Bacteria 904
61 Ga0070675_100912738 3300005354 Unclassified 805
62 Ga0070675_101542427 3300005354 Unclassified 613
63 Ga0070671_100057089 3300005355 Bacteria 3248
64 Ga0070673_100032232 3300005364 Bacteria 3943
65 Ga0070673_100224672 3300005364 Bacteria 1627
66 Ga0070673_100276350 3300005364 Bacteria 1472
67 Ga0070688_100045881 3300005365 Unclassified 2703
68 Ga0070688_100092354 3300005365 Bacteria 1980
69 Ga0070688_100133991 3300005365 Bacteria 1675
70 Ga0070659_100003555 3300005366 Bacteria 11096
71 Ga0070659_100007166 3300005366 Bacteria 8090
72 Ga0070659_100160943 3300005366 Bacteria 1835
73 Ga0070659_101557696 3300005366 Bacteria 589
74 Ga0070667_100181041 3300005367 Bacteria 1864
75 Ga0070700_100776128 3300005441 Bacteria 769
76 Ga0070700_101171579 3300005441 Unclassified 640
77 Ga0070663_100134422 3300005455 Bacteria 1882
78 Ga0070663_100309193 3300005455 Bacteria 1268
79 Ga0070663_100791196 3300005455 Bacteria 813
80 Ga0070663_101231767 3300005455 Unclassified 658
81 Ga0070678_100122957 3300005456 Bacteria 2049
82 Ga0070678_100299084 3300005456 Bacteria 1367
83 Ga0070662_100017749 3300005457 Bacteria 4801
84 Ga0070681_10035209 3300005458 Bacteria 5029
85 Ga0068867_100053979 3300005459 Bacteria 2968
86 Ga0068867_100171619 3300005459 Bacteria 1718
87 Ga0068867_100295407 3300005459 Bacteria 1334
88 Ga0068867_100436581 3300005459 Bacteria 1112
89 Ga0068867_101501512 3300005459 Bacteria 627
90 Ga0070685_10404621 3300005466 Bacteria 946
91 Ga0070685_11350276 3300005466 Bacteria 546
92 Ga0070698_100639612 3300005471 Bacteria 1005
93 Ga0070679_100062882 3300005530 Bacteria 3700
94 Ga0070684_100001198 3300005535 Bacteria 18634
95 Ga0070684_100108698 3300005535 Bacteria 2485
96 Ga0070684_100123577 3300005535 Bacteria 2329
97 Ga0070684_100680733 3300005535 Unclassified 958
98 Ga0070684_100953522 3300005535 Bacteria 804
99 Ga0070684_101151847 3300005535 Unclassified 729
100 Ga0068853_100023090 3300005539 Bacteria 5205
101 Ga0068853_100030039 3300005539 Bacteria 4587
102 Ga0068853_100080274 3300005539 Bacteria 2854
103 Ga0068853_100214822 3300005539 Bacteria 1754
104 Ga0068853_100487948 3300005539 Bacteria 1162
105 Ga0068853_100571459 3300005539 Unclassified 1072
106 Ga0068853_100957468 3300005539 Bacteria 823
107 Ga0068853_100958581 3300005539 Bacteria 823
108 Ga0070672_100393979 3300005543 Bacteria 1186
109 Ga0070686_100062477 3300005544 Bacteria 2410
110 Ga0070686_100876985 3300005544 Bacteria 728
111 Ga0070695_100593853 3300005545 Unclassified 868
112 Ga0070693_100031657 3300005547 Bacteria 2901
113 Ga0070693_100054019 3300005547 Bacteria 2308
114 Ga0070693_101244679 3300005547 Bacteria 573
115 Ga0070665_100494896 3300005548 Unclassified 1234
116 Ga0070665_101171953 3300005548 Bacteria 779
117 Ga0068855_100003306 3300005563 Bacteria 19732
118 Ga0068855_100042328 3300005563 Bacteria 5396
119 Ga0068855_100559489 3300005563 Bacteria 1237
120 Ga0068855_100643799 3300005563 Unclassified 1139
121 Ga0070664_100006530 3300005564 Bacteria 9403
122 Ga0070664_100049030 3300005564 Bacteria 3571
123 Ga0070664_100115210 3300005564 Bacteria 2349
124 Ga0068857_100007841 3300005577 Bacteria 9207
125 Ga0068857_100061304 3300005577 Bacteria 3341
126 Ga0068857_100097317 3300005577 Bacteria 2638
127 Ga0068857_100221486 3300005577 Bacteria 1728
128 Ga0068857_100347611 3300005577 Bacteria 1373
129 Ga0068857_101043035 3300005577 Bacteria 788
130 Ga0068854_100222830 3300005578 Bacteria 1493
131 Ga0068854_100333630 3300005578 Bacteria 1236
132 Ga0068854_100404332 3300005578 Bacteria 1131
133 Ga0068854_101749653 3300005578 Unclassified 569
134 Ga0068856_100216805 3300005614 Bacteria 1929
135 Ga0068856_101764219 3300005614 Bacteria 631
136 Ga0068852_100000346 3300005616 Bacteria 31188
137 Ga0068852_100268880 3300005616 Bacteria 1640
138 Ga0068852_100278831 3300005616 Bacteria 1611
139 Ga0068852_100323972 3300005616 Bacteria 1497
140 Ga0068852_100661507 3300005616 Bacteria 1053
141 Ga0068852_100716901 3300005616 Bacteria 1011
142 Ga0068852_101093493 3300005616 Bacteria 817
143 Ga0068852_101215492 3300005616 Bacteria 775
144 Ga0068852_101254028 3300005616 Bacteria 763
145 Ga0068852_102495100 3300005616 Unclassified 537
146 Ga0068852_102499066 3300005616 Bacteria 537
147 Ga0068859_100010050 3300005617 Bacteria 9542
148 Ga0068859_100017677 3300005617 Bacteria 7169
149 Ga0068859_100278282 3300005617 Unclassified 1766
150 Ga0068859_100496652 3300005617 Bacteria 1315
151 Ga0068859_101694553 3300005617 Bacteria 698
152 Ga0068864_100092812 3300005618 Bacteria 2665
153 Ga0068864_100108031 3300005618 Bacteria 2476
154 Ga0068864_100279806 3300005618 Bacteria 1557
155 Ga0068861_100449616 3300005719 Unclassified 1154
156 Ga0068861_101875835 3300005719 Bacteria 596
157 Ga0068851_10603563 3300005834 Bacteria 668
158 Ga0068851_10721474 3300005834 Bacteria 615
159 Ga0068870_10049105 3300005840 Bacteria 2224
