F464533
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 188 | 564 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0039451|Ga0466969_0039451_779_1666 |
| Length | 286 |
| Sequence | MTAKLIDGKAAAAEVREQVATAAASFRTATGRAPGLAVVLVGEHPPSAAYVRMKIKATLEAGMESFEHRIPAETSQQDLLALIDRLNADETVDGILVQLPLPRHVDEQAILTGFHPINVGRLSIGLDSLVPCTPLGCLVLLQRELGDLSGKDAIVIGRSNIVGKPMAQLLLGANCTVTVAHSRSRDLASLTRRADIVVAAVGRPELVRGSWLKPGATVIDVGQERVEQPDGSRKLLGDVAFDEAMEVAGAITPVPGGVGPMTIAMLLRNTVVAAHRRMGLPDPEGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 3 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 4 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 5 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 84 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 137 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 156 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 159 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 177 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 178 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 179 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.35 |
| Rhizoplane | 3 |
| Rhizosphere | 96.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_8754477 | 2162886012 | Bacteria | 1833 |
| 2 | JGI24736J21556_1004038 | 3300001904 | Bacteria | 2525 |
| 3 | JGI24740J21852_10000089 | 3300001979 | Bacteria | 31515 |
| 4 | JGI24739J22299_10000097 | 3300001989 | Bacteria | 25965 |
| 5 | JGI24737J22298_10000037 | 3300001990 | Bacteria | 37991 |
| 6 | JGI24737J22298_10000930 | 3300001990 | Bacteria | 10388 |
| 7 | JGI24737J22298_10033425 | 3300001990 | Bacteria | 1597 |
| 8 | JGI24743J22301_10002872 | 3300001991 | Bacteria | 2655 |
| 9 | JGI24735J21928_10004142 | 3300002067 | Bacteria | 4898 |
| 10 | JGI24735J21928_10037844 | 3300002067 | Bacteria | 1413 |
| 11 | JGI24738J21930_10000023 | 3300002075 | Bacteria | 29088 |
| 12 | Ga0065715_10095614 | 3300005293 | Bacteria | 4044 |
| 13 | Ga0070658_10000377 | 3300005327 | Bacteria | 38853 |
| 14 | Ga0070658_10020877 | 3300005327 | Bacteria | 5247 |
| 15 | Ga0070658_10091831 | 3300005327 | Bacteria | 2502 |
| 16 | Ga0070658_10109501 | 3300005327 | Bacteria | 2287 |
| 17 | Ga0070658_10116380 | 3300005327 | Bacteria | 2218 |
| 18 | Ga0070658_10119188 | 3300005327 | Bacteria | 2192 |
| 19 | Ga0070658_10306175 | 3300005327 | Bacteria | 1355 |
| 20 | Ga0070676_10104483 | 3300005328 | Bacteria | 1755 |
| 21 | Ga0070683_100001819 | 3300005329 | Bacteria | 16631 |
| 22 | Ga0070683_100039504 | 3300005329 | Bacteria | 4332 |
| 23 | Ga0070683_100228118 | 3300005329 | Bacteria | 1770 |
| 24 | Ga0070670_100003109 | 3300005331 | Bacteria | 13741 |
| 25 | Ga0070670_100003400 | 3300005331 | Bacteria | 13192 |
| 26 | Ga0070670_100042597 | 3300005331 | Bacteria | 3903 |
| 27 | Ga0070670_100159246 | 3300005331 | Bacteria | 1956 |
| 28 | Ga0070670_100177227 | 3300005331 | Bacteria | 1850 |
| 29 | Ga0070670_100395907 | 3300005331 | Bacteria | 1219 |
| 30 | Ga0070677_10008918 | 3300005333 | Bacteria | 3388 |
| 31 | Ga0070677_10047425 | 3300005333 | Bacteria | 1722 |
| 32 | Ga0070666_10000779 | 3300005335 | Bacteria | 19305 |
| 33 | Ga0070666_10005953 | 3300005335 | Bacteria | 7486 |
| 34 | Ga0070666_10024629 | 3300005335 | Bacteria | 3922 |
| 35 | Ga0070666_10065966 | 3300005335 | Bacteria | 2456 |
| 36 | Ga0070682_100006873 | 3300005337 | Bacteria | 6393 |
| 37 | Ga0068868_100000259 | 3300005338 | Bacteria | 36003 |
| 38 | Ga0068868_100015245 | 3300005338 | Bacteria | 5681 |
| 39 | Ga0068868_100048166 | 3300005338 | Bacteria | 3343 |
| 40 | Ga0068868_100061889 | 3300005338 | Bacteria | 2966 |
| 41 | Ga0070660_100000986 | 3300005339 | Bacteria | 19065 |
| 42 | Ga0070660_100058544 | 3300005339 | Bacteria | 2986 |
| 43 | Ga0070660_100081729 | 3300005339 | Bacteria | 2537 |
| 44 | Ga0070660_100171964 | 3300005339 | Bacteria | 1750 |
| 45 | Ga0070689_100028985 | 3300005340 | Bacteria | 4187 |
| 46 | Ga0070689_100158173 | 3300005340 | Bacteria | 1830 |
| 47 | Ga0070661_100000187 | 3300005344 | Bacteria | 51095 |
| 48 | Ga0070661_100004695 | 3300005344 | Bacteria | 9409 |
| 49 | Ga0070661_100011962 | 3300005344 | Bacteria | 6062 |
| 50 | Ga0070661_100072913 | 3300005344 | Bacteria | 2527 |
| 51 | Ga0070661_100165569 | 3300005344 | Bacteria | 1676 |
| 52 | Ga0070661_100209843 | 3300005344 | Bacteria | 1490 |
| 53 | Ga0070661_100224334 | 3300005344 | Bacteria | 1442 |
| 54 | Ga0070692_10034116 | 3300005345 | Bacteria | 2568 |
| 55 | Ga0070692_10057624 | 3300005345 | Bacteria | 2038 |
| 56 | Ga0070668_100035371 | 3300005347 | Bacteria | 3809 |
| 57 | Ga0070669_100000174 | 3300005353 | Bacteria | 56290 |
| 58 | Ga0070669_100033518 | 3300005353 | Bacteria | 3715 |
| 59 | Ga0070669_100131253 | 3300005353 | Bacteria | 1922 |
| 60 | Ga0070669_100164872 | 3300005353 | Bacteria | 1724 |
| 61 | Ga0070675_100002370 | 3300005354 | Bacteria | 14027 |
| 62 | Ga0070675_100010543 | 3300005354 | Bacteria | 7221 |
| 63 | Ga0070675_100023558 | 3300005354 | Bacteria | 4925 |
| 64 | Ga0070675_100102492 | 3300005354 | Bacteria | 2411 |
| 65 | Ga0070671_100001282 | 3300005355 | Bacteria | 18862 |
| 66 | Ga0070671_100029886 | 3300005355 | Bacteria | 4495 |
| 67 | Ga0070671_100054381 | 3300005355 | Bacteria | 3329 |
| 68 | Ga0070671_100128547 | 3300005355 | Bacteria | 2133 |
| 69 | Ga0070674_100007200 | 3300005356 | Bacteria | 6548 |
| 70 | Ga0070674_100161329 | 3300005356 | Bacteria | 1701 |
| 71 | Ga0070674_100168299 | 3300005356 | Bacteria | 1669 |
| 72 | Ga0070673_100000337 | 3300005364 | Bacteria | 24629 |
| 73 | Ga0070673_100010120 | 3300005364 | Bacteria | 6367 |
| 74 | Ga0070673_100011602 | 3300005364 | Bacteria | 6020 |
| 75 | Ga0070673_100011732 | 3300005364 | Bacteria | 5992 |
| 76 | Ga0070673_100031597 | 3300005364 | Bacteria | 3976 |
| 77 | Ga0070659_100000191 | 3300005366 | Bacteria | 47035 |
| 78 | Ga0070659_100000674 | 3300005366 | Bacteria | 24835 |
| 79 | Ga0070659_100028122 | 3300005366 | Bacteria | 4339 |
| 80 | Ga0070659_100039493 | 3300005366 | Bacteria | 3685 |
| 81 | Ga0070659_100052281 | 3300005366 | Bacteria | 3213 |
| 82 | Ga0070659_100141643 | 3300005366 | Bacteria | 1958 |
| 83 | Ga0070659_100183630 | 3300005366 | Bacteria | 1717 |
| 84 | Ga0070659_100209052 | 3300005366 | Bacteria | 1608 |
| 85 | Ga0070659_100212634 | 3300005366 | Bacteria | 1594 |
| 86 | Ga0070667_100001311 | 3300005367 | Bacteria | 22374 |
| 87 | Ga0070667_100003559 | 3300005367 | Bacteria | 13269 |
| 88 | Ga0070667_100011671 | 3300005367 | Bacteria | 7263 |
| 89 | Ga0070667_100104177 | 3300005367 | Bacteria | 2454 |
| 90 | Ga0070667_100263107 | 3300005367 | Bacteria | 1545 |
| 91 | Ga0070667_100300977 | 3300005367 | Bacteria | 1444 |
| 92 | Ga0070714_100055739 | 3300005435 | Bacteria | 3379 |
| 93 | Ga0070714_100065718 | 3300005435 | Bacteria | 3124 |
| 94 | Ga0070663_100000754 | 3300005455 | Bacteria | 17546 |
| 95 | Ga0070663_100029193 | 3300005455 | Bacteria | 3765 |
| 96 | Ga0070663_100077044 | 3300005455 | Bacteria | 2440 |
| 97 | Ga0070663_100108487 | 3300005455 | Bacteria | 2082 |
| 98 | Ga0070663_100110707 | 3300005455 | Bacteria | 2063 |
| 99 | Ga0070663_100128264 | 3300005455 | Bacteria | 1923 |
| 100 | Ga0070678_100034382 | 3300005456 | Bacteria | 3529 |
| 101 | Ga0070662_100000012 | 3300005457 | Bacteria | 129380 |
| 102 | Ga0070662_100001658 | 3300005457 | Bacteria | 13697 |
| 103 | Ga0070662_100004211 | 3300005457 | Bacteria | 9062 |
| 104 | Ga0070662_100005641 | 3300005457 | Bacteria | 8004 |
| 105 | Ga0070662_100007787 | 3300005457 | Bacteria | 6960 |
| 106 | Ga0070662_100122185 | 3300005457 | Bacteria | 1997 |
| 107 | Ga0070662_100222646 | 3300005457 | Bacteria | 1506 |
| 108 | Ga0068867_100006572 | 3300005459 | Bacteria | 8214 |
| 109 | Ga0068867_100008577 | 3300005459 | Bacteria | 7215 |
| 110 | Ga0068867_100214457 | 3300005459 | Bacteria | 1548 |
| 111 | Ga0070685_10068101 | 3300005466 | Bacteria | 2102 |
| 112 | Ga0070679_100162601 | 3300005530 | Bacteria | 2206 |
| 113 | Ga0070679_100522698 | 3300005530 | Bacteria | 1131 |
| 114 | Ga0070684_100003278 | 3300005535 | Bacteria | 12122 |
| 115 | Ga0070684_100009174 | 3300005535 | Bacteria | 7780 |
| 116 | Ga0070684_100107569 | 3300005535 | Bacteria | 2498 |
| 117 | Ga0068853_100000032 | 3300005539 | Bacteria | 114306 |
| 118 | Ga0068853_100000811 | 3300005539 | Bacteria | 21781 |
| 119 | Ga0068853_100311023 | 3300005539 | Bacteria | 1458 |
| 120 | Ga0070672_100000945 | 3300005543 | Bacteria | 17467 |
| 121 | Ga0070672_100004830 | 3300005543 | Bacteria | 8857 |
| 122 | Ga0070672_100015335 | 3300005543 | Bacteria | 5454 |
| 123 | Ga0070686_100032521 | 3300005544 | Bacteria | 3199 |
| 124 | Ga0070693_100000332 | 3300005547 | Bacteria | 21624 |
| 125 | Ga0070665_100013547 | 3300005548 | Bacteria | 8203 |
| 126 | Ga0070665_100021059 | 3300005548 | Bacteria | 6556 |
| 127 | Ga0070665_100031747 | 3300005548 | Bacteria | 5316 |
| 128 | Ga0070665_100104758 | 3300005548 | Bacteria | 2831 |
| 129 | Ga0068855_100000591 | 3300005563 | Bacteria | 44412 |
| 130 | Ga0068855_100003900 | 3300005563 | Bacteria | 18212 |
| 131 | Ga0070664_100000187 | 3300005564 | Bacteria | 43750 |
| 132 | Ga0070664_100001469 | 3300005564 | Bacteria | 18785 |
| 133 | Ga0070664_100012642 | 3300005564 | Bacteria | 6872 |
| 134 | Ga0070664_100039187 | 3300005564 | Bacteria | 3992 |
| 135 | Ga0070664_100159072 | 3300005564 | Bacteria | 1997 |
| 136 | Ga0070664_100229423 | 3300005564 | Bacteria | 1664 |
| 137 | Ga0070664_100321093 | 3300005564 | Bacteria | 1403 |
| 138 | Ga0068857_100004021 | 3300005577 | Bacteria | 12383 |
| 139 | Ga0068857_100034073 | 3300005577 | Bacteria | 4505 |
| 140 | Ga0068857_100078693 | 3300005577 | Bacteria | 2943 |
| 141 | Ga0068854_100000664 | 3300005578 | Bacteria | 20511 |
| 142 | Ga0068854_100025831 | 3300005578 | Bacteria | 4031 |
| 143 | Ga0068854_100491376 | 3300005578 | Bacteria | 1032 |
| 144 | Ga0068856_100000291 | 3300005614 | Bacteria | 54890 |
| 145 | Ga0068856_100013426 | 3300005614 | Bacteria | 7930 |
| 146 | Ga0068856_100100639 | 3300005614 | Bacteria | 2882 |
| 147 | Ga0068856_100124219 | 3300005614 | Bacteria | 2583 |
| 148 | Ga0068856_100156559 | 3300005614 | Bacteria | 2288 |
| 149 | Ga0068852_100000906 | 3300005616 | Bacteria | 19629 |
| 150 | Ga0068852_100102337 | 3300005616 | Bacteria | 2588 |
| 151 | Ga0068852_100104429 | 3300005616 | Bacteria | 2564 |
| 152 | Ga0068852_100141397 | 3300005616 | Bacteria | 2228 |
| 153 | Ga0068852_100325452 | 3300005616 | Bacteria | 1494 |
| 154 | Ga0068859_100002786 | 3300005617 | Bacteria | 17711 |
| 155 | Ga0068864_100002633 | 3300005618 | Bacteria | 14809 |
| 156 | Ga0068864_100224571 | 3300005618 | Bacteria | 1734 |
| 157 | Ga0068866_10098458 | 3300005718 | Bacteria | 1608 |
| 158 | Ga0068861_100027898 | 3300005719 | Bacteria | 4117 |
| 159 | Ga0068861_100264410 | 3300005719 | Bacteria | 1474 |
| 160 | Ga0068851_10022469 | 3300005834 | Bacteria | 3073 |
| 161 | Ga0068851_10042459 | 3300005834 | Bacteria | 2289 |
| 162 | Ga0068863_100002317 | 3300005841 | Bacteria | 18934 |
| 163 | Ga0068858_100000620 | 3300005842 | Bacteria | 36979 |
| 164 | Ga0068858_100009881 | 3300005842 | Bacteria | 9065 |
| 165 | Ga0068860_100003524 | 3300005843 | Bacteria | 16093 |
| 166 | Ga0097620_100002786 | 3300006931 | Bacteria | 17711 |
| 167 | Ga0105240_10048201 | 3300009093 | Bacteria | 5386 |
| 168 | Ga0105240_10152373 | 3300009093 | Bacteria | 2752 |
| 169 | Ga0105240_10221098 | 3300009093 | Bacteria | 2206 |
| 170 | Ga0105240_10481935 | 3300009093 | Bacteria | 1383 |
| 171 | Ga0105245_10000229 | 3300009098 | Bacteria | 53255 |
| 172 | Ga0105245_10023282 | 3300009098 | Bacteria | 5437 |
| 173 | Ga0105245_10198795 | 3300009098 | Bacteria | 1924 |
| 174 | Ga0105247_10237929 | 3300009101 | Bacteria | 1239 |
| 175 | Ga0105243_10030827 | 3300009148 | Bacteria | 4132 |
| 176 | Ga0105241_10109553 | 3300009174 | Bacteria | 2208 |
| 177 | Ga0105241_10236893 | 3300009174 | Bacteria | 1541 |
| 178 | Ga0105248_10000083 | 3300009177 | Bacteria | 110619 |
| 179 | Ga0105248_10000790 | 3300009177 | Bacteria | 35522 |
| 180 | Ga0105248_10001634 | 3300009177 | Bacteria | 24926 |
| 181 | Ga0105248_10003127 | 3300009177 | Bacteria | 18320 |
| 182 | Ga0105248_10011959 | 3300009177 | Bacteria | 9570 |
| 183 | Ga0105248_10023944 | 3300009177 | Bacteria | 6787 |
| 184 | Ga0105248_10254978 | 3300009177 | Bacteria | 1975 |
| 185 | Ga0105238_10024793 | 3300009551 | Bacteria | 6113 |
| 186 | Ga0105239_10221754 | 3300010375 | Bacteria | 2120 |
| 187 | Ga0105246_10006237 | 3300011119 | Bacteria | 7278 |
| 188 | Ga0157373_10071086 | 3300013100 | Bacteria | 2458 |
| 189 | Ga0157373_10087945 | 3300013100 | Bacteria | 2189 |
| 190 | Ga0157373_10089370 | 3300013100 | Bacteria | 2169 |
| 191 | Ga0157373_10100314 | 3300013100 | Bacteria | 2037 |
| 192 | Ga0157373_10169372 | 3300013100 | Bacteria | 1537 |
| 193 | Ga0157371_10000756 | 3300013102 | Bacteria | 37389 |
| 194 | Ga0157371_10009514 | 3300013102 | Bacteria | 7642 |
| 195 | Ga0157371_10024460 | 3300013102 | Bacteria | 4410 |
| 196 | Ga0157371_10070421 | 3300013102 | Bacteria | 2476 |
| 197 | Ga0157371_10347565 | 3300013102 | Bacteria | 1079 |
| 198 | Ga0157370_10150712 | 3300013104 | Bacteria | 2164 |
| 199 | Ga0157369_10000137 | 3300013105 | Bacteria | 103542 |
| 200 | Ga0157369_10007204 | 3300013105 | Bacteria | 12816 |
| 201 | Ga0157369_10019245 | 3300013105 | Bacteria | 7638 |
| 202 | Ga0157369_10042284 | 3300013105 | Bacteria | 4972 |
| 203 | Ga0157369_10049779 | 3300013105 | Bacteria | 4540 |
| 204 | Ga0157369_10084813 | 3300013105 | Bacteria | 3385 |
| 205 | Ga0157369_10224048 | 3300013105 | Bacteria | 1967 |
| 206 | Ga0157374_10019076 | 3300013296 | Bacteria | 6068 |
| 207 | Ga0157374_10090171 | 3300013296 | Bacteria | 2922 |
| 208 | Ga0157374_10219149 | 3300013296 | Bacteria | 1867 |
| 209 | Ga0157374_10505694 | 3300013296 | Bacteria | 1213 |
| 210 | Ga0157378_10000154 | 3300013297 | Bacteria | 64986 |
| 211 | Ga0157378_10191875 | 3300013297 | Bacteria | 1927 |
| 212 | Ga0163162_10023881 | 3300013306 | Bacteria | 6034 |
| 213 | Ga0157372_10379691 | 3300013307 | Bacteria | 1647 |
| 214 | Ga0157372_10454013 | 3300013307 | Bacteria | 1493 |
| 215 | Ga0157375_10020583 | 3300013308 | Bacteria | 6030 |
| 216 | Ga0157375_10200197 | 3300013308 | Bacteria | 2153 |
| 217 | Ga0157375_10403985 | 3300013308 | Bacteria | 1533 |
| 218 | Ga0163163_10001064 | 3300014325 | Bacteria | 23319 |
| 219 | Ga0182008_10222246 | 3300014497 | Bacteria | 966 |
| 220 | Ga0157376_10090404 | 3300014969 | Bacteria | 2649 |
| 221 | Ga0206353_11586731 | 3300020082 | Bacteria | 976 |
| 222 | Ga0213875_10020399 | 3300021388 | Bacteria | 3179 |
| 223 | Ga0207673_1007899 | 3300025290 | Bacteria | 1341 |
| 224 | Ga0207697_10000187 | 3300025315 | Bacteria | 32396 |
| 225 | Ga0207656_10001253 | 3300025321 | Bacteria | 8367 |
| 226 | Ga0207656_10054507 | 3300025321 | Bacteria | 1738 |
| 227 | Ga0207682_10059230 | 3300025893 | Bacteria | 1600 |
| 228 | Ga0207688_10000595 | 3300025901 | Bacteria | 17763 |
| 229 | Ga0207688_10022437 | 3300025901 | Bacteria | 3454 |
| 230 | Ga0207680_10002585 | 3300025903 | Bacteria | 8443 |
| 231 | Ga0207680_10068629 | 3300025903 | Bacteria | 2188 |
| 232 | Ga0207680_10134016 | 3300025903 | Bacteria | 1635 |
| 233 | Ga0207647_10000090 | 3300025904 | Bacteria | 69395 |
| 234 | Ga0207647_10012986 | 3300025904 | Bacteria | 5785 |
| 235 | Ga0207647_10028131 | 3300025904 | Bacteria | 3656 |
| 236 | Ga0207647_10047898 | 3300025904 | Bacteria | 2656 |
| 237 | Ga0207645_10012721 | 3300025907 | Bacteria | 5706 |
| 238 | Ga0207645_10031056 | 3300025907 | Bacteria | 3439 |
| 239 | Ga0207645_10096039 | 3300025907 | Bacteria | 1909 |
| 240 | Ga0207705_10000030 | 3300025909 | Bacteria | 239341 |
| 241 | Ga0207705_10000072 | 3300025909 | Bacteria | 126043 |
| 242 | Ga0207705_10010411 | 3300025909 | Bacteria | 6760 |
| 243 | Ga0207705_10011473 | 3300025909 | Bacteria | 6412 |
| 244 | Ga0207705_10023019 | 3300025909 | Bacteria | 4443 |
| 245 | Ga0207705_10031771 | 3300025909 | Bacteria | 3770 |
| 246 | Ga0207705_10095609 | 3300025909 | Bacteria | 2180 |
| 247 | Ga0207705_10175862 | 3300025909 | Bacteria | 1613 |
| 248 | Ga0207705_10197535 | 3300025909 | Bacteria | 1523 |
| 249 | Ga0207695_10014730 | 3300025913 | Bacteria | 9246 |
| 250 | Ga0207695_10036058 | 3300025913 | Bacteria | 5351 |
| 251 | Ga0207695_10157091 | 3300025913 | Bacteria | 2208 |
| 252 | Ga0207657_10000176 | 3300025919 | Bacteria | 65856 |
| 253 | Ga0207657_10002682 | 3300025919 | Bacteria | 19192 |
| 254 | Ga0207657_10007866 | 3300025919 | Bacteria | 10882 |
| 255 | Ga0207657_10014374 | 3300025919 | Bacteria | 7730 |
| 256 | Ga0207657_10014766 | 3300025919 | Bacteria | 7605 |
| 257 | Ga0207657_10018127 | 3300025919 | Bacteria | 6735 |
| 258 | Ga0207657_10020297 | 3300025919 | Bacteria | 6284 |
| 259 | Ga0207657_10140627 | 3300025919 | Bacteria | 1972 |
| 260 | Ga0207649_10000810 | 3300025920 | Bacteria | 20093 |
| 261 | Ga0207649_10004374 | 3300025920 | Bacteria | 7667 |
| 262 | Ga0207649_10006147 | 3300025920 | Bacteria | 6518 |
| 263 | Ga0207649_10016042 | 3300025920 | Bacteria | 4218 |
| 264 | Ga0207649_10046477 | 3300025920 | Bacteria | 2667 |
| 265 | Ga0207649_10068215 | 3300025920 | Bacteria | 2260 |
| 266 | Ga0207649_10075884 | 3300025920 | Bacteria | 2161 |
| 267 | Ga0207649_10083466 | 3300025920 | Bacteria | 2074 |
| 268 | Ga0207652_10003111 | 3300025921 | Bacteria | 13832 |
| 269 | Ga0207681_10005702 | 3300025923 | Bacteria | 7642 |
| 270 | Ga0207681_10146085 | 3300025923 | Bacteria | 1767 |
| 271 | Ga0207681_10167103 | 3300025923 | Bacteria | 1664 |
| 272 | Ga0207694_10036262 | 3300025924 | Bacteria | 3784 |
| 273 | Ga0207650_10005079 | 3300025925 | Bacteria | 8983 |
| 274 | Ga0207650_10016751 | 3300025925 | Bacteria | 5125 |
| 275 | Ga0207650_10034652 | 3300025925 | Bacteria | 3662 |
| 276 | Ga0207650_10059964 | 3300025925 | Bacteria | 2838 |
| 277 | Ga0207650_10251182 | 3300025925 | Bacteria | 1432 |
| 278 | Ga0207659_10007264 | 3300025926 | Bacteria | 6805 |
| 279 | Ga0207659_10012137 | 3300025926 | Bacteria | 5465 |
| 280 | Ga0207659_10138795 | 3300025926 | Bacteria | 1885 |
| 281 | Ga0207659_10174596 | 3300025926 | Bacteria | 1697 |
| 282 | Ga0207687_10001063 | 3300025927 | Bacteria | 18628 |
| 283 | Ga0207687_10012657 | 3300025927 | Bacteria | 5512 |
| 284 | Ga0207664_10079535 | 3300025929 | Bacteria | 2662 |
| 285 | Ga0207664_10184904 | 3300025929 | Bacteria | 1791 |
| 286 | Ga0207644_10005196 | 3300025931 | Bacteria | 8507 |
| 287 | Ga0207644_10015754 | 3300025931 | Bacteria | 5080 |
| 288 | Ga0207644_10018835 | 3300025931 | Bacteria | 4677 |
| 289 | Ga0207644_10105072 | 3300025931 | Bacteria | 2127 |
| 290 | Ga0207644_10106168 | 3300025931 | Bacteria | 2117 |