160 Ga0068863_100203650 3300005841 Bacteria 1904
161 Ga0068863_100262904 3300005841 Unclassified 1669
162 Ga0068863_100405492 3300005841 Bacteria 1334
163 Ga0068863_100608915 3300005841 Bacteria 1081
164 Ga0068858_100134635 3300005842 Bacteria 2318
165 Ga0068858_100873658 3300005842 Bacteria 879
166 Ga0068858_100937529 3300005842 Unclassified 847
167 Ga0068860_100366940 3300005843 Bacteria 1419
168 Ga0068860_100509738 3300005843 Bacteria 1202
169 Ga0068860_100591719 3300005843 Bacteria 1114
170 Ga0068862_100104884 3300005844 Bacteria 2477
171 Ga0068862_102021780 3300005844 Bacteria 587
172 Ga0070715_10315701 3300006163 Bacteria 841
173 Ga0075366_10028680 3300006195 Bacteria 3268
174 Ga0075366_10085015 3300006195 Unclassified 1892
175 Ga0075366_10142982 3300006195 Bacteria 1447
176 Ga0097621_100526707 3300006237 Bacteria 1073
177 Ga0097621_100906189 3300006237 Bacteria 821
178 Ga0068871_100051739 3300006358 Bacteria 3326
179 Ga0068871_100111569 3300006358 Bacteria 2300
180 Ga0068871_100497524 3300006358 Bacteria 1098
181 Ga0068871_100900552 3300006358 Bacteria 820
182 Ga0068871_101137913 3300006358 Bacteria 731
183 Ga0075431_100008716 3300006847 Bacteria 10161
184 Ga0075434_100918354 3300006871 Bacteria 890
185 Ga0075429_100080141 3300006880 Bacteria 2846
186 Ga0068865_100237881 3300006881 Bacteria 1431
187 Ga0097620_100010050 3300006931 Bacteria 9542
188 Ga0097620_100017677 3300006931 Bacteria 7169
189 Ga0097620_100278285 3300006931 Unclassified 1766
190 Ga0097620_100496600 3300006931 Bacteria 1315
191 Ga0097620_101694348 3300006931 Bacteria 698
192 Ga0075435_101826815 3300007076 Bacteria 533
193 Ga0105240_10236186 3300009093 Bacteria 2121
194 Ga0105240_10979224 3300009093 Bacteria 906
195 Ga0105240_11048099 3300009093 Bacteria 870
196 Ga0111539_10555983 3300009094 Unclassified 1336
197 Ga0105245_10832482 3300009098 Bacteria 962
198 Ga0105247_10173238 3300009101 Bacteria 1436
199 Ga0114129_10012062 3300009147 Bacteria 12296
200 Ga0105241_10026780 3300009174 Bacteria 4292
201 Ga0105241_11190299 3300009174 Bacteria 721
202 Ga0105241_11761996 3300009174 Unclassified 603
203 Ga0105242_10023667 3300009176 Unclassified 4842
204 Ga0105242_10044054 3300009176 Bacteria 3612
205 Ga0105242_10117795 3300009176 Bacteria 2274
206 Ga0105242_12184496 3300009176 Bacteria 598
207 Ga0105248_10351318 3300009177 Bacteria 1660
208 Ga0105237_10000710 3300009545 Bacteria 46041
209 Ga0105237_10057690 3300009545 Bacteria 3885
210 Ga0105249_10601516 3300009553 Bacteria 1154
211 Ga0105249_10609319 3300009553 Bacteria 1147
212 Ga0105249_10800966 3300009553 Bacteria 1006
213 Ga0105239_10004686 3300010375 Bacteria 16236
214 Ga0105239_10034559 3300010375 Bacteria 5552
215 Ga0105239_10229243 3300010375 Bacteria 2084
216 Ga0105239_10533455 3300010375 Bacteria 1336
217 Ga0105239_11528456 3300010375 Bacteria 771
218 Ga0105246_10509124 3300011119 Bacteria 1024
219 Ga0157373_10084354 3300013100 Bacteria 2239
220 Ga0157371_10015828 3300013102 Bacteria 5642
221 Ga0157371_10077422 3300013102 Bacteria 2355
222 Ga0157371_10210045 3300013102 Bacteria 1397
223 Ga0157371_10303339 3300013102 Bacteria 1156
224 Ga0157371_10589256 3300013102 Unclassified 826
225 Ga0157371_10711663 3300013102 Unclassified 752
226 Ga0157370_10034994 3300013104 Bacteria 4887
227 Ga0157370_10131429 3300013104 Bacteria 2335
228 Ga0157369_10134030 3300013105 Bacteria 2623
229 Ga0157369_11241150 3300013105 Bacteria 760
230 Ga0157369_11658404 3300013105 Bacteria 650
231 Ga0157374_10000260 3300013296 Bacteria 48732
232 Ga0157374_10009429 3300013296 Bacteria 8379
233 Ga0157374_10019184 3300013296 Bacteria 6051
234 Ga0157374_10040183 3300013296 Bacteria 4307
235 Ga0157374_10140854 3300013296 Bacteria 2341
236 Ga0157374_10154441 3300013296 Bacteria 2233
237 Ga0157374_11388116 3300013296 Bacteria 725
238 Ga0157378_10095604 3300013297 Unclassified 2706
239 Ga0157378_10187857 3300013297 Bacteria 1947
240 Ga0157378_11080856 3300013297 Bacteria 839
241 Ga0157378_11758156 3300013297 Bacteria 668
242 Ga0163162_10005692 3300013306 Bacteria 12043
243 Ga0163162_10376812 3300013306 Bacteria 1552
244 Ga0163162_11131394 3300013306 Bacteria 887
245 Ga0163162_11386390 3300013306 Bacteria 800
246 Ga0163162_12144434 3300013306 Bacteria 641
247 Ga0163162_12171088 3300013306 Bacteria 637
248 Ga0157372_10023974 3300013307 Bacteria 6620
249 Ga0157372_10044800 3300013307 Bacteria 4904
250 Ga0157372_10050469 3300013307 Unclassified 4628
251 Ga0157372_10149087 3300013307 Bacteria 2698
252 Ga0157372_10154083 3300013307 Bacteria 2654
253 Ga0157372_10233398 3300013307 Bacteria 2133
254 Ga0157372_10374052 3300013307 Bacteria 1660
255 Ga0157372_10555388 3300013307 Bacteria 1338
256 Ga0157372_10806906 3300013307 Unclassified 1090
257 Ga0157372_11013355 3300013307 Bacteria 962
258 Ga0157372_11404309 3300013307 Bacteria 805
259 Ga0157372_11921851 3300013307 Unclassified 680