| 291 | Ga0207644_10125658 | 3300025931 | Bacteria | 1957 |
| 292 | Ga0207644_10141283 | 3300025931 | Bacteria | 1854 |
| 293 | Ga0207690_10000245 | 3300025932 | Bacteria | 39464 |
| 294 | Ga0207690_10005573 | 3300025932 | Bacteria | 7437 |
| 295 | Ga0207690_10014951 | 3300025932 | Bacteria | 4700 |
| 296 | Ga0207690_10055336 | 3300025932 | Bacteria | 2672 |
| 297 | Ga0207690_10109546 | 3300025932 | Bacteria | 1987 |
| 298 | Ga0207690_10133771 | 3300025932 | Bacteria | 1818 |
| 299 | Ga0207690_10189570 | 3300025932 | Bacteria | 1554 |
| 300 | Ga0207690_10198959 | 3300025932 | Bacteria | 1520 |
| 301 | Ga0207690_10439908 | 3300025932 | Bacteria | 1046 |
| 302 | Ga0207706_10000041 | 3300025933 | Bacteria | 130090 |
| 303 | Ga0207706_10001429 | 3300025933 | Bacteria | 23905 |
| 304 | Ga0207706_10003596 | 3300025933 | Bacteria | 14803 |
| 305 | Ga0207706_10011213 | 3300025933 | Bacteria | 8172 |
| 306 | Ga0207706_10011368 | 3300025933 | Bacteria | 8112 |
| 307 | Ga0207706_10059459 | 3300025933 | Bacteria | 3365 |
| 308 | Ga0207706_10082581 | 3300025933 | Bacteria | 2824 |
| 309 | Ga0207706_10180054 | 3300025933 | Bacteria | 1856 |
| 310 | Ga0207706_10321123 | 3300025933 | Bacteria | 1348 |
| 311 | Ga0207669_10022495 | 3300025937 | Bacteria | 3350 |
| 312 | Ga0207669_10097778 | 3300025937 | Bacteria | 1931 |
| 313 | Ga0207669_10179077 | 3300025937 | Bacteria | 1518 |
| 314 | Ga0207691_10000045 | 3300025940 | Bacteria | 99798 |
| 315 | Ga0207691_10005139 | 3300025940 | Bacteria | 12634 |
| 316 | Ga0207691_10013011 | 3300025940 | Bacteria | 7967 |
| 317 | Ga0207691_10128425 | 3300025940 | Bacteria | 2241 |
| 318 | Ga0207711_10001311 | 3300025941 | Bacteria | 23539 |
| 319 | Ga0207711_10001677 | 3300025941 | Bacteria | 20395 |
| 320 | Ga0207711_10002858 | 3300025941 | Bacteria | 15138 |
| 321 | Ga0207711_10003863 | 3300025941 | Bacteria | 12888 |
| 322 | Ga0207711_10009533 | 3300025941 | Bacteria | 8098 |
| 323 | Ga0207711_10189622 | 3300025941 | Bacteria | 1873 |
| 324 | Ga0207689_10000226 | 3300025942 | Bacteria | 50110 |
| 325 | Ga0207661_10000953 | 3300025944 | Bacteria | 19059 |
| 326 | Ga0207661_10005783 | 3300025944 | Bacteria | 8719 |
| 327 | Ga0207661_10043965 | 3300025944 | Bacteria | 3527 |
| 328 | Ga0207661_10084033 | 3300025944 | Bacteria | 2636 |
| 329 | Ga0207679_10000243 | 3300025945 | Bacteria | 41706 |
| 330 | Ga0207679_10008060 | 3300025945 | Bacteria | 6698 |
| 331 | Ga0207679_10112309 | 3300025945 | Bacteria | 2153 |
| 332 | Ga0207667_10006092 | 3300025949 | Bacteria | 14659 |
| 333 | Ga0207667_10063634 | 3300025949 | Bacteria | 3854 |
| 334 | Ga0207667_10201249 | 3300025949 | Bacteria | 2043 |
| 335 | Ga0207667_10228513 | 3300025949 | Bacteria | 1905 |
| 336 | Ga0207651_10000494 | 3300025960 | Bacteria | 16521 |
| 337 | Ga0207651_10012001 | 3300025960 | Bacteria | 4878 |
| 338 | Ga0207651_10013969 | 3300025960 | Bacteria | 4619 |
| 339 | Ga0207651_10034105 | 3300025960 | Bacteria | 3292 |
| 340 | Ga0207651_10076825 | 3300025960 | Bacteria | 2388 |
| 341 | Ga0207668_10027591 | 3300025972 | Bacteria | 3700 |
| 342 | Ga0207668_10060121 | 3300025972 | Bacteria | 2666 |
| 343 | Ga0207668_10315338 | 3300025972 | Bacteria | 1296 |
| 344 | Ga0207640_10004637 | 3300025981 | Bacteria | 7459 |
| 345 | Ga0207640_10124709 | 3300025981 | Bacteria | 1852 |
| 346 | Ga0207658_10004807 | 3300025986 | Bacteria | 9347 |
| 347 | Ga0207658_10008814 | 3300025986 | Bacteria | 6848 |
| 348 | Ga0207658_10174315 | 3300025986 | Bacteria | 1775 |
| 349 | Ga0207658_10353257 | 3300025986 | Bacteria | 1280 |
| 350 | Ga0207658_10462448 | 3300025986 | Bacteria | 1125 |
| 351 | Ga0207677_10003117 | 3300026023 | Bacteria | 8747 |
| 352 | Ga0207677_10018354 | 3300026023 | Bacteria | 4196 |
| 353 | Ga0207677_10030638 | 3300026023 | Bacteria | 3437 |
| 354 | Ga0207677_10143483 | 3300026023 | Bacteria | 1832 |
| 355 | Ga0207677_10190567 | 3300026023 | Bacteria | 1621 |
| 356 | Ga0207703_10002105 | 3300026035 | Bacteria | 17519 |
| 357 | Ga0207703_10002663 | 3300026035 | Bacteria | 15352 |
| 358 | Ga0207703_10079372 | 3300026035 | Bacteria | 2730 |
| 359 | Ga0207639_10000222 | 3300026041 | Bacteria | 42464 |
| 360 | Ga0207639_10006140 | 3300026041 | Bacteria | 8157 |
| 361 | Ga0207639_10033533 | 3300026041 | Bacteria | 3788 |
| 362 | Ga0207678_10004584 | 3300026067 | Bacteria | 12425 |
| 363 | Ga0207678_10004795 | 3300026067 | Bacteria | 12143 |
| 364 | Ga0207678_10009690 | 3300026067 | Bacteria | 8475 |
| 365 | Ga0207678_10021513 | 3300026067 | Bacteria | 5656 |
| 366 | Ga0207678_10039637 | 3300026067 | Bacteria | 4088 |
| 367 | Ga0207678_10056947 | 3300026067 | Bacteria | 3364 |
| 368 | Ga0207678_10087759 | 3300026067 | Bacteria | 2658 |
| 369 | Ga0207678_10100749 | 3300026067 | Bacteria | 2467 |
| 370 | Ga0207678_10181336 | 3300026067 | Bacteria | 1798 |
| 371 | Ga0207702_10000074 | 3300026078 | Bacteria | 113070 |
| 372 | Ga0207702_10044382 | 3300026078 | Bacteria | 3736 |
| 373 | Ga0207702_10245637 | 3300026078 | Bacteria | 1679 |
| 374 | Ga0207702_10467518 | 3300026078 | Bacteria | 1226 |
| 375 | Ga0207702_10543802 | 3300026078 | Bacteria | 1135 |
| 376 | Ga0207641_10024907 | 3300026088 | Bacteria | 4933 |
| 377 | Ga0207648_10002102 | 3300026089 | Bacteria | 21704 |
| 378 | Ga0207648_10008748 | 3300026089 | Bacteria | 9757 |
| 379 | Ga0207648_10222877 | 3300026089 | Bacteria | 1676 |
| 380 | Ga0207676_10001193 | 3300026095 | Bacteria | 19504 |
| 381 | Ga0207676_10005397 | 3300026095 | Bacteria | 9048 |
| 382 | Ga0207676_10007462 | 3300026095 | Bacteria | 7760 |
| 383 | Ga0207676_10030129 | 3300026095 | Bacteria | 4070 |
| 384 | Ga0207674_10000531 | 3300026116 | Bacteria | 49979 |
| 385 | Ga0207674_10030221 | 3300026116 | Bacteria | 5698 |
| 386 | Ga0207674_10125058 | 3300026116 | Bacteria | 2537 |
| 387 | Ga0207674_10127106 | 3300026116 | Bacteria | 2514 |
| 388 | Ga0207675_100044742 | 3300026118 | Bacteria | 4137 |
| 389 | Ga0207675_100075063 | 3300026118 | Bacteria | 3164 |
| 390 | Ga0207698_10000892 | 3300026142 | Bacteria | 17333 |
| 391 | Ga0207698_10031124 | 3300026142 | Bacteria | 3848 |
| 392 | Ga0207698_10089400 | 3300026142 | Bacteria | 2515 |
| 393 | Ga0207698_10412655 | 3300026142 | Bacteria | 1294 |
| 394 | Ga0268266_10049829 | 3300028379 | Bacteria | 3592 |
| 395 | Ga0268266_10055274 | 3300028379 | Bacteria | 3412 |
| 396 | Ga0268266_10083549 | 3300028379 | Bacteria | 2787 |
| 397 | Ga0268265_10501880 | 3300028380 | Bacteria | 1143 |
| 398 | Ga0268264_10147803 | 3300028381 | Bacteria | 2103 |
| 399 | Ga0307408_100047429 | 3300031548 | Bacteria | 3077 |
| 400 | Ga0307408_100077095 | 3300031548 | Bacteria | 2481 |
| 401 | Ga0307408_100365071 | 3300031548 | Bacteria | 1229 |
| 402 | Ga0307405_10017948 | 3300031731 | Bacteria | 3894 |
| 403 | Ga0307405_10026183 | 3300031731 | Bacteria | 3362 |
| 404 | Ga0307405_10100468 | 3300031731 | Bacteria | 1939 |
| 405 | Ga0307405_10103982 | 3300031731 | Bacteria | 1910 |
| 406 | Ga0307405_10118105 | 3300031731 | Bacteria | 1809 |
| 407 | Ga0307413_10003433 | 3300031824 | Bacteria | 6664 |
| 408 | Ga0307413_10004014 | 3300031824 | Bacteria | 6325 |
| 409 | Ga0307413_10099590 | 3300031824 | Bacteria | 1916 |
| 410 | Ga0307410_10005046 | 3300031852 | Bacteria | 6936 |
| 411 | Ga0307410_10067429 | 3300031852 | Bacteria | 2468 |
| 412 | Ga0307410_10141388 | 3300031852 | Bacteria | 1781 |
| 413 | Ga0307406_10028024 | 3300031901 | Bacteria | 3400 |
| 414 | Ga0307406_10077785 | 3300031901 | Bacteria | 2196 |
| 415 | Ga0307406_10079032 | 3300031901 | Bacteria | 2180 |
| 416 | Ga0307406_10108653 | 3300031901 | Bacteria | 1905 |
| 417 | Ga0307406_10170289 | 3300031901 | Bacteria | 1575 |
| 418 | Ga0307407_10039617 | 3300031903 | Bacteria | 2621 |
| 419 | Ga0307407_10060018 | 3300031903 | Bacteria | 2217 |
| 420 | Ga0307407_10130786 | 3300031903 | Bacteria | 1605 |
| 421 | Ga0307412_10011180 | 3300031911 | Bacteria | 5194 |
| 422 | Ga0307412_10020171 | 3300031911 | Bacteria | 4052 |
| 423 | Ga0307412_10120115 | 3300031911 | Bacteria | 1891 |
| 424 | Ga0307412_10205605 | 3300031911 | Bacteria | 1498 |
| 425 | Ga0307409_100071473 | 3300031995 | Bacteria | 2759 |
| 426 | Ga0307409_100129968 | 3300031995 | Bacteria | 2150 |
| 427 | Ga0307409_100181339 | 3300031995 | Bacteria | 1864 |
| 428 | Ga0307409_100287227 | 3300031995 | Bacteria | 1523 |
| 429 | Ga0307409_100289801 | 3300031995 | Bacteria | 1518 |
| 430 | Ga0307409_100436012 | 3300031995 | Bacteria | 1261 |
| 431 | Ga0307416_100014929 | 3300032002 | Bacteria | 5344 |
| 432 | Ga0307416_100169776 | 3300032002 | Bacteria | 2029 |
| 433 | Ga0307416_100546920 | 3300032002 | Bacteria | 1230 |
| 434 | Ga0307414_10020483 | 3300032004 | Bacteria | 4123 |
| 435 | Ga0307414_10037658 | 3300032004 | Bacteria | 3241 |
| 436 | Ga0307414_10069861 | 3300032004 | Bacteria | 2526 |
| 437 | Ga0307414_10099666 | 3300032004 | Bacteria | 2183 |
| 438 | Ga0307414_10243286 | 3300032004 | Bacteria | 1491 |
| 439 | Ga0307411_10016425 | 3300032005 | Bacteria | 4188 |
| 440 | Ga0307411_10018606 | 3300032005 | Bacteria | 3990 |
| 441 | Ga0307415_100039909 | 3300032126 | Bacteria | 3106 |
| 442 | Ga0307415_100197213 | 3300032126 | Bacteria | 1594 |
| 443 | Ga0373943_0029916 | 3300035170 | Bacteria | 2575 |
| 444 | Ga0373955_0247488 | 3300035172 | Bacteria | 1068 |
| 445 | Ga0373931_0052464 | 3300035691 | Bacteria | 2174 |
| 446 | Ga0373935_0252100 | 3300035692 | Bacteria | 1235 |