260 Ga0157372_12081799 3300013307 Bacteria 652
261 Ga0157372_12564711 3300013307 Bacteria 585
262 Ga0157375_10027553 3300013308 Bacteria 5312
263 Ga0157375_10061638 3300013308 Unclassified 3725
264 Ga0157375_10074625 3300013308 Bacteria 3413
265 Ga0157375_10086807 3300013308 Bacteria 3180
266 Ga0157375_11814488 3300013308 Unclassified 723
267 Ga0163163_10000279 3300014325 Bacteria 50882
268 Ga0163163_10017479 3300014325 Bacteria 6690
269 Ga0163163_12418965 3300014325 Bacteria 584
270 Ga0157380_13496997 3300014326 Bacteria 503
271 Ga0157377_10008716 3300014745 Bacteria 4957
272 Ga0157377_10357036 3300014745 Bacteria 982
273 Ga0157377_10690558 3300014745 Unclassified 740
274 Ga0157379_10073954 3300014968 Bacteria 3051
275 Ga0157379_10074419 3300014968 Bacteria 3041
276 Ga0157379_10187588 3300014968 Bacteria 1869
277 Ga0157376_10012587 3300014969 Bacteria 6284
278 Ga0157376_11222638 3300014969 Bacteria 780
279 Ga0182005_1000071 3300015265 Bacteria 84771
280 Ga0163161_10005088 3300017792 Bacteria 9153
281 Ga0163161_10058031 3300017792 Bacteria 2813
282 Ga0163161_10159563 3300017792 Bacteria 1719
283 Ga0163161_11454224 3300017792 Bacteria 600
284 Ga0213876_10020175 3300021384 Bacteria 3522
285 Ga0213876_10318941 3300021384 Bacteria 826
286 Ga0209436_103489 3300025208 Bacteria 4164
287 Ga0209258_100075 3300025242 Bacteria 270751
288 Ga0209646_1002479 3300025246 Bacteria 4064
289 Ga0209646_1016742 3300025246 Bacteria 1085
290 Ga0209148_1000085 3300025254 Bacteria 265193
291 Ga0207426_1010650 3300025302 Bacteria 3554
292 Ga0209257_1000004 3300025304 Bacteria 1678347
293 Ga0207656_10028580 3300025321 Bacteria 2290
294 Ga0207682_10517583 3300025893 Unclassified 565
295 Ga0207642_10424884 3300025899 Bacteria 800
296 Ga0207688_10364171 3300025901 Bacteria 892
297 Ga0207680_10208888 3300025903 Bacteria 1334
298 Ga0207647_10000017 3300025904 Bacteria 129999
299 Ga0207647_10191710 3300025904 Bacteria 1184
300 Ga0207685_10150837 3300025905 Bacteria 1052
301 Ga0207645_10030773 3300025907 Bacteria 3459
302 Ga0207645_10137640 3300025907 Bacteria 1590
303 Ga0207643_10065320 3300025908 Bacteria 2084
304 Ga0207654_10025341 3300025911 Bacteria 3199
305 Ga0207654_11062119 3300025911 Unclassified 589
306 Ga0207707_10131490 3300025912 Bacteria 2189
307 Ga0207695_10000282 3300025913 Bacteria 126242
308 Ga0207671_10447315 3300025914 Bacteria 1029
309 Ga0207660_10536368 3300025917 Bacteria 951
310 Ga0207657_10503967 3300025919 Bacteria 948
311 Ga0207649_10031318 3300025920 Bacteria 3160
312 Ga0207649_10217155 3300025920 Bacteria 1360
313 Ga0207649_10586367 3300025920 Bacteria 856
314 Ga0207649_10882222 3300025920 Bacteria 701
315 Ga0207649_11015956 3300025920 Bacteria 653
316 Ga0207652_10366952 3300025921 Bacteria 1299
317 Ga0207652_10956544 3300025921 Unclassified 754
318 Ga0207681_10018330 3300025923 Bacteria 4411
319 Ga0207681_10187913 3300025923 Bacteria 1578
320 Ga0207681_10983532 3300025923 Bacteria 708
321 Ga0207650_10248742 3300025925 Bacteria 1439
322 Ga0207650_11031507 3300025925 Unclassified 700
323 Ga0207659_10590703 3300025926 Bacteria 946
324 Ga0207659_10809852 3300025926 Unclassified 805
325 Ga0207644_10101286 3300025931 Bacteria 2164
326 Ga0207644_10127693 3300025931 Bacteria 1943
327 Ga0207644_11698285 3300025931 Bacteria 529
328 Ga0207690_10005074 3300025932 Bacteria 7777
329 Ga0207690_10100119 3300025932 Bacteria 2068
330 Ga0207690_10153618 3300025932 Bacteria 1709
331 Ga0207690_11153495 3300025932 Bacteria 646
332 Ga0207706_10003994 3300025933 Bacteria 13976
333 Ga0207706_10008162 3300025933 Bacteria 9658
334 Ga0207706_10086980 3300025933 Unclassified 2747
335 Ga0207706_10117921 3300025933 Bacteria 2334
336 Ga0207706_11322196 3300025933 Unclassified 595
337 Ga0207686_10139377 3300025934 Bacteria 1674
338 Ga0207686_10223226 3300025934 Bacteria 1362
339 Ga0207686_10635236 3300025934 Bacteria 843
340 Ga0207686_11133330 3300025934 Bacteria 639
341 Ga0207670_10006784 3300025936 Bacteria 6368
342 Ga0207670_10283286 3300025936 Unclassified 1292
343 Ga0207704_10096122 3300025938 Bacteria 1961
344 Ga0207704_10562924 3300025938 Bacteria 928
345 Ga0207691_10019070 3300025940 Bacteria 6495
346 Ga0207711_12153987 3300025941 Unclassified 500
347 Ga0207689_10011364 3300025942 Bacteria 7634
348 Ga0207689_10027514 3300025942 Bacteria 4759
349 Ga0207689_10030722 3300025942 Bacteria 4476
350 Ga0207689_10041659 3300025942 Bacteria 3800
351 Ga0207689_10235322 3300025942 Bacteria 1514
352 Ga0207661_10003108 3300025944 Bacteria 11489
353 Ga0207661_10015527 3300025944 Bacteria 5606
354 Ga0207661_10034774 3300025944 Bacteria 3922
355 Ga0207661_10661427 3300025944 Bacteria 960
356 Ga0207679_10004210 3300025945 Bacteria 8939
357 Ga0207679_10030394 3300025945 Bacteria 3771
358 Ga0207679_10892170 3300025945 Bacteria 813
359 Ga0207667_10045230 3300025949 Bacteria 4664
360 Ga0207667_10083970 3300025949 Bacteria 3297
361 Ga0207667_10270953 3300025949 Bacteria 1736
362 Ga0207667_10599553 3300025949 Unclassified 1111
363 Ga0207651_10016417 3300025960 Bacteria 4337
364 Ga0207651_10028861 3300025960 Bacteria 3507
365 Ga0207712_10557799 3300025961 Bacteria 986
366 Ga0207668_10198725 3300025972 Bacteria 1595
367 Ga0207668_10414732 3300025972 Bacteria 1142
368 Ga0207640_10097479 3300025981 Bacteria 2053
369 Ga0207640_10114101 3300025981 Bacteria 1922
370 Ga0207640_10174603 3300025981 Bacteria 1605
371 Ga0207640_10601039 3300025981 Bacteria 931
372 Ga0207640_10688069 3300025981 Bacteria 875
373 Ga0207640_12103315 3300025981 Unclassified 512
374 Ga0207658_10011371 3300025986 Bacteria 6057
375 Ga0207658_10237212 3300025986 Bacteria 1543
376 Ga0207658_10675925 3300025986 Bacteria 932
377 Ga0207677_10020432 3300026023 Bacteria 4021
378 Ga0207677_10321616 3300026023 Bacteria 1286
379 Ga0207677_10454580 3300026023 Eukaryota 1098
380 Ga0207677_10598157 3300026023 Bacteria 967
381 Ga0207677_11330217 3300026023 Unclassified 660
382 Ga0207703_10079753 3300026035 Unclassified 2725
383 Ga0207703_10279789 3300026035 Bacteria 1515
384 Ga0207639_10013064 3300026041 Bacteria 5798
385 Ga0207639_10021770 3300026041 Bacteria 4608
386 Ga0207639_10759937 3300026041 Bacteria 902
387 Ga0207639_10772328 3300026041 Bacteria 894
388 Ga0207639_11362815 3300026041 Bacteria 666
389 Ga0207678_10091709 3300026067 Bacteria 2597
390 Ga0207678_10154558 3300026067 Bacteria 1959
391 Ga0207678_10690212 3300026067 Bacteria 898
392 Ga0207708_11268239 3300026075 Unclassified 645
393 Ga0207702_10019094 3300026078 Bacteria 5673
394 Ga0207641_10097597 3300026088 Unclassified 2583
395 Ga0207641_10098902 3300026088 Bacteria 2566
396 Ga0207641_10345216 3300026088 Bacteria 1417
397 Ga0207648_10004829 3300026089 Bacteria 13743
398 Ga0207648_10020364 3300026089 Bacteria 5974
399 Ga0207648_10118032 3300026089 Bacteria 2331
400 Ga0207648_10380487 3300026089 Bacteria 1276
401 Ga0207648_10385570 3300026089 Bacteria 1268
402 Ga0207676_10003591 3300026095 Bacteria 10965
403 Ga0207676_10140041 3300026095 Bacteria 2070
404 Ga0207674_10014867 3300026116 Bacteria 8583
405 Ga0207674_10037244 3300026116 Bacteria 5061
406 Ga0207674_10070579 3300026116 Bacteria 3512
407 Ga0207674_10095119 3300026116 Bacteria 2965
408 Ga0207674_10274655 3300026116 Bacteria 1633
409 Ga0207674_10426785 3300026116 Bacteria 1281
410 Ga0207675_100177850 3300026118 Bacteria 2036
411 Ga0207675_100926074 3300026118 Bacteria 888
412 Ga0207683_10017143 3300026121 Bacteria 6166
413 Ga0207698_10068225 3300026142 Bacteria 2807
414 Ga0207698_10123695 3300026142 Bacteria 2195
415 Ga0207698_10190365 3300026142 Bacteria 1827
416 Ga0207698_10220946 3300026142 Bacteria 1712
417 Ga0207698_10290871 3300026142 Bacteria 1516
418 Ga0207698_10529541 3300026142 Bacteria 1151
419 Ga0268266_10635922 3300028379 Bacteria 1026
420 Ga0268265_10408682 3300028380 Bacteria 1257
421 Ga0268265_10712076 3300028380 Bacteria 971
422 Ga0268265_12230114 3300028380 Bacteria 555
423 Ga0268264_10256885 3300028381 Bacteria 1626
424 Ga0268264_10839354 3300028381 Bacteria 920
425 Ga0307515_10351275 3300028794 Bacteria 1121
426 Ga0307515_10620043 3300028794 Unclassified 693
427 Ga0265327_10002389 3300031251 Bacteria 19924
428 Ga0265327_10024696 3300031251 Unclassified 3522
429 Ga0307513_10072928 3300031456 Bacteria 3576
430 Ga0307513_10729198 3300031456 Bacteria 697
431 Ga0307509_10025575 3300031507 Bacteria 6589
432 Ga0307516_10047548 3300031730 Bacteria 4225
433 Ga0307406_10871678 3300031901 Unclassified 765
434 Ga0307414_10222773 3300032004 Bacteria 1549
435 Ga0307510_10085164 3300033180 Bacteria 3039
436 Ga0373934_0087634 3300035086 Bacteria 1253
437 Ga0373936_0067895 3300035113 Bacteria 1466
438 Ga0373945_0060289 3300035116 Bacteria 1415
439 Ga0373954_0271280 3300035118 Bacteria 836
440 Ga0373957_0451090 3300035120 Unclassified 557
441 Ga0373943_0695147 3300035170 Unclassified 602
442 Ga0373943_0798119 3300035170 Bacteria 562
443 Ga0373924_0087418 3300035410 Bacteria 1331
444 Ga0373927_0227655 3300035695 Bacteria 1225
445 Ga0373947_0434966 3300035725 Unclassified 888
446 Ga0373937_0006671 3300036401 Bacteria 9965
447 Ga0373925_0637733 3300037068 Bacteria 878
448 Ga0436365_0951333 3300039437 Bacteria 12859
449 Ga0436365_0964301 3300039437 Bacteria 1031
450 Ga0436363_1023855 3300039450 Bacteria 686
451 Ga0439436_0001185 3300041404 Bacteria 7405
452 Ga0439439_0050446 3300041406 Bacteria 1090
453 Ga0451791_1715121 3300041451 Bacteria 2710
454 Ga0451798_0445179 3300041458 Bacteria 888
455 Ga0451802_0108801 3300041460 Bacteria 1728
456 Ga0451807_1318492 3300041486 Bacteria 816
457 Ga0451807_2404277 3300041486 Unclassified 605
458 Ga0451833_0366459 3300041491 Bacteria 700
459 Ga0451833_0878953 3300041491 Bacteria 790
460 Ga0451849_0091715 3300041505 Bacteria 1123