| 447 | Ga0373933_0031583 | 3300035724 | Bacteria | 3072 |
| 448 | Ga0373925_0044348 | 3300037068 | Bacteria | 3302 |
| 449 | Ga0395899_0000302 | 3300037312 | Bacteria | 63367 |
| 450 | Ga0395899_0017613 | 3300037312 | Bacteria | 5440 |
| 451 | Ga0395899_0019434 | 3300037312 | Bacteria | 5161 |
| 452 | Ga0395899_0032366 | 3300037312 | Bacteria | 3927 |
| 453 | Ga0395899_0044714 | 3300037312 | Bacteria | 3299 |
| 454 | Ga0395899_0046829 | 3300037312 | Bacteria | 3220 |
| 455 | Ga0395899_0053011 | 3300037312 | Bacteria | 3004 |
| 456 | Ga0395899_0090094 | 3300037312 | Bacteria | 2224 |
| 457 | Ga0395899_0122093 | 3300037312 | Bacteria | 1865 |
| 458 | Ga0395899_0123975 | 3300037312 | Bacteria | 1848 |
| 459 | Ga0395899_0193215 | 3300037312 | Bacteria | 1423 |
| 460 | Ga0395899_0233293 | 3300037312 | Bacteria | 1269 |
| 461 | Ga0395900_0000997 | 3300037418 | Bacteria | 36770 |
| 462 | Ga0395900_0002684 | 3300037418 | Bacteria | 19451 |
| 463 | Ga0395900_0007283 | 3300037418 | Bacteria | 11451 |
| 464 | Ga0395900_0009267 | 3300037418 | Bacteria | 10092 |
| 465 | Ga0395900_0017664 | 3300037418 | Bacteria | 7280 |
| 466 | Ga0395900_0023580 | 3300037418 | Bacteria | 6295 |
| 467 | Ga0395900_0027388 | 3300037418 | Bacteria | 5837 |
| 468 | Ga0395900_0166059 | 3300037418 | Bacteria | 2249 |
| 469 | Ga0395900_0237224 | 3300037418 | Bacteria | 1831 |
| 470 | Ga0395900_0275376 | 3300037418 | Bacteria | 1676 |
| 471 | Ga0395900_0383731 | 3300037418 | Bacteria | 1372 |
| 472 | Ga0395900_0427317 | 3300037418 | Bacteria | 1284 |
| 473 | Ga0395900_0594746 | 3300037418 | Bacteria | 1047 |
| 474 | Ga0395898_0000054 | 3300037466 | Bacteria | 279561 |
| 475 | Ga0395898_0014768 | 3300037466 | Bacteria | 8016 |
| 476 | Ga0395898_0051732 | 3300037466 | Bacteria | 4016 |
| 477 | Ga0395898_0053971 | 3300037466 | Bacteria | 3923 |
| 478 | Ga0395898_0054496 | 3300037466 | Bacteria | 3902 |
| 479 | Ga0395898_0085987 | 3300037466 | Bacteria | 3031 |
| 480 | Ga0395898_0193645 | 3300037466 | Bacteria | 1942 |
| 481 | Ga0395905_0000046 | 3300037471 | Bacteria | 240463 |
| 482 | Ga0395905_0001164 | 3300037471 | Bacteria | 32823 |
| 483 | Ga0395905_0043817 | 3300037471 | Bacteria | 4198 |
| 484 | Ga0395905_0047368 | 3300037471 | Bacteria | 4029 |
| 485 | Ga0395905_0084641 | 3300037471 | Bacteria | 2971 |
| 486 | Ga0395905_0129196 | 3300037471 | Bacteria | 2376 |
| 487 | Ga0395905_0259947 | 3300037471 | Bacteria | 1621 |
| 488 | Ga0395905_0373048 | 3300037471 | Bacteria | 1320 |
| 489 | Ga0436364_0089743 | 3300037853 | Bacteria | 14523 |
| 490 | Ga0395901_0000086 | 3300038443 | Bacteria | 125359 |
| 491 | Ga0395901_0000516 | 3300038443 | Bacteria | 44694 |
| 492 | Ga0395901_0002142 | 3300038443 | Bacteria | 20180 |
| 493 | Ga0395901_0004461 | 3300038443 | Bacteria | 14121 |
| 494 | Ga0395901_0007579 | 3300038443 | Bacteria | 10963 |
| 495 | Ga0395901_0027070 | 3300038443 | Bacteria | 5889 |
| 496 | Ga0395901_0041174 | 3300038443 | Bacteria | 4786 |
| 497 | Ga0395901_0061569 | 3300038443 | Bacteria | 3905 |
| 498 | Ga0395901_0150594 | 3300038443 | Bacteria | 2444 |
| 499 | Ga0395901_0183756 | 3300038443 | Bacteria | 2193 |
| 500 | Ga0395901_0283645 | 3300038443 | Bacteria | 1720 |
| 501 | Ga0395901_0337678 | 3300038443 | Bacteria | 1557 |
| 502 | Ga0395901_0556751 | 3300038443 | Bacteria | 1161 |
| 503 | Ga0395901_0677003 | 3300038443 | Bacteria | 1032 |
| 504 | Ga0466969_0039451 | 3300044656 | Bacteria | 2371 |
| 505 | Ga0466966_0001152 | 3300044684 | Bacteria | 16994 |
| 506 | Ga0466966_0003709 | 3300044684 | Bacteria | 10071 |
| 507 | Ga0466966_0022621 | 3300044684 | Bacteria | 4124 |
| 508 | Ga0466966_0029842 | 3300044684 | Bacteria | 3545 |
| 509 | Ga0466961_0029514 | 3300044693 | Bacteria | 3524 |
| 510 | Ga0466961_0041922 | 3300044693 | Bacteria | 2934 |
| 511 | Ga0466963_0015928 | 3300044694 | Bacteria | 4667 |
| 512 | Ga0466963_0029848 | 3300044694 | Bacteria | 3513 |
| 513 | Ga0466963_0081294 | 3300044694 | Bacteria | 2194 |
| 514 | Ga0466971_0014596 | 3300044719 | Bacteria | 3458 |
| 515 | Ga0466970_0001142 | 3300044765 | Bacteria | 12860 |
| 516 | Ga0466970_0002914 | 3300044765 | Bacteria | 8290 |
| 517 | Ga0466957_0008413 | 3300044842 | Bacteria | 5867 |
| 518 | Ga0466957_0043075 | 3300044842 | Bacteria | 2732 |
| 519 | Ga0466959_0020592 | 3300045049 | Bacteria | 4859 |
| 520 | Ga0466959_0021499 | 3300045049 | Bacteria | 4758 |
| 521 | Ga0466959_0110958 | 3300045049 | Bacteria | 1957 |
| 522 | Ga0466959_0164656 | 3300045049 | Bacteria | 1557 |
| 523 | Ga0466958_0000291 | 3300045836 | Bacteria | 19576 |
| 524 | Ga0466958_0027595 | 3300045836 | Bacteria | 3361 |
| 525 | Ga0466958_0093701 | 3300045836 | Bacteria | 1860 |
| 526 | Ga0466958_0204334 | 3300045836 | Bacteria | 1257 |
| 527 | Ga0466958_0254738 | 3300045836 | Bacteria | 1123 |
| 528 | Ga0466967_0126710 | 3300045976 | Bacteria | 2366 |
| 529 | Ga0466967_0559283 | 3300045976 | Bacteria | 1126 |
| 530 | Ga0495620_0099039 | 3300046515 | Bacteria | 1163 |
| 531 | Ga0495663_0061392 | 3300046525 | Bacteria | 1182 |
| 532 | Ga0495598_0006299 | 3300046537 | Bacteria | 2675 |
| 533 | Ga0495633_0055753 | 3300046558 | Bacteria | 1857 |
| 534 | Ga0495668_0190935 | 3300046616 | Bacteria | 1122 |
| 535 | Ga0495623_0070991 | 3300046679 | Bacteria | 2168 |
| 536 | Ga0495669_0001170 | 3300046684 | Bacteria | 10906 |
| 537 | Ga0495669_0009423 | 3300046684 | Bacteria | 4116 |
| 538 | Ga0495669_0012829 | 3300046684 | Bacteria | 3567 |
| 539 | Ga0495669_0014347 | 3300046684 | Bacteria | 3387 |
| 540 | Ga0495669_0096011 | 3300046684 | Bacteria | 1373 |
| 541 | Ga0495670_0011219 | 3300046691 | Bacteria | 4404 |
| 542 | Ga0495602_0046500 | 3300048088 | Bacteria | 3920 |
| 543 | Ga0496100_0037411 | 3300048903 | Bacteria | 3068 |
| 544 | Ga0496101_0003378 | 3300048904 | Bacteria | 9953 |
| 545 | Ga0496101_0353140 | 3300048904 | Bacteria | 1156 |
| 546 | Ga0496105_0099105 | 3300048908 | Bacteria | 2406 |
| 547 | Ga0496106_0050361 | 3300048909 | Bacteria | 3139 |
| 548 | Ga0496107_0144020 | 3300048910 | Bacteria | 1761 |
| 549 | Ga0496108_0079528 | 3300048911 | Bacteria | 2776 |
| 550 | Ga0496109_0000775 | 3300048912 | Bacteria | 26550 |
| 551 | Ga0496109_0098706 | 3300048912 | Bacteria | 2708 |
| 552 | Ga0496110_0005805 | 3300048913 | Bacteria | 9702 |
| 553 | Ga0496110_0012933 | 3300048913 | Bacteria | 6882 |
| 554 | Ga0496111_0004837 | 3300048914 | Bacteria | 8544 |
| 555 | Ga0496111_0012279 | 3300048914 | Bacteria | 5795 |
| 556 | Ga0496112_0041602 | 3300048915 | Bacteria | 4496 |
| 557 | Ga0496112_0055685 | 3300048915 | Bacteria | 3890 |
| 558 | Ga0496113_0265737 | 3300048916 | Bacteria | 1371 |
| 559 | Ga0496114_0026396 | 3300048917 | Bacteria | 4755 |
| 560 | Ga0501074_0044732 | 3300049590 | Bacteria | 3204 |
| 561 | Ga0495612_0041992 | 3300053078 | Bacteria | 1866 |
| 562 | Ga0466962_0002330 | 3300061719 | Bacteria | 9001 |
| 563 | Ga0466962_0049527 | 3300061719 | Bacteria | 2008 |
| 564 | Ga0466962_0068276 | 3300061719 | Bacteria | 1697 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002067 | JGI24735J21928_10004142 | JGI24735J21928_100041422 | 258 |
| 2 | 3300038443 | Ga0395901_0283645 | Ga0395901_0283645_47_823 | 258 |
| 3 | 3300038443 | Ga0395901_0677003 | Ga0395901_0677003_57_833 | 258 |
| 4 | 3300061719 | Ga0466962_0049527 | Ga0466962_0049527_1194_1970 | 258 |
| 5 | 3300048904 | Ga0496101_0353140 | Ga0496101_0353140_20_802 | 260 |
| 6 | 3300037471 | Ga0395905_0259947 | Ga0395905_0259947_41_832 | 263 |
| 7 | 3300001979 | JGI24740J21852_10000089 | JGI24740J21852_1000008923 | 277 |
| 8 | 3300001991 | JGI24743J22301_10002872 | JGI24743J22301_100028723 | 277 |
| 9 | 3300005331 | Ga0070670_100177227 | Ga0070670_1001772273 | 277 |
| 10 | 3300005335 | Ga0070666_10065966 | Ga0070666_100659662 | 277 |
| 11 | 3300005338 | Ga0068868_100048166 | Ga0068868_1000481663 | 277 |
| 12 | 3300005354 | Ga0070675_100023558 | Ga0070675_1000235582 | 277 |
| 13 | 3300005364 | Ga0070673_100011602 | Ga0070673_1000116023 | 277 |
| 14 | 3300005367 | Ga0070667_100104177 | Ga0070667_1001041773 | 277 |
| 15 | 3300005456 | Ga0070678_100034382 | Ga0070678_1000343824 | 277 |
| 16 | 3300005457 | Ga0070662_100222646 | Ga0070662_1002226462 | 277 |
| 17 | 3300005543 | Ga0070672_100015335 | Ga0070672_1000153355 | 277 |
| 18 | 3300005548 | Ga0070665_100013547 | Ga0070665_1000135473 | 277 |
| 19 | 3300005564 | Ga0070664_100229423 | Ga0070664_1002294232 | 277 |
| 20 | 3300009177 | Ga0105248_10254978 | Ga0105248_102549783 | 277 |
| 21 | 3300013296 | Ga0157374_10019076 | Ga0157374_100190765 | 277 |
| 22 | 3300013306 | Ga0163162_10023881 | Ga0163162_100238815 | 277 |
| 23 | 3300013308 | Ga0157375_10020583 | Ga0157375_100205834 | 277 |
| 24 | 3300014969 | Ga0157376_10090404 | Ga0157376_100904043 | 277 |
| 25 | 3300025901 | Ga0207688_10022437 | Ga0207688_100224372 | 277 |
| 26 | 3300025903 | Ga0207680_10068629 | Ga0207680_100686292 | 277 |
| 27 | 3300025925 | Ga0207650_10059964 | Ga0207650_100599643 | 277 |
| 28 | 3300025926 | Ga0207659_10174596 | Ga0207659_101745961 | 277 |
| 29 | 3300025933 | Ga0207706_10180054 | Ga0207706_101800543 | 277 |
| 30 | 3300025940 | Ga0207691_10013011 | Ga0207691_100130118 | 277 |
| 31 | 3300025941 | Ga0207711_10189622 | Ga0207711_101896223 | 277 |
| 32 | 3300025960 | Ga0207651_10012001 | Ga0207651_100120014 | 277 |
| 33 | 3300026023 | Ga0207677_10030638 | Ga0207677_100306382 | 277 |