461 Ga0451855_0399365 3300041511 Bacteria 1169
462 Ga0451853_1473345 3300041512 Bacteria 1616
463 Ga0439442_046838 3300042002 Unclassified 911
464 Ga0439449_0033701 3300042007 Bacteria 1907
465 Ga0439457_002307 3300042014 Bacteria 5483
466 Ga0439462_0020830 3300042015 Bacteria 1712
467 Ga0466969_0000004 3300044656 Bacteria 168068
468 Ga0466969_0410449 3300044656 Unclassified 615
469 Ga0466966_0390951 3300044684 Bacteria 835
470 Ga0466961_0237603 3300044693 Bacteria 1120
471 Ga0466961_0269435 3300044693 Bacteria 1043
472 Ga0466964_0030639 3300044706 Bacteria 2130
473 Ga0466971_0021777 3300044719 Bacteria 2853
474 Ga0466970_0306660 3300044765 Bacteria 896
475 Ga0466957_0000367 3300044842 Bacteria 22106
476 Ga0466959_0000004 3300045049 Bacteria 216815
477 Ga0466959_0000819 3300045049 Bacteria 18344
478 Ga0466959_0366678 3300045049 Unclassified 981
479 Ga0451576_0000015 3300045051 Bacteria 579908
480 Ga0466958_0223936 3300045836 Bacteria 1200
481 Ga0466967_1178024 3300045976 Bacteria 763
482 Ga0495638_0389116 3300046460 Unclassified 726
483 Ga0495653_0140308 3300046463 Bacteria 1701
484 Ga0495606_0003869 3300046507 Bacteria 15454
485 Ga0495608_0088061 3300046511 Bacteria 2010
486 Ga0495618_0118574 3300046514 Bacteria 1695
487 Ga0495628_0139162 3300046516 Bacteria 1853
488 Ga0495630_0008352 3300046517 Bacteria 7433
489 Ga0495632_0178975 3300046519 Bacteria 972
490 Ga0495652_0141965 3300046529 Bacteria 1888
491 Ga0495587_0028612 3300046536 Bacteria 3388
492 Ga0495667_0037763 3300046559 Bacteria 3218
493 Ga0495611_0000378 3300046648 Bacteria 28522
494 Ga0495657_0179372 3300046675 Bacteria 1301
495 Ga0495599_0112526 3300046678 Bacteria 1695
496 Ga0495613_0082880 3300046689 Bacteria 2329
497 Ga0495649_0006163 3300046694 Bacteria 7496
498 Ga0495604_0286425 3300047317 Bacteria 1111
499 Ga0495674_0036378 3300047319 Bacteria 4432
500 Ga0495676_0284842 3300047321 Bacteria 1118
501 Ga0495675_0059568 3300047444 Bacteria 2421
502 Ga0495684_0052581 3300047471 Bacteria 3109
503 Ga0495686_0234280 3300047472 Bacteria 1038
504 Ga0496101_0980273 3300048904 Bacteria 665
505 Ga0496110_0348990 3300048913 Unclassified 1348
506 Ga0496112_0924394 3300048915 Bacteria 794
507 Ga0496126_0012088 3300048929 Bacteria 8866
508 Ga0501034_0614017 3300049571 Bacteria 992
509 Ga0501047_0015825 3300049581 Bacteria 7187
510 Ga0501047_0057892 3300049581 Bacteria 3746
511 Ga0501047_0279348 3300049581 Unclassified 1515
512 Ga0501217_058401 3300049661 Unclassified 1025
513 Ga0501035_1522187 3300049822 Bacteria 510
514 Ga0501044_0006478 3300049823 Bacteria 12931
515 Ga0501044_0273861 3300049823 Bacteria 1623
516 nmdc:mga0k408_22469_c1 3300050493 Bacteria 3552
517 nmdc:mga0k408_263676_c1 3300050493 Bacteria 1029
518 nmdc:mga0k408_347017_c1 3300050493 Bacteria 885
519 nmdc:mga0k408_574341_c1 3300050493 Unclassified 666
520 nmdc:mga05p37_2793_c1 3300050507 Bacteria 20304
521 nmdc:mga05p37_452687_c1 3300050507 Bacteria 1485
522 nmdc:mga06r32_1555836_c1 3300050510 Unclassified 601
523 nmdc:mga0n895_10170_c1 3300050512 Bacteria 8285
524 Ga0500578_0000037 3300053086 Bacteria 134901
525 Ga0500644_0000377 3300053088 Bacteria 21758
526 Ga0500646_0068661 3300053090 Bacteria 1058
527 Ga0500646_0118471 3300053090 Bacteria 849
528 Ga0500583_0000068 3300053092 Bacteria 64748
529 Ga0500583_0001206 3300053092 Bacteria 7395
530 Ga0500583_0006731 3300053092 Bacteria 3983
531 Ga0500583_0024398 3300053092 Bacteria 2565
532 Ga0500651_0270458 3300053093 Bacteria 983
533 Ga0500556_0059729 3300053104 Bacteria 1402
534 Ga0500569_000574 3300053109 Bacteria 6188
535 Ga0500607_171358 3300053121 Bacteria 977
536 Ga0500607_196993 3300053121 Bacteria 871
537 Ga0500618_058239 3300053125 Bacteria 870
538 Ga0500642_0244688 3300053130 Bacteria 825
539 Ga0500652_020775 3300053131 Bacteria 2462
540 Ga0500559_0070625 3300053136 Bacteria 1571
541 Ga0500573_0322482 3300053140 Bacteria 762
542 Ga0500577_0000477 3300053142 Bacteria 10351
543 Ga0500588_0098659 3300053146 Bacteria 1004
544 Ga0500589_013142 3300053147 Bacteria 3640
545 Ga0500590_145919 3300053148 Bacteria 1074
546 Ga0500616_0126229 3300053153 Bacteria 1215
547 Ga0500616_0266839 3300053153 Unclassified 724
548 Ga0500622_0000144 3300053156 Bacteria 75663
549 Ga0500622_0353195 3300053156 Bacteria 609
550 Ga0500627_0068433 3300053158 Bacteria 1570
551 Ga0500627_0139342 3300053158 Unclassified 1096
552 Ga0500633_0094656 3300053160 Bacteria 1094
553 Ga0500634_0032890 3300053161 Bacteria 2827
554 Ga0500636_0009917 3300053177 Bacteria 5545
555 Ga0500636_0061374 3300053177 Bacteria 2194
556 Ga0500636_0165204 3300053177 Bacteria 1203
557 Ga0500611_042142 3300053727 Bacteria 1008
558 Ga0500661_009095 3300055283 Bacteria 1824
559 Ga0500661_061482 3300055283 Bacteria 679
560 Ga0466962_0438323 3300061719 Unclassified 657
561 2819571863 2818991442 Bacteria 8318214
562 2821141892 2821136567 Bacteria 8080116
563 2903898690 2903895155 Bacteria 5258610
564 2904469694 2904467357 Bacteria 8057758
565 2919684579 2919683626 Bacteria 5534354
566 2929159882 2929154850 Bacteria 6753285
567 2929245492 2929239360 Bacteria 7745570
568 Ga0495684_0450214
569 JGI24744J21845_10036188
570 JGI25158J39367_1035557
571 JGI25153J46596_10005223
572 rootH2_10092971
573 rootH2_10139917
574 rootL2_10002814
575 rootL2_10002815
576 rootL2_10038550
577 rootL2_10141830
578 rootL2_10187862
579 rootL2_10350863
580 rootH1_10011487
581 rootH1_10176919
582 rootH1_10232739
583 Ga0055535_1007611
584 Ga0055542_1008713
585 Ga0055531_10000177
586 Ga0065165_1011946
587 Ga0065712_10807747
588 Ga0070676_10015287
589 Ga0070683_100002331
590 Ga0070683_100014609
591 Ga0070683_100033730
592 Ga0070683_100055746
593 Ga0070683_100204993
594 Ga0070690_100282418
595 Ga0070670_100670155
596 Ga0070670_101040234
597 Ga0070670_101936128
598 Ga0070670_102203316
599 Ga0070677_10481309
600 Ga0068869_100042970
601 Ga0068869_100059529
602 Ga0068869_100111674
603 Ga0068869_100339241
604 Ga0070666_10060939
605 Ga0070666_10749665
606 Ga0070680_100140146
607 Ga0070682_100040200
608 Ga0070682_100173722
609 Ga0070682_100345569
610 Ga0070682_100436175
611 Ga0068868_100000427
612 Ga0068868_100038018
613 Ga0068868_100195606
614 Ga0068868_101059708
615 Ga0070689_100063778
616 Ga0070691_10060628
617 Ga0070661_100048180
618 Ga0070661_100127711
619 Ga0070668_100214957
620 Ga0070668_100287958
621 Ga0070669_100199546
622 Ga0070669_100271669
623 Ga0070669_100650566
624 Ga0070669_101449157
625 Ga0070675_100080687
626 Ga0070675_100573258
627 Ga0070675_100728577
628 Ga0070675_100912738
629 Ga0070675_101542427
630 Ga0070671_100057089
631 Ga0070673_100032232
632 Ga0070673_100224672
633 Ga0070673_100276350
634 Ga0070688_100045881
635 Ga0070688_100092354
636 Ga0070688_100133991
637 Ga0070659_100003555
638 Ga0070659_100007166
639 Ga0070659_100160943
640 Ga0070659_101557696
641 Ga0070667_100181041
642 Ga0070700_100776128
643 Ga0070700_101171579
644 Ga0070663_100134422
645 Ga0070663_100309193
646 Ga0070663_100791196
647 Ga0070663_101231767
648 Ga0070678_100122957
649 Ga0070678_100299084
650 Ga0070662_100017749
651 Ga0070681_10035209
652 Ga0068867_100053979
653 Ga0068867_100171619
654 Ga0068867_100295407
655 Ga0068867_100436581
656 Ga0068867_101501512
657 Ga0070685_10404621
658 Ga0070685_11350276
659 Ga0070698_100639612
660 Ga0070679_100062882
661 Ga0070684_100001198
662 Ga0070684_100108698
663 Ga0070684_100123577
664 Ga0070684_100680733
665 Ga0070684_100953522
666 Ga0070684_101151847
667 Ga0068853_100023090
668 Ga0068853_100030039
669 Ga0068853_100080274
670 Ga0068853_100214822
671 Ga0068853_100487948
672 Ga0068853_100571459
673 Ga0068853_100957468
674 Ga0068853_100958581
675 Ga0070672_100393979
676 Ga0070686_100062477
677 Ga0070686_100876985
678 Ga0070695_100593853
679 Ga0070693_100031657
680 Ga0070693_100054019
681 Ga0070693_101244679
682 Ga0070665_100494896
683 Ga0070665_101171953
684 Ga0068855_100003306
685 Ga0068855_100042328
686 Ga0068855_100559489
687 Ga0068855_100643799
688 Ga0070664_100006530
689 Ga0070664_100049030
690 Ga0070664_100115210
691 Ga0068857_100007841
692 Ga0068857_100061304
693 Ga0068857_100097317
694 Ga0068857_100221486
695 Ga0068857_100347611
696 Ga0068857_101043035
697 Ga0068854_100222830
698 Ga0068854_100333630
699 Ga0068854_100404332
700 Ga0068854_101749653
701 Ga0068856_100216805
702 Ga0068856_101764219
703 Ga0068852_100000346
704 Ga0068852_100268880
705 Ga0068852_100278831
706 Ga0068852_100323972
707 Ga0068852_100661507
708 Ga0068852_100716901
709 Ga0068852_101093493
710 Ga0068852_101215492
711 Ga0068852_101254028
712 Ga0068852_102495100
713 Ga0068852_102499066
714 Ga0068859_100010050
715 Ga0068859_100017677
716 Ga0068859_100278282
717 Ga0068859_100496652
718 Ga0068859_101694553
719 Ga0068864_100092812
720 Ga0068864_100108031
721 Ga0068864_100279806
722 Ga0068861_100449616
723 Ga0068861_101875835
724 Ga0068851_10603563
725 Ga0068851_10721474
726 Ga0068870_10049105
727 Ga0068863_100203650
728 Ga0068863_100262904
729 Ga0068863_100405492
730 Ga0068863_100608915
731 Ga0068858_100134635
732 Ga0068858_100873658
733 Ga0068858_100937529
734 Ga0068860_100366940
735 Ga0068860_100509738
736 Ga0068860_100591719
737 Ga0068862_100104884
738 Ga0068862_102021780
739 Ga0070715_10315701
740 Ga0075366_10028680
741 Ga0075366_10085015
742 Ga0075366_10142982
743 Ga0097621_100526707
744 Ga0097621_100906189
745 Ga0068871_100051739
746 Ga0068871_100111569
747 Ga0068871_100497524
748 Ga0068871_100900552
749 Ga0068871_101137913
750 Ga0075431_100008716
751 Ga0075434_100918354
752 Ga0075429_100080141
753 Ga0068865_100237881
754 Ga0097620_100010050
755 Ga0097620_100017677
756 Ga0097620_100278285
757 Ga0097620_100496600
758 Ga0097620_101694348
759 Ga0075435_101826815
760 Ga0105240_10236186
761 Ga0105240_10979224