| 34 | 3300026035 | Ga0207703_10079372 | Ga0207703_100793724 | 277 |
| 35 | 3300028379 | Ga0268266_10083549 | Ga0268266_100835493 | 277 |
| 36 | 3300044694 | Ga0466963_0015928 | Ga0466963_0015928_2152_3039 | 279 |
| 37 | 3300031852 | Ga0307410_10141388 | Ga0307410_101413883 | 280 |
| 38 | 3300031901 | Ga0307406_10108653 | Ga0307406_101086533 | 280 |
| 39 | 3300044684 | Ga0466966_0029842 | Ga0466966_0029842_1878_2765 | 281 |
| 40 | 3300045049 | Ga0466959_0164656 | Ga0466959_0164656_94_981 | 281 |
| 41 | 3300045836 | Ga0466958_0254738 | Ga0466958_0254738_27_914 | 281 |
| 42 | 3300044656 | Ga0466969_0039451 | Ga0466969_0039451_779_1666 | 286 |
| 43 | 3300044684 | Ga0466966_0003709 | Ga0466966_0003709_8920_9807 | 286 |
| 44 | 3300044693 | Ga0466961_0029514 | Ga0466961_0029514_685_1572 | 286 |
| 45 | 3300044719 | Ga0466971_0014596 | Ga0466971_0014596_2127_3014 | 286 |
| 46 | 3300044765 | Ga0466970_0001142 | Ga0466970_0001142_4446_5333 | 286 |
| 47 | 3300044842 | Ga0466957_0008413 | Ga0466957_0008413_513_1400 | 286 |
| 48 | 3300045049 | Ga0466959_0110958 | Ga0466959_0110958_395_1282 | 286 |
| 49 | 3300045836 | Ga0466958_0000291 | Ga0466958_0000291_7265_8152 | 286 |
| 50 | 3300061719 | Ga0466962_0002330 | Ga0466962_0002330_2789_3676 | 286 |
| 51 | 3300021388 | Ga0213875_10020399 | Ga0213875_100203994 | 287 |
| 52 | 3300037853 | Ga0436364_0089743 | Ga0436364_0089743_11344_12231 | 287 |
| 53 | 3300005327 | Ga0070658_10306175 | Ga0070658_103061752 | 289 |
| 54 | 3300025909 | Ga0207705_10197535 | Ga0207705_101975352 | 289 |
| 55 | iso_pu_bacteria | 2524023205 | 2524442918 | 290 |
| 56 | iso_pu_bacteria | 2744054633 | 2745082621 | 290 |
| 57 | iso_pu_bacteria | 2876761206 | 2876765283 | 290 |
| 58 | 3300053078 | Ga0495612_0041992 | Ga0495612_0041992_521_1411 | 294 |
| 59 | 2162886012 | MBSR1b_contig_8754477 | MBSR1b_0101.00000990 | 295 |
| 60 | 3300001904 | JGI24736J21556_1004038 | JGI24736J21556_10040383 | 295 |
| 61 | 3300001989 | JGI24739J22299_10000097 | JGI24739J22299_1000009717 | 295 |
| 62 | 3300001990 | JGI24737J22298_10000037 | JGI24737J22298_1000003734 | 295 |
| 63 | 3300001990 | JGI24737J22298_10000930 | JGI24737J22298_100009303 | 295 |
| 64 | 3300001990 | JGI24737J22298_10033425 | JGI24737J22298_100334253 | 295 |
| 65 | 3300002067 | JGI24735J21928_10037844 | JGI24735J21928_100378442 | 295 |
| 66 | 3300002075 | JGI24738J21930_10000023 | JGI24738J21930_1000002313 | 295 |
| 67 | 3300005293 | Ga0065715_10095614 | Ga0065715_100956145 | 295 |
| 68 | 3300005327 | Ga0070658_10000377 | Ga0070658_1000037735 | 295 |
| 69 | 3300005327 | Ga0070658_10020877 | Ga0070658_100208775 | 295 |
| 70 | 3300005327 | Ga0070658_10091831 | Ga0070658_100918313 | 295 |
| 71 | 3300005327 | Ga0070658_10109501 | Ga0070658_101095013 | 295 |
| 72 | 3300005327 | Ga0070658_10116380 | Ga0070658_101163802 | 295 |
| 73 | 3300005327 | Ga0070658_10119188 | Ga0070658_101191883 | 295 |
| 74 | 3300005328 | Ga0070676_10104483 | Ga0070676_101044833 | 295 |
| 75 | 3300005329 | Ga0070683_100001819 | Ga0070683_10000181914 | 295 |
| 76 | 3300005329 | Ga0070683_100039504 | Ga0070683_1000395043 | 295 |
| 77 | 3300005329 | Ga0070683_100228118 | Ga0070683_1002281183 | 295 |
| 78 | 3300005331 | Ga0070670_100003109 | Ga0070670_10000310911 | 295 |
| 79 | 3300005331 | Ga0070670_100003400 | Ga0070670_1000034009 | 295 |
| 80 | 3300005331 | Ga0070670_100042597 | Ga0070670_1000425974 | 295 |
| 81 | 3300005331 | Ga0070670_100159246 | Ga0070670_1001592462 | 295 |
| 82 | 3300005331 | Ga0070670_100395907 | Ga0070670_1003959071 | 295 |
| 83 | 3300005333 | Ga0070677_10008918 | Ga0070677_100089184 | 295 |
| 84 | 3300005333 | Ga0070677_10047425 | Ga0070677_100474252 | 295 |
| 85 | 3300005335 | Ga0070666_10000779 | Ga0070666_1000077915 | 295 |
| 86 | 3300005335 | Ga0070666_10005953 | Ga0070666_100059538 | 295 |
| 87 | 3300005335 | Ga0070666_10024629 | Ga0070666_100246292 | 295 |
| 88 | 3300005337 | Ga0070682_100006873 | Ga0070682_1000068734 | 295 |
| 89 | 3300005338 | Ga0068868_100000259 | Ga0068868_1000002597 | 295 |
| 90 | 3300005338 | Ga0068868_100015245 | Ga0068868_1000152457 | 295 |
| 91 | 3300005338 | Ga0068868_100061889 | Ga0068868_1000618892 | 295 |
| 92 | 3300005339 | Ga0070660_100000986 | Ga0070660_1000009864 | 295 |
| 93 | 3300005339 | Ga0070660_100058544 | Ga0070660_1000585443 | 295 |
| 94 | 3300005339 | Ga0070660_100081729 | Ga0070660_1000817292 | 295 |
| 95 | 3300005339 | Ga0070660_100171964 | Ga0070660_1001719642 | 295 |
| 96 | 3300005340 | Ga0070689_100028985 | Ga0070689_1000289852 | 295 |
| 97 | 3300005340 | Ga0070689_100158173 | Ga0070689_1001581733 | 295 |
| 98 | 3300005344 | Ga0070661_100000187 | Ga0070661_10000018735 | 295 |
| 99 | 3300005344 | Ga0070661_100004695 | Ga0070661_10000469512 | 295 |
| 100 | 3300005344 | Ga0070661_100011962 | Ga0070661_1000119627 | 295 |
| 101 | 3300005344 | Ga0070661_100072913 | Ga0070661_1000729133 | 295 |
| 102 | 3300005344 | Ga0070661_100165569 | Ga0070661_1001655693 | 295 |
| 103 | 3300005344 | Ga0070661_100209843 | Ga0070661_1002098432 | 295 |
| 104 | 3300005344 | Ga0070661_100224334 | Ga0070661_1002243342 | 295 |
| 105 | 3300005345 | Ga0070692_10034116 | Ga0070692_100341162 | 295 |
| 106 | 3300005345 | Ga0070692_10057624 | Ga0070692_100576242 | 295 |
| 107 | 3300005347 | Ga0070668_100035371 | Ga0070668_1000353714 | 295 |
| 108 | 3300005353 | Ga0070669_100000174 | Ga0070669_10000017423 | 295 |
| 109 | 3300005353 | Ga0070669_100033518 | Ga0070669_1000335184 | 295 |
| 110 | 3300005353 | Ga0070669_100131253 | Ga0070669_1001312532 | 295 |
| 111 | 3300005353 | Ga0070669_100164872 | Ga0070669_1001648722 | 295 |
| 112 | 3300005354 | Ga0070675_100002370 | Ga0070675_10000237010 | 295 |
| 113 | 3300005354 | Ga0070675_100010543 | Ga0070675_1000105434 | 295 |
| 114 | 3300005354 | Ga0070675_100102492 | Ga0070675_1001024923 | 295 |
| 115 | 3300005355 | Ga0070671_100001282 | Ga0070671_10000128226 | 295 |
| 116 | 3300005355 | Ga0070671_100029886 | Ga0070671_1000298862 | 295 |
| 117 | 3300005355 | Ga0070671_100054381 | Ga0070671_1000543812 | 295 |
| 118 | 3300005355 | Ga0070671_100128547 | Ga0070671_1001285473 | 295 |
| 119 | 3300005356 | Ga0070674_100007200 | Ga0070674_1000072003 | 295 |
| 120 | 3300005356 | Ga0070674_100161329 | Ga0070674_1001613291 | 295 |
| 121 | 3300005356 | Ga0070674_100168299 | Ga0070674_1001682992 | 295 |
| 122 | 3300005364 | Ga0070673_100000337 | Ga0070673_10000033717 | 295 |
| 123 | 3300005364 | Ga0070673_100010120 | Ga0070673_1000101204 | 295 |
| 124 | 3300005364 | Ga0070673_100011732 | Ga0070673_1000117324 | 295 |
| 125 | 3300005364 | Ga0070673_100031597 | Ga0070673_1000315973 | 295 |
| 126 | 3300005366 | Ga0070659_100000191 | Ga0070659_10000019115 | 295 |
| 127 | 3300005366 | Ga0070659_100000674 | Ga0070659_10000067420 | 295 |
| 128 | 3300005366 | Ga0070659_100028122 | Ga0070659_1000281225 | 295 |
| 129 | 3300005366 | Ga0070659_100039493 | Ga0070659_1000394934 | 295 |
| 130 | 3300005366 | Ga0070659_100052281 | Ga0070659_1000522814 | 295 |
| 131 | 3300005366 | Ga0070659_100141643 | Ga0070659_1001416432 | 295 |
| 132 | 3300005366 | Ga0070659_100183630 | Ga0070659_1001836302 | 295 |
| 133 | 3300005366 | Ga0070659_100209052 | Ga0070659_1002090521 | 295 |
| 134 | 3300005366 | Ga0070659_100212634 | Ga0070659_1002126342 | 295 |
| 135 | 3300005367 | Ga0070667_100001311 | Ga0070667_1000013113 | 295 |
| 136 | 3300005367 | Ga0070667_100003559 | Ga0070667_1000035594 | 295 |
| 137 | 3300005367 | Ga0070667_100011671 | Ga0070667_1000116718 | 295 |
| 138 | 3300005367 | Ga0070667_100263107 | Ga0070667_1002631072 | 295 |
| 139 | 3300005367 | Ga0070667_100300977 | Ga0070667_1003009772 | 295 |
| 140 | 3300005435 | Ga0070714_100055739 | Ga0070714_1000557393 | 295 |
| 141 | 3300005435 | Ga0070714_100065718 | Ga0070714_1000657184 | 295 |
| 142 | 3300005455 | Ga0070663_100000754 | Ga0070663_1000007541 | 295 |
| 143 | 3300005455 | Ga0070663_100029193 | Ga0070663_1000291932 | 295 |
| 144 | 3300005455 | Ga0070663_100077044 | Ga0070663_1000770442 | 295 |
| 145 | 3300005455 | Ga0070663_100108487 | Ga0070663_1001084873 | 295 |
| 146 | 3300005455 | Ga0070663_100110707 | Ga0070663_1001107072 | 295 |
| 147 | 3300005455 | Ga0070663_100128264 | Ga0070663_1001282642 | 295 |
| 148 | 3300005457 | Ga0070662_100000012 | Ga0070662_10000001238 | 295 |
| 149 | 3300005457 | Ga0070662_100001658 | Ga0070662_1000016584 | 295 |
| 150 | 3300005457 | Ga0070662_100004211 | Ga0070662_10000421117 | 295 |
| 151 | 3300005457 | Ga0070662_100005641 | Ga0070662_1000056412 | 295 |
| 152 | 3300005457 | Ga0070662_100007787 | Ga0070662_1000077878 | 295 |
| 153 | 3300005457 | Ga0070662_100122185 | Ga0070662_1001221851 | 295 |
| 154 | 3300005459 | Ga0068867_100006572 | Ga0068867_1000065725 | 295 |
| 155 | 3300005459 | Ga0068867_100008577 | Ga0068867_1000085771 | 295 |
| 156 | 3300005459 | Ga0068867_100214457 | Ga0068867_1002144572 | 295 |
| 157 | 3300005466 | Ga0070685_10068101 | Ga0070685_100681013 | 295 |
| 158 | 3300005530 | Ga0070679_100162601 | Ga0070679_1001626012 | 295 |
| 159 | 3300005530 | Ga0070679_100522698 | Ga0070679_1005226981 | 295 |
| 160 | 3300005535 | Ga0070684_100003278 | Ga0070684_10000327813 | 295 |
| 161 | 3300005535 | Ga0070684_100009174 | Ga0070684_1000091746 | 295 |
| 162 | 3300005535 | Ga0070684_100107569 | Ga0070684_1001075693 | 295 |
| 163 | 3300005539 | Ga0068853_100000032 | Ga0068853_10000003287 | 295 |