762 Ga0105240_11048099
763 Ga0111539_10555983
764 Ga0105245_10832482
765 Ga0105247_10173238
766 Ga0114129_10012062
767 Ga0105241_10026780
768 Ga0105241_11190299
769 Ga0105241_11761996
770 Ga0105242_10023667
771 Ga0105242_10044054
772 Ga0105242_10117795
773 Ga0105242_12184496
774 Ga0105248_10351318
775 Ga0105237_10000710
776 Ga0105237_10057690
777 Ga0105249_10601516
778 Ga0105249_10609319
779 Ga0105249_10800966
780 Ga0105239_10004686
781 Ga0105239_10034559
782 Ga0105239_10229243
783 Ga0105239_10533455
784 Ga0105239_11528456
785 Ga0105246_10509124
786 Ga0157373_10084354
787 Ga0157371_10015828
788 Ga0157371_10077422
789 Ga0157371_10210045
790 Ga0157371_10303339
791 Ga0157371_10589256
792 Ga0157371_10711663
793 Ga0157370_10034994
794 Ga0157370_10131429
795 Ga0157369_10134030
796 Ga0157369_11241150
797 Ga0157369_11658404
798 Ga0157374_10000260
799 Ga0157374_10009429
800 Ga0157374_10019184
801 Ga0157374_10040183
802 Ga0157374_10140854
803 Ga0157374_10154441
804 Ga0157374_11388116
805 Ga0157378_10095604
806 Ga0157378_10187857
807 Ga0157378_11080856
808 Ga0157378_11758156
809 Ga0163162_10005692
810 Ga0163162_10376812
811 Ga0163162_11131394
812 Ga0163162_11386390
813 Ga0163162_12144434
814 Ga0163162_12171088
815 Ga0157372_10023974
816 Ga0157372_10044800
817 Ga0157372_10050469
818 Ga0157372_10149087
819 Ga0157372_10154083
820 Ga0157372_10233398
821 Ga0157372_10374052
822 Ga0157372_10555388
823 Ga0157372_10806906
824 Ga0157372_11013355
825 Ga0157372_11404309
826 Ga0157372_11921851
827 Ga0157372_12081799
828 Ga0157372_12564711
829 Ga0157375_10027553
830 Ga0157375_10061638
831 Ga0157375_10074625
832 Ga0157375_10086807
833 Ga0157375_11814488
834 Ga0163163_10000279
835 Ga0163163_10017479
836 Ga0163163_12418965
837 Ga0157380_13496997
838 Ga0157377_10008716
839 Ga0157377_10357036
840 Ga0157377_10690558
841 Ga0157379_10073954
842 Ga0157379_10074419
843 Ga0157379_10187588
844 Ga0157376_10012587
845 Ga0157376_11222638
846 Ga0182005_1000071
847 Ga0163161_10005088
848 Ga0163161_10058031
849 Ga0163161_10159563
850 Ga0163161_11454224
851 Ga0213876_10020175
852 Ga0213876_10318941
853 Ga0209436_103489
854 Ga0209258_100075
855 Ga0209646_1002479
856 Ga0209646_1016742
857 Ga0209148_1000085
858 Ga0207426_1010650
859 Ga0209257_1000004
860 Ga0207656_10028580
861 Ga0207682_10517583
862 Ga0207642_10424884
863 Ga0207688_10364171
864 Ga0207680_10208888
865 Ga0207647_10000017
866 Ga0207647_10191710
867 Ga0207685_10150837
868 Ga0207645_10030773
869 Ga0207645_10137640
870 Ga0207643_10065320
871 Ga0207654_10025341
872 Ga0207654_11062119
873 Ga0207707_10131490
874 Ga0207695_10000282
875 Ga0207671_10447315
876 Ga0207660_10536368
877 Ga0207657_10503967
878 Ga0207649_10031318
879 Ga0207649_10217155
880 Ga0207649_10586367
881 Ga0207649_10882222
882 Ga0207649_11015956
883 Ga0207652_10366952
884 Ga0207652_10956544
885 Ga0207681_10018330
886 Ga0207681_10187913
887 Ga0207681_10983532
888 Ga0207650_10248742
889 Ga0207650_11031507
890 Ga0207659_10590703
891 Ga0207659_10809852
892 Ga0207644_10101286
893 Ga0207644_10127693
894 Ga0207644_11698285
895 Ga0207690_10005074
896 Ga0207690_10100119
897 Ga0207690_10153618
898 Ga0207690_11153495
899 Ga0207706_10003994
900 Ga0207706_10008162
901 Ga0207706_10086980
902 Ga0207706_10117921
903 Ga0207706_11322196
904 Ga0207686_10139377
905 Ga0207686_10223226
906 Ga0207686_10635236
907 Ga0207686_11133330
908 Ga0207670_10006784
909 Ga0207670_10283286
910 Ga0207704_10096122
911 Ga0207704_10562924
912 Ga0207691_10019070
913 Ga0207711_12153987
914 Ga0207689_10011364
915 Ga0207689_10027514
916 Ga0207689_10030722
917 Ga0207689_10041659
918 Ga0207689_10235322
919 Ga0207661_10003108
920 Ga0207661_10015527
921 Ga0207661_10034774
922 Ga0207661_10661427
923 Ga0207679_10004210
924 Ga0207679_10030394
925 Ga0207679_10892170
926 Ga0207667_10045230
927 Ga0207667_10083970
928 Ga0207667_10270953
929 Ga0207667_10599553
930 Ga0207651_10016417
931 Ga0207651_10028861
932 Ga0207712_10557799
933 Ga0207668_10198725
934 Ga0207668_10414732
935 Ga0207640_10097479
936 Ga0207640_10114101
937 Ga0207640_10174603
938 Ga0207640_10601039
939 Ga0207640_10688069
940 Ga0207640_12103315
941 Ga0207658_10011371
942 Ga0207658_10237212
943 Ga0207658_10675925
944 Ga0207677_10020432
945 Ga0207677_10321616
946 Ga0207677_10454580
947 Ga0207677_10598157
948 Ga0207677_11330217
949 Ga0207703_10079753
950 Ga0207703_10279789
951 Ga0207639_10013064
952 Ga0207639_10021770
953 Ga0207639_10759937
954 Ga0207639_10772328
955 Ga0207639_11362815
956 Ga0207678_10091709
957 Ga0207678_10154558
958 Ga0207678_10690212
959 Ga0207708_11268239
960 Ga0207702_10019094
961 Ga0207641_10097597
962 Ga0207641_10098902
963 Ga0207641_10345216
964 Ga0207648_10004829
965 Ga0207648_10020364
966 Ga0207648_10118032
967 Ga0207648_10380487
968 Ga0207648_10385570
969 Ga0207676_10003591
970 Ga0207676_10140041
971 Ga0207674_10014867
972 Ga0207674_10037244