| 164 | 3300005539 | Ga0068853_100000811 | Ga0068853_10000081127 | 295 |
| 165 | 3300005539 | Ga0068853_100311023 | Ga0068853_1003110231 | 295 |
| 166 | 3300005543 | Ga0070672_100000945 | Ga0070672_10000094516 | 295 |
| 167 | 3300005543 | Ga0070672_100004830 | Ga0070672_1000048304 | 295 |
| 168 | 3300005544 | Ga0070686_100032521 | Ga0070686_1000325213 | 295 |
| 169 | 3300005547 | Ga0070693_100000332 | Ga0070693_10000033210 | 295 |
| 170 | 3300005548 | Ga0070665_100021059 | Ga0070665_1000210599 | 295 |
| 171 | 3300005548 | Ga0070665_100031747 | Ga0070665_1000317477 | 295 |
| 172 | 3300005548 | Ga0070665_100104758 | Ga0070665_1001047582 | 295 |
| 173 | 3300005563 | Ga0068855_100000591 | Ga0068855_10000059111 | 295 |
| 174 | 3300005563 | Ga0068855_100003900 | Ga0068855_10000390025 | 295 |
| 175 | 3300005564 | Ga0070664_100000187 | Ga0070664_10000018726 | 295 |
| 176 | 3300005564 | Ga0070664_100001469 | Ga0070664_10000146922 | 295 |
| 177 | 3300005564 | Ga0070664_100012642 | Ga0070664_1000126426 | 295 |
| 178 | 3300005564 | Ga0070664_100039187 | Ga0070664_1000391872 | 295 |
| 179 | 3300005564 | Ga0070664_100159072 | Ga0070664_1001590723 | 295 |
| 180 | 3300005564 | Ga0070664_100321093 | Ga0070664_1003210932 | 295 |
| 181 | 3300005577 | Ga0068857_100004021 | Ga0068857_1000040214 | 295 |
| 182 | 3300005577 | Ga0068857_100034073 | Ga0068857_1000340736 | 295 |
| 183 | 3300005577 | Ga0068857_100078693 | Ga0068857_1000786933 | 295 |
| 184 | 3300005578 | Ga0068854_100000664 | Ga0068854_1000006643 | 295 |
| 185 | 3300005578 | Ga0068854_100025831 | Ga0068854_1000258313 | 295 |
| 186 | 3300005578 | Ga0068854_100491376 | Ga0068854_1004913761 | 295 |
| 187 | 3300005614 | Ga0068856_100000291 | Ga0068856_10000029135 | 295 |
| 188 | 3300005614 | Ga0068856_100013426 | Ga0068856_1000134267 | 295 |
| 189 | 3300005614 | Ga0068856_100100639 | Ga0068856_1001006393 | 295 |
| 190 | 3300005614 | Ga0068856_100124219 | Ga0068856_1001242192 | 295 |
| 191 | 3300005614 | Ga0068856_100156559 | Ga0068856_1001565592 | 295 |
| 192 | 3300005616 | Ga0068852_100000906 | Ga0068852_10000090611 | 295 |
| 193 | 3300005616 | Ga0068852_100102337 | Ga0068852_1001023373 | 295 |
| 194 | 3300005616 | Ga0068852_100104429 | Ga0068852_1001044293 | 295 |
| 195 | 3300005616 | Ga0068852_100141397 | Ga0068852_1001413972 | 295 |
| 196 | 3300005616 | Ga0068852_100325452 | Ga0068852_1003254522 | 295 |
| 197 | 3300005617 | Ga0068859_100002786 | Ga0068859_10000278614 | 295 |
| 198 | 3300005618 | Ga0068864_100002633 | Ga0068864_10000263320 | 295 |
| 199 | 3300005618 | Ga0068864_100224571 | Ga0068864_1002245712 | 295 |
| 200 | 3300005718 | Ga0068866_10098458 | Ga0068866_100984582 | 295 |
| 201 | 3300005719 | Ga0068861_100027898 | Ga0068861_1000278984 | 295 |
| 202 | 3300005719 | Ga0068861_100264410 | Ga0068861_1002644103 | 295 |
| 203 | 3300005834 | Ga0068851_10022469 | Ga0068851_100224693 | 295 |
| 204 | 3300005834 | Ga0068851_10042459 | Ga0068851_100424592 | 295 |
| 205 | 3300005841 | Ga0068863_100002317 | Ga0068863_10000231715 | 295 |
| 206 | 3300005842 | Ga0068858_100000620 | Ga0068858_10000062018 | 295 |
| 207 | 3300005842 | Ga0068858_100009881 | Ga0068858_1000098819 | 295 |
| 208 | 3300005843 | Ga0068860_100003524 | Ga0068860_1000035248 | 295 |
| 209 | 3300006931 | Ga0097620_100002786 | Ga0097620_10000278614 | 295 |
| 210 | 3300009093 | Ga0105240_10048201 | Ga0105240_100482012 | 295 |
| 211 | 3300009093 | Ga0105240_10152373 | Ga0105240_101523733 | 295 |
| 212 | 3300009093 | Ga0105240_10221098 | Ga0105240_102210982 | 295 |
| 213 | 3300009093 | Ga0105240_10481935 | Ga0105240_104819352 | 295 |
| 214 | 3300009098 | Ga0105245_10000229 | Ga0105245_1000022927 | 295 |
| 215 | 3300009098 | Ga0105245_10023282 | Ga0105245_100232827 | 295 |
| 216 | 3300009098 | Ga0105245_10198795 | Ga0105245_101987953 | 295 |
| 217 | 3300009101 | Ga0105247_10237929 | Ga0105247_102379292 | 295 |
| 218 | 3300009148 | Ga0105243_10030827 | Ga0105243_100308273 | 295 |
| 219 | 3300009174 | Ga0105241_10109553 | Ga0105241_101095533 | 295 |
| 220 | 3300009174 | Ga0105241_10236893 | Ga0105241_102368933 | 295 |
| 221 | 3300009177 | Ga0105248_10000083 | Ga0105248_1000008382 | 295 |
| 222 | 3300009177 | Ga0105248_10000790 | Ga0105248_1000079013 | 295 |
| 223 | 3300009177 | Ga0105248_10001634 | Ga0105248_100016343 | 295 |
| 224 | 3300009177 | Ga0105248_10003127 | Ga0105248_1000312712 | 295 |
| 225 | 3300009177 | Ga0105248_10011959 | Ga0105248_1001195914 | 295 |
| 226 | 3300009177 | Ga0105248_10023944 | Ga0105248_100239442 | 295 |
| 227 | 3300009551 | Ga0105238_10024793 | Ga0105238_100247937 | 295 |
| 228 | 3300010375 | Ga0105239_10221754 | Ga0105239_102217542 | 295 |
| 229 | 3300011119 | Ga0105246_10006237 | Ga0105246_100062372 | 295 |
| 230 | 3300013100 | Ga0157373_10071086 | Ga0157373_100710864 | 295 |
| 231 | 3300013100 | Ga0157373_10087945 | Ga0157373_100879453 | 295 |
| 232 | 3300013100 | Ga0157373_10089370 | Ga0157373_100893702 | 295 |
| 233 | 3300013100 | Ga0157373_10100314 | Ga0157373_101003142 | 295 |
| 234 | 3300013100 | Ga0157373_10169372 | Ga0157373_101693722 | 295 |
| 235 | 3300013102 | Ga0157371_10000756 | Ga0157371_1000075633 | 295 |
| 236 | 3300013102 | Ga0157371_10009514 | Ga0157371_100095142 | 295 |
| 237 | 3300013102 | Ga0157371_10024460 | Ga0157371_100244605 | 295 |
| 238 | 3300013102 | Ga0157371_10070421 | Ga0157371_100704212 | 295 |
| 239 | 3300013102 | Ga0157371_10347565 | Ga0157371_103475652 | 295 |
| 240 | 3300013104 | Ga0157370_10150712 | Ga0157370_101507123 | 295 |
| 241 | 3300013105 | Ga0157369_10000137 | Ga0157369_1000013798 | 295 |
| 242 | 3300013105 | Ga0157369_10007204 | Ga0157369_1000720412 | 295 |
| 243 | 3300013105 | Ga0157369_10019245 | Ga0157369_100192453 | 295 |
| 244 | 3300013105 | Ga0157369_10042284 | Ga0157369_100422841 | 295 |
| 245 | 3300013105 | Ga0157369_10049779 | Ga0157369_100497794 | 295 |
| 246 | 3300013105 | Ga0157369_10084813 | Ga0157369_100848132 | 295 |
| 247 | 3300013105 | Ga0157369_10224048 | Ga0157369_102240483 | 295 |
| 248 | 3300013296 | Ga0157374_10090171 | Ga0157374_100901713 | 295 |
| 249 | 3300013296 | Ga0157374_10219149 | Ga0157374_102191493 | 295 |
| 250 | 3300013296 | Ga0157374_10505694 | Ga0157374_105056941 | 295 |
| 251 | 3300013297 | Ga0157378_10000154 | Ga0157378_1000015438 | 295 |
| 252 | 3300013297 | Ga0157378_10191875 | Ga0157378_101918753 | 295 |
| 253 | 3300013307 | Ga0157372_10379691 | Ga0157372_103796912 | 295 |
| 254 | 3300013307 | Ga0157372_10454013 | Ga0157372_104540132 | 295 |
| 255 | 3300013308 | Ga0157375_10200197 | Ga0157375_102001973 | 295 |
| 256 | 3300013308 | Ga0157375_10403985 | Ga0157375_104039852 | 295 |
| 257 | 3300014325 | Ga0163163_10001064 | Ga0163163_100010648 | 295 |
| 258 | 3300014497 | Ga0182008_10222246 | Ga0182008_102222461 | 295 |
| 259 | 3300020082 | Ga0206353_11586731 | Ga0206353_115867311 | 295 |
| 260 | 3300025290 | Ga0207673_1007899 | Ga0207673_10078992 | 295 |
| 261 | 3300025315 | Ga0207697_10000187 | Ga0207697_1000018733 | 295 |
| 262 | 3300025321 | Ga0207656_10001253 | Ga0207656_100012535 | 295 |
| 263 | 3300025321 | Ga0207656_10054507 | Ga0207656_100545072 | 295 |
| 264 | 3300025893 | Ga0207682_10059230 | Ga0207682_100592302 | 295 |
| 265 | 3300025901 | Ga0207688_10000595 | Ga0207688_1000059527 | 295 |
| 266 | 3300025903 | Ga0207680_10002585 | Ga0207680_100025858 | 295 |
| 267 | 3300025903 | Ga0207680_10134016 | Ga0207680_101340162 | 295 |
| 268 | 3300025904 | Ga0207647_10000090 | Ga0207647_1000009027 | 295 |
| 269 | 3300025904 | Ga0207647_10012986 | Ga0207647_100129862 | 295 |
| 270 | 3300025904 | Ga0207647_10028131 | Ga0207647_100281313 | 295 |
| 271 | 3300025904 | Ga0207647_10047898 | Ga0207647_100478983 | 295 |
| 272 | 3300025907 | Ga0207645_10012721 | Ga0207645_100127214 | 295 |
| 273 | 3300025907 | Ga0207645_10031056 | Ga0207645_100310563 | 295 |
| 274 | 3300025907 | Ga0207645_10096039 | Ga0207645_100960392 | 295 |
| 275 | 3300025909 | Ga0207705_10000030 | Ga0207705_10000030210 | 295 |
| 276 | 3300025909 | Ga0207705_10000072 | Ga0207705_1000007287 | 295 |
| 277 | 3300025909 | Ga0207705_10010411 | Ga0207705_100104114 | 295 |
| 278 | 3300025909 | Ga0207705_10011473 | Ga0207705_100114733 | 295 |
| 279 | 3300025909 | Ga0207705_10023019 | Ga0207705_100230192 | 295 |
| 280 | 3300025909 | Ga0207705_10031771 | Ga0207705_100317713 | 295 |
| 281 | 3300025909 | Ga0207705_10095609 | Ga0207705_100956093 | 295 |
| 282 | 3300025909 | Ga0207705_10175862 | Ga0207705_101758622 | 295 |
| 283 | 3300025913 | Ga0207695_10014730 | Ga0207695_100147307 | 295 |
| 284 | 3300025913 | Ga0207695_10036058 | Ga0207695_100360586 | 295 |
| 285 | 3300025913 | Ga0207695_10157091 | Ga0207695_101570911 | 295 |
| 286 | 3300025919 | Ga0207657_10000176 | Ga0207657_1000017638 | 295 |
| 287 | 3300025919 | Ga0207657_10002682 | Ga0207657_100026824 | 295 |
| 288 | 3300025919 | Ga0207657_10007866 | Ga0207657_100078667 | 295 |
| 289 | 3300025919 | Ga0207657_10014374 | Ga0207657_100143745 | 295 |
| 290 | 3300025919 | Ga0207657_10014766 | Ga0207657_100147663 | 295 |
| 291 | 3300025919 | Ga0207657_10018127 | Ga0207657_100181273 | 295 |
| 292 | 3300025919 | Ga0207657_10020297 | Ga0207657_100202976 | 295 |
| 293 | 3300025919 | Ga0207657_10140627 | Ga0207657_101406273 | 295 |
| 294 | 3300025920 | Ga0207649_10000810 | Ga0207649_1000081017 | 295 |
| 295 | 3300025920 | Ga0207649_10004374 | Ga0207649_100043745 | 295 |