973 Ga0207674_10070579
974 Ga0207674_10095119
975 Ga0207674_10274655
976 Ga0207674_10426785
977 Ga0207675_100177850
978 Ga0207675_100926074
979 Ga0207683_10017143
980 Ga0207698_10068225
981 Ga0207698_10123695
982 Ga0207698_10190365
983 Ga0207698_10220946
984 Ga0207698_10290871
985 Ga0207698_10529541
986 Ga0268266_10635922
987 Ga0268265_10408682
988 Ga0268265_10712076
989 Ga0268265_12230114
990 Ga0268264_10256885
991 Ga0268264_10839354
992 Ga0307515_10351275
993 Ga0307515_10620043
994 Ga0265327_10002389
995 Ga0265327_10024696
996 Ga0307513_10072928
997 Ga0307513_10729198
998 Ga0307509_10025575
999 Ga0307516_10047548
1000 Ga0307406_10871678
1001 Ga0307414_10222773
1002 Ga0307510_10085164
1003 Ga0373934_0087634
1004 Ga0373936_0067895
1005 Ga0373945_0060289
1006 Ga0373954_0271280
1007 Ga0373957_0451090
1008 Ga0373943_0695147
1009 Ga0373943_0798119
1010 Ga0373924_0087418
1011 Ga0373927_0227655
1012 Ga0373947_0434966
1013 Ga0373937_0006671
1014 Ga0373925_0637733
1015 Ga0436365_0951333
1016 Ga0436365_0964301
1017 Ga0436363_1023855
1018 Ga0439436_0001185
1019 Ga0439439_0050446
1020 Ga0451791_1715121
1021 Ga0451798_0445179
1022 Ga0451802_0108801
1023 Ga0451807_1318492
1024 Ga0451807_2404277
1025 Ga0451833_0366459
1026 Ga0451833_0878953
1027 Ga0451849_0091715
1028 Ga0451855_0399365
1029 Ga0451853_1473345
1030 Ga0439442_046838
1031 Ga0439449_0033701
1032 Ga0439457_002307
1033 Ga0439462_0020830
1034 Ga0466969_0000004
1035 Ga0466969_0410449
1036 Ga0466966_0390951
1037 Ga0466961_0237603
1038 Ga0466961_0269435
1039 Ga0466964_0030639
1040 Ga0466971_0021777
1041 Ga0466970_0306660
1042 Ga0466957_0000367
1043 Ga0466959_0000004
1044 Ga0466959_0000819
1045 Ga0466959_0366678
1046 Ga0451576_0000015
1047 Ga0466958_0223936
1048 Ga0466967_1178024
1049 Ga0495638_0389116
1050 Ga0495653_0140308
1051 Ga0495606_0003869
1052 Ga0495608_0088061
1053 Ga0495618_0118574
1054 Ga0495628_0139162
1055 Ga0495630_0008352
1056 Ga0495632_0178975
1057 Ga0495652_0141965
1058 Ga0495587_0028612
1059 Ga0495667_0037763
1060 Ga0495611_0000378
1061 Ga0495657_0179372
1062 Ga0495599_0112526
1063 Ga0495613_0082880
1064 Ga0495649_0006163
1065 Ga0495604_0286425
1066 Ga0495674_0036378
1067 Ga0495676_0284842
1068 Ga0495675_0059568
1069 Ga0495684_0052581
1070 Ga0495686_0234280
1071 Ga0496101_0980273
1072 Ga0496110_0348990
1073 Ga0496112_0924394
1074 Ga0496126_0012088
1075 Ga0501034_0614017
1076 Ga0501047_0015825
1077 Ga0501047_0057892
1078 Ga0501047_0279348
1079 Ga0501217_058401
1080 Ga0501035_1522187
1081 Ga0501044_0006478
1082 Ga0501044_0273861
1083 nmdc:mga0k408_22469_c1
1084 nmdc:mga0k408_263676_c1
1085 nmdc:mga0k408_347017_c1
1086 nmdc:mga0k408_574341_c1
1087 nmdc:mga05p37_2793_c1
1088 nmdc:mga05p37_452687_c1
1089 nmdc:mga06r32_1555836_c1
1090 nmdc:mga0n895_10170_c1
1091 Ga0500578_0000037
1092 Ga0500644_0000377
1093 Ga0500646_0068661
1094 Ga0500646_0118471
1095 Ga0500583_0000068
1096 Ga0500583_0001206
1097 Ga0500583_0006731
1098 Ga0500583_0024398
1099 Ga0500651_0270458
1100 Ga0500556_0059729
1101 Ga0500569_000574
1102 Ga0500607_171358
1103 Ga0500607_196993
1104 Ga0500618_058239
1105 Ga0500642_0244688
1106 Ga0500652_020775
1107 Ga0500559_0070625
1108 Ga0500573_0322482
1109 Ga0500577_0000477
1110 Ga0500588_0098659
1111 Ga0500589_013142
1112 Ga0500590_145919
1113 Ga0500616_0126229
1114 Ga0500616_0266839
1115 Ga0500622_0000144
1116 Ga0500622_0353195
1117 Ga0500627_0068433
1118 Ga0500627_0139342
1119 Ga0500633_0094656
1120 Ga0500634_0032890
1121 Ga0500636_0009917
1122 Ga0500636_0061374
1123 Ga0500636_0165204
1124 Ga0500611_042142
1125 Ga0500661_009095
1126 Ga0500661_061482
1127 Ga0466962_0438323
1128 2819571863
1129 2821141892
1130 2903898690
1131 2904469694
1132 2919684579
1133 2929159882
1134 2929245492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

3

110

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.9777 1 120
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.9697 1 120
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.8789 2 119
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.8785 2 120
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.8653 2 120
ID Description Score Start End Superfamily
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9698 1 120 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 1 120 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8785 2 120 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8653 2 120 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8475 3 113 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1J5SU64-F1-model_v4 CoA-binding domain-containing protein 1.004 3 120
AF-A0A561Q4Z6-F1-model_v4 TIGR01777 family protein 1.004 5 120
AF-A0A4Q0AZ43-F1-model_v4 CoA-binding protein 1.001 3 120
AF-A0A1I5WNJ6-F1-model_v4 CoA-binding domain-containing protein 0.9991 1 120
AF-A0A7W2FVE9-F1-model_v4 CoA-binding protein 0.9985 48 120

Map