| 296 | 3300025920 | Ga0207649_10006147 | Ga0207649_100061477 | 295 |
| 297 | 3300025920 | Ga0207649_10016042 | Ga0207649_100160424 | 295 |
| 298 | 3300025920 | Ga0207649_10046477 | Ga0207649_100464773 | 295 |
| 299 | 3300025920 | Ga0207649_10068215 | Ga0207649_100682153 | 295 |
| 300 | 3300025920 | Ga0207649_10075884 | Ga0207649_100758842 | 295 |
| 301 | 3300025920 | Ga0207649_10083466 | Ga0207649_100834663 | 295 |
| 302 | 3300025921 | Ga0207652_10003111 | Ga0207652_100031116 | 295 |
| 303 | 3300025923 | Ga0207681_10005702 | Ga0207681_100057028 | 295 |
| 304 | 3300025923 | Ga0207681_10146085 | Ga0207681_101460852 | 295 |
| 305 | 3300025923 | Ga0207681_10167103 | Ga0207681_101671032 | 295 |
| 306 | 3300025924 | Ga0207694_10036262 | Ga0207694_100362624 | 295 |
| 307 | 3300025925 | Ga0207650_10005079 | Ga0207650_100050799 | 295 |
| 308 | 3300025925 | Ga0207650_10016751 | Ga0207650_100167513 | 295 |
| 309 | 3300025925 | Ga0207650_10034652 | Ga0207650_100346524 | 295 |
| 310 | 3300025925 | Ga0207650_10251182 | Ga0207650_102511822 | 295 |
| 311 | 3300025926 | Ga0207659_10007264 | Ga0207659_100072644 | 295 |
| 312 | 3300025926 | Ga0207659_10012137 | Ga0207659_100121374 | 295 |
| 313 | 3300025926 | Ga0207659_10138795 | Ga0207659_101387952 | 295 |
| 314 | 3300025927 | Ga0207687_10001063 | Ga0207687_1000106310 | 295 |
| 315 | 3300025927 | Ga0207687_10012657 | Ga0207687_100126577 | 295 |
| 316 | 3300025929 | Ga0207664_10079535 | Ga0207664_100795353 | 295 |
| 317 | 3300025929 | Ga0207664_10184904 | Ga0207664_101849043 | 295 |
| 318 | 3300025931 | Ga0207644_10005196 | Ga0207644_100051964 | 295 |
| 319 | 3300025931 | Ga0207644_10015754 | Ga0207644_100157544 | 295 |
| 320 | 3300025931 | Ga0207644_10018835 | Ga0207644_100188354 | 295 |
| 321 | 3300025931 | Ga0207644_10105072 | Ga0207644_101050722 | 295 |
| 322 | 3300025931 | Ga0207644_10106168 | Ga0207644_101061683 | 295 |
| 323 | 3300025931 | Ga0207644_10125658 | Ga0207644_101256582 | 295 |
| 324 | 3300025931 | Ga0207644_10141283 | Ga0207644_101412831 | 295 |
| 325 | 3300025932 | Ga0207690_10000245 | Ga0207690_1000024519 | 295 |
| 326 | 3300025932 | Ga0207690_10005573 | Ga0207690_100055735 | 295 |
| 327 | 3300025932 | Ga0207690_10014951 | Ga0207690_100149515 | 295 |
| 328 | 3300025932 | Ga0207690_10055336 | Ga0207690_100553363 | 295 |
| 329 | 3300025932 | Ga0207690_10109546 | Ga0207690_101095463 | 295 |
| 330 | 3300025932 | Ga0207690_10133771 | Ga0207690_101337712 | 295 |
| 331 | 3300025932 | Ga0207690_10189570 | Ga0207690_101895702 | 295 |
| 332 | 3300025932 | Ga0207690_10198959 | Ga0207690_101989592 | 295 |
| 333 | 3300025932 | Ga0207690_10439908 | Ga0207690_104399081 | 295 |
| 334 | 3300025933 | Ga0207706_10000041 | Ga0207706_1000004188 | 295 |
| 335 | 3300025933 | Ga0207706_10001429 | Ga0207706_1000142927 | 295 |
| 336 | 3300025933 | Ga0207706_10003596 | Ga0207706_1000359611 | 295 |
| 337 | 3300025933 | Ga0207706_10011213 | Ga0207706_1001121315 | 295 |
| 338 | 3300025933 | Ga0207706_10011368 | Ga0207706_1001136813 | 295 |
| 339 | 3300025933 | Ga0207706_10059459 | Ga0207706_100594595 | 295 |
| 340 | 3300025933 | Ga0207706_10082581 | Ga0207706_100825814 | 295 |
| 341 | 3300025933 | Ga0207706_10321123 | Ga0207706_103211232 | 295 |
| 342 | 3300025937 | Ga0207669_10022495 | Ga0207669_100224953 | 295 |
| 343 | 3300025937 | Ga0207669_10097778 | Ga0207669_100977783 | 295 |
| 344 | 3300025937 | Ga0207669_10179077 | Ga0207669_101790772 | 295 |
| 345 | 3300025940 | Ga0207691_10000045 | Ga0207691_1000004597 | 295 |
| 346 | 3300025940 | Ga0207691_10005139 | Ga0207691_1000513919 | 295 |
| 347 | 3300025940 | Ga0207691_10128425 | Ga0207691_101284252 | 295 |
| 348 | 3300025941 | Ga0207711_10001311 | Ga0207711_100013114 | 295 |
| 349 | 3300025941 | Ga0207711_10001677 | Ga0207711_1000167712 | 295 |
| 350 | 3300025941 | Ga0207711_10002858 | Ga0207711_100028587 | 295 |
| 351 | 3300025941 | Ga0207711_10003863 | Ga0207711_100038637 | 295 |
| 352 | 3300025941 | Ga0207711_10009533 | Ga0207711_100095334 | 295 |
| 353 | 3300025942 | Ga0207689_10000226 | Ga0207689_1000022627 | 295 |
| 354 | 3300025944 | Ga0207661_10000953 | Ga0207661_1000095314 | 295 |
| 355 | 3300025944 | Ga0207661_10005783 | Ga0207661_100057836 | 295 |
| 356 | 3300025944 | Ga0207661_10043965 | Ga0207661_100439654 | 295 |
| 357 | 3300025944 | Ga0207661_10084033 | Ga0207661_100840333 | 295 |
| 358 | 3300025945 | Ga0207679_10000243 | Ga0207679_1000024330 | 295 |
| 359 | 3300025945 | Ga0207679_10008060 | Ga0207679_100080606 | 295 |
| 360 | 3300025945 | Ga0207679_10112309 | Ga0207679_101123093 | 295 |
| 361 | 3300025949 | Ga0207667_10006092 | Ga0207667_1000609211 | 295 |
| 362 | 3300025949 | Ga0207667_10063634 | Ga0207667_100636344 | 295 |
| 363 | 3300025949 | Ga0207667_10201249 | Ga0207667_102012493 | 295 |
| 364 | 3300025949 | Ga0207667_10228513 | Ga0207667_102285132 | 295 |
| 365 | 3300025960 | Ga0207651_10000494 | Ga0207651_1000049416 | 295 |
| 366 | 3300025960 | Ga0207651_10013969 | Ga0207651_100139694 | 295 |
| 367 | 3300025960 | Ga0207651_10034105 | Ga0207651_100341053 | 295 |
| 368 | 3300025960 | Ga0207651_10076825 | Ga0207651_100768253 | 295 |
| 369 | 3300025972 | Ga0207668_10027591 | Ga0207668_100275913 | 295 |
| 370 | 3300025972 | Ga0207668_10060121 | Ga0207668_100601214 | 295 |
| 371 | 3300025972 | Ga0207668_10315338 | Ga0207668_103153382 | 295 |
| 372 | 3300025981 | Ga0207640_10004637 | Ga0207640_100046378 | 295 |
| 373 | 3300025981 | Ga0207640_10124709 | Ga0207640_101247093 | 295 |
| 374 | 3300025986 | Ga0207658_10004807 | Ga0207658_100048074 | 295 |
| 375 | 3300025986 | Ga0207658_10008814 | Ga0207658_100088142 | 295 |
| 376 | 3300025986 | Ga0207658_10174315 | Ga0207658_101743153 | 295 |
| 377 | 3300025986 | Ga0207658_10353257 | Ga0207658_103532572 | 295 |
| 378 | 3300025986 | Ga0207658_10462448 | Ga0207658_104624482 | 295 |
| 379 | 3300026023 | Ga0207677_10003117 | Ga0207677_100031177 | 295 |
| 380 | 3300026023 | Ga0207677_10018354 | Ga0207677_100183544 | 295 |
| 381 | 3300026023 | Ga0207677_10143483 | Ga0207677_101434832 | 295 |
| 382 | 3300026023 | Ga0207677_10190567 | Ga0207677_101905673 | 295 |
| 383 | 3300026035 | Ga0207703_10002105 | Ga0207703_1000210513 | 295 |
| 384 | 3300026035 | Ga0207703_10002663 | Ga0207703_100026633 | 295 |
| 385 | 3300026041 | Ga0207639_10000222 | Ga0207639_100002228 | 295 |
| 386 | 3300026041 | Ga0207639_10006140 | Ga0207639_1000614010 | 295 |
| 387 | 3300026041 | Ga0207639_10033533 | Ga0207639_100335334 | 295 |
| 388 | 3300026067 | Ga0207678_10004584 | Ga0207678_100045844 | 295 |
| 389 | 3300026067 | Ga0207678_10004795 | Ga0207678_100047959 | 295 |
| 390 | 3300026067 | Ga0207678_10009690 | Ga0207678_100096908 | 295 |
| 391 | 3300026067 | Ga0207678_10021513 | Ga0207678_100215136 | 295 |
| 392 | 3300026067 | Ga0207678_10039637 | Ga0207678_100396373 | 295 |
| 393 | 3300026067 | Ga0207678_10056947 | Ga0207678_100569472 | 295 |
| 394 | 3300026067 | Ga0207678_10087759 | Ga0207678_100877593 | 295 |
| 395 | 3300026067 | Ga0207678_10100749 | Ga0207678_101007493 | 295 |
| 396 | 3300026067 | Ga0207678_10181336 | Ga0207678_101813362 | 295 |
| 397 | 3300026078 | Ga0207702_10000074 | Ga0207702_1000007424 | 295 |
| 398 | 3300026078 | Ga0207702_10044382 | Ga0207702_100443824 | 295 |
| 399 | 3300026078 | Ga0207702_10245637 | Ga0207702_102456372 | 295 |
| 400 | 3300026078 | Ga0207702_10467518 | Ga0207702_104675182 | 295 |
| 401 | 3300026078 | Ga0207702_10543802 | Ga0207702_105438022 | 295 |
| 402 | 3300026088 | Ga0207641_10024907 | Ga0207641_100249073 | 295 |
| 403 | 3300026089 | Ga0207648_10002102 | Ga0207648_100021026 | 295 |
| 404 | 3300026089 | Ga0207648_10008748 | Ga0207648_100087488 | 295 |
| 405 | 3300026089 | Ga0207648_10222877 | Ga0207648_102228772 | 295 |
| 406 | 3300026095 | Ga0207676_10001193 | Ga0207676_100011938 | 295 |
| 407 | 3300026095 | Ga0207676_10005397 | Ga0207676_100053974 | 295 |
| 408 | 3300026095 | Ga0207676_10007462 | Ga0207676_100074624 | 295 |
| 409 | 3300026095 | Ga0207676_10030129 | Ga0207676_100301294 | 295 |
| 410 | 3300026116 | Ga0207674_10000531 | Ga0207674_1000053118 | 295 |
| 411 | 3300026116 | Ga0207674_10030221 | Ga0207674_100302213 | 295 |
| 412 | 3300026116 | Ga0207674_10125058 | Ga0207674_101250582 | 295 |
| 413 | 3300026116 | Ga0207674_10127106 | Ga0207674_101271062 | 295 |
| 414 | 3300026118 | Ga0207675_100044742 | Ga0207675_1000447424 | 295 |
| 415 | 3300026118 | Ga0207675_100075063 | Ga0207675_1000750634 | 295 |
| 416 | 3300026142 | Ga0207698_10000892 | Ga0207698_1000089213 | 295 |
| 417 | 3300026142 | Ga0207698_10031124 | Ga0207698_100311242 | 295 |
| 418 | 3300026142 | Ga0207698_10089400 | Ga0207698_100894003 | 295 |
| 419 | 3300026142 | Ga0207698_10412655 | Ga0207698_104126552 | 295 |
| 420 | 3300028379 | Ga0268266_10049829 | Ga0268266_100498292 | 295 |
| 421 | 3300028379 | Ga0268266_10055274 | Ga0268266_100552744 | 295 |
| 422 | 3300028380 | Ga0268265_10501880 | Ga0268265_105018802 | 295 |
| 423 | 3300028381 | Ga0268264_10147803 | Ga0268264_101478033 | 295 |
| 424 | 3300031548 | Ga0307408_100047429 | Ga0307408_1000474293 | 295 |
| 425 | 3300031548 | Ga0307408_100077095 | Ga0307408_1000770953 | 295 |
| 426 | 3300031548 | Ga0307408_100365071 | Ga0307408_1003650711 | 295 |
| 427 | 3300031731 | Ga0307405_10017948 | Ga0307405_100179482 | 295 |
| 428 | 3300031731 | Ga0307405_10026183 | Ga0307405_100261834 | 295 |
| 429 | 3300031731 | Ga0307405_10100468 | Ga0307405_101004682 | 295 |
| 430 | 3300031731 | Ga0307405_10103982 | Ga0307405_101039822 | 295 |
| 431 | 3300031731 | Ga0307405_10118105 | Ga0307405_101181052 | 295 |
| 432 | 3300031824 | Ga0307413_10003433 | Ga0307413_100034332 | 295 |
| 433 | 3300031824 | Ga0307413_10004014 | Ga0307413_100040144 | 295 |
| 434 | 3300031824 | Ga0307413_10099590 | Ga0307413_100995902 | 295 |
| 435 | 3300031852 | Ga0307410_10005046 | Ga0307410_100050467 | 295 |
| 436 | 3300031852 | Ga0307410_10067429 | Ga0307410_100674292 | 295 |
| 437 | 3300031901 | Ga0307406_10028024 | Ga0307406_100280241 | 295 |
| 438 | 3300031901 | Ga0307406_10077785 | Ga0307406_100777853 | 295 |
| 439 | 3300031901 | Ga0307406_10079032 | Ga0307406_100790322 | 295 |
| 440 | 3300031901 | Ga0307406_10170289 | Ga0307406_101702892 | 295 |
| 441 | 3300031903 | Ga0307407_10039617 | Ga0307407_100396172 | 295 |
| 442 | 3300031903 | Ga0307407_10060018 | Ga0307407_100600183 | 295 |
| 443 | 3300031903 | Ga0307407_10130786 | Ga0307407_101307862 | 295 |
| 444 | 3300031911 | Ga0307412_10011180 | Ga0307412_100111803 | 295 |
| 445 | 3300031911 | Ga0307412_10020171 | Ga0307412_100201714 | 295 |
| 446 | 3300031911 | Ga0307412_10120115 | Ga0307412_101201153 | 295 |
| 447 | 3300031911 | Ga0307412_10205605 | Ga0307412_102056052 | 295 |
| 448 | 3300031995 | Ga0307409_100071473 | Ga0307409_1000714734 | 295 |
| 449 | 3300031995 | Ga0307409_100129968 | Ga0307409_1001299682 | 295 |
| 450 | 3300031995 | Ga0307409_100181339 | Ga0307409_1001813391 | 295 |
| 451 | 3300031995 | Ga0307409_100287227 | Ga0307409_1002872273 | 295 |
| 452 | 3300031995 | Ga0307409_100289801 | Ga0307409_1002898012 | 295 |
| 453 | 3300031995 | Ga0307409_100436012 | Ga0307409_1004360122 | 295 |
| 454 | 3300032002 | Ga0307416_100014929 | Ga0307416_1000149293 | 295 |
| 455 | 3300032002 | Ga0307416_100169776 | Ga0307416_1001697763 | 295 |
| 456 | 3300032002 | Ga0307416_100546920 | Ga0307416_1005469202 | 295 |
| 457 | 3300032004 | Ga0307414_10020483 | Ga0307414_100204832 | 295 |
| 458 | 3300032004 | Ga0307414_10037658 | Ga0307414_100376583 | 295 |
| 459 | 3300032004 | Ga0307414_10069861 | Ga0307414_100698614 | 295 |
| 460 | 3300032004 | Ga0307414_10099666 | Ga0307414_100996662 | 295 |
| 461 | 3300032004 | Ga0307414_10243286 | Ga0307414_102432862 | 295 |
| 462 | 3300032005 | Ga0307411_10016425 | Ga0307411_100164255 | 295 |
| 463 | 3300032005 | Ga0307411_10018606 | Ga0307411_100186065 | 295 |
| 464 | 3300032126 | Ga0307415_100039909 | Ga0307415_1000399093 | 295 |
| 465 | 3300032126 | Ga0307415_100197213 | Ga0307415_1001972132 | 295 |
| 466 | 3300035170 | Ga0373943_0029916 | Ga0373943_0029916_85_972 | 295 |
| 467 | 3300035172 | Ga0373955_0247488 | Ga0373955_0247488_159_1046 | 295 |
| 468 | 3300035691 | Ga0373931_0052464 | Ga0373931_0052464_992_1879 | 295 |
| 469 | 3300035692 | Ga0373935_0252100 | Ga0373935_0252100_333_1220 | 295 |
| 470 | 3300035724 | Ga0373933_0031583 | Ga0373933_0031583_716_1603 | 295 |
| 471 | 3300037068 | Ga0373925_0044348 | Ga0373925_0044348_19_906 | 295 |
| 472 | 3300037312 | Ga0395899_0000302 | Ga0395899_0000302_27492_28379 | 295 |
| 473 | 3300037312 | Ga0395899_0017613 | Ga0395899_0017613_93_980 | 295 |
| 474 | 3300037312 | Ga0395899_0019434 | Ga0395899_0019434_2902_3789 | 295 |
| 475 | 3300037312 | Ga0395899_0032366 | Ga0395899_0032366_2809_3696 | 295 |
| 476 | 3300037312 | Ga0395899_0044714 | Ga0395899_0044714_1834_2721 | 295 |
| 477 | 3300037312 | Ga0395899_0046829 | Ga0395899_0046829_1243_2130 | 295 |
| 478 | 3300037312 | Ga0395899_0053011 | Ga0395899_0053011_447_1334 | 295 |
| 479 | 3300037312 | Ga0395899_0090094 | Ga0395899_0090094_307_1194 | 295 |
| 480 | 3300037312 | Ga0395899_0122093 | Ga0395899_0122093_217_1104 | 295 |
| 481 | 3300037312 | Ga0395899_0123975 | Ga0395899_0123975_837_1724 | 295 |
| 482 | 3300037312 | Ga0395899_0193215 | Ga0395899_0193215_136_1023 | 295 |
| 483 | 3300037312 | Ga0395899_0233293 | Ga0395899_0233293_132_1019 | 295 |
| 484 | 3300037418 | Ga0395900_0000997 | Ga0395900_0000997_21512_22399 | 295 |
| 485 | 3300037418 | Ga0395900_0002684 | Ga0395900_0002684_15238_16125 | 295 |
| 486 | 3300037418 | Ga0395900_0007283 | Ga0395900_0007283_1671_2558 | 295 |
| 487 | 3300037418 | Ga0395900_0009267 | Ga0395900_0009267_7308_8195 | 295 |
| 488 | 3300037418 | Ga0395900_0017664 | Ga0395900_0017664_3067_3954 | 295 |
| 489 | 3300037418 | Ga0395900_0023580 | Ga0395900_0023580_4461_5348 | 295 |
| 490 | 3300037418 | Ga0395900_0027388 | Ga0395900_0027388_4141_5028 | 295 |
| 491 | 3300037418 | Ga0395900_0166059 | Ga0395900_0166059_752_1639 | 295 |
| 492 | 3300037418 | Ga0395900_0237224 | Ga0395900_0237224_890_1777 | 295 |
| 493 | 3300037418 | Ga0395900_0275376 | Ga0395900_0275376_89_976 | 295 |
| 494 | 3300037418 | Ga0395900_0383731 | Ga0395900_0383731_139_1026 | 295 |
| 495 | 3300037418 | Ga0395900_0427317 | Ga0395900_0427317_204_1091 | 295 |
| 496 | 3300037418 | Ga0395900_0594746 | Ga0395900_0594746_106_993 | 295 |
| 497 | 3300037466 | Ga0395898_0000054 | Ga0395898_0000054_74826_75713 | 295 |
| 498 | 3300037466 | Ga0395898_0014768 | Ga0395898_0014768_314_1201 | 295 |
| 499 | 3300037466 | Ga0395898_0051732 | Ga0395898_0051732_1037_1924 | 295 |
| 500 | 3300037466 | Ga0395898_0053971 | Ga0395898_0053971_2190_3077 | 295 |
| 501 | 3300037466 | Ga0395898_0054496 | Ga0395898_0054496_1960_2847 | 295 |
| 502 | 3300037466 | Ga0395898_0085987 | Ga0395898_0085987_229_1116 | 295 |
| 503 | 3300037466 | Ga0395898_0193645 | Ga0395898_0193645_327_1214 | 295 |
| 504 | 3300037471 | Ga0395905_0000046 | Ga0395905_0000046_35832_36719 | 295 |
| 505 | 3300037471 | Ga0395905_0001164 | Ga0395905_0001164_14357_15244 | 295 |
| 506 | 3300037471 | Ga0395905_0043817 | Ga0395905_0043817_1083_1970 | 295 |
| 507 | 3300037471 | Ga0395905_0047368 | Ga0395905_0047368_1426_2313 | 295 |
| 508 | 3300037471 | Ga0395905_0084641 | Ga0395905_0084641_847_1734 | 295 |
| 509 | 3300037471 | Ga0395905_0129196 | Ga0395905_0129196_941_1828 | 295 |
| 510 | 3300037471 | Ga0395905_0373048 | Ga0395905_0373048_349_1236 | 295 |
| 511 | 3300038443 | Ga0395901_0000086 | Ga0395901_0000086_8628_9515 | 295 |
| 512 | 3300038443 | Ga0395901_0000516 | Ga0395901_0000516_28439_29326 | 295 |
| 513 | 3300038443 | Ga0395901_0002142 | Ga0395901_0002142_17703_18590 | 295 |
| 514 | 3300038443 | Ga0395901_0004461 | Ga0395901_0004461_8038_8925 | 295 |
| 515 | 3300038443 | Ga0395901_0007579 | Ga0395901_0007579_2937_3824 | 295 |
| 516 | 3300038443 | Ga0395901_0027070 | Ga0395901_0027070_222_1109 | 295 |
| 517 | 3300038443 | Ga0395901_0041174 | Ga0395901_0041174_3495_4382 | 295 |
| 518 | 3300038443 | Ga0395901_0061569 | Ga0395901_0061569_2806_3693 | 295 |
| 519 | 3300038443 | Ga0395901_0150594 | Ga0395901_0150594_1355_2242 | 295 |
| 520 | 3300038443 | Ga0395901_0183756 | Ga0395901_0183756_35_922 | 295 |
| 521 | 3300038443 | Ga0395901_0337678 | Ga0395901_0337678_403_1290 | 295 |
| 522 | 3300038443 | Ga0395901_0556751 | Ga0395901_0556751_203_1090 | 295 |
| 523 | 3300044684 | Ga0466966_0001152 | Ga0466966_0001152_5990_6877 | 295 |
| 524 | 3300044684 | Ga0466966_0022621 | Ga0466966_0022621_2537_3424 | 295 |
| 525 | 3300044693 | Ga0466961_0041922 | Ga0466961_0041922_1768_2655 | 295 |
| 526 | 3300044694 | Ga0466963_0029848 | Ga0466963_0029848_499_1386 | 295 |
| 527 | 3300044694 | Ga0466963_0081294 | Ga0466963_0081294_50_937 | 295 |
| 528 | 3300044765 | Ga0466970_0002914 | Ga0466970_0002914_1116_2003 | 295 |
| 529 | 3300044842 | Ga0466957_0043075 | Ga0466957_0043075_510_1397 | 295 |
| 530 | 3300045049 | Ga0466959_0020592 | Ga0466959_0020592_395_1282 | 295 |
| 531 | 3300045049 | Ga0466959_0021499 | Ga0466959_0021499_374_1261 | 295 |
| 532 | 3300045836 | Ga0466958_0027595 | Ga0466958_0027595_1212_2099 | 295 |
| 533 | 3300045836 | Ga0466958_0093701 | Ga0466958_0093701_667_1554 | 295 |
| 534 | 3300045836 | Ga0466958_0204334 | Ga0466958_0204334_45_932 | 295 |
| 535 | 3300045976 | Ga0466967_0126710 | Ga0466967_0126710_985_1872 | 295 |
| 536 | 3300045976 | Ga0466967_0559283 | Ga0466967_0559283_76_963 | 295 |
| 537 | 3300046515 | Ga0495620_0099039 | Ga0495620_0099039_216_1103 | 295 |
| 538 | 3300046525 | Ga0495663_0061392 | Ga0495663_0061392_19_906 | 295 |
| 539 | 3300046537 | Ga0495598_0006299 | Ga0495598_0006299_829_1716 | 295 |
| 540 | 3300046558 | Ga0495633_0055753 | Ga0495633_0055753_543_1430 | 295 |
| 541 | 3300046616 | Ga0495668_0190935 | Ga0495668_0190935_178_1065 | 295 |
| 542 | 3300046679 | Ga0495623_0070991 | Ga0495623_0070991_135_1022 | 295 |
| 543 | 3300046684 | Ga0495669_0001170 | Ga0495669_0001170_7038_7925 | 295 |
| 544 | 3300046684 | Ga0495669_0009423 | Ga0495669_0009423_2266_3153 | 295 |
| 545 | 3300046684 | Ga0495669_0012829 | Ga0495669_0012829_1597_2484 | 295 |
| 546 | 3300046684 | Ga0495669_0014347 | Ga0495669_0014347_747_1634 | 295 |
| 547 | 3300046684 | Ga0495669_0096011 | Ga0495669_0096011_17_904 | 295 |
| 548 | 3300046691 | Ga0495670_0011219 | Ga0495670_0011219_1982_2869 | 295 |
| 549 | 3300048088 | Ga0495602_0046500 | Ga0495602_0046500_2044_2931 | 295 |
| 550 | 3300048903 | Ga0496100_0037411 | Ga0496100_0037411_547_1434 | 295 |
| 551 | 3300048904 | Ga0496101_0003378 | Ga0496101_0003378_6540_7427 | 295 |
| 552 | 3300048908 | Ga0496105_0099105 | Ga0496105_0099105_794_1681 | 295 |
| 553 | 3300048909 | Ga0496106_0050361 | Ga0496106_0050361_1668_2555 | 295 |
| 554 | 3300048910 | Ga0496107_0144020 | Ga0496107_0144020_416_1303 | 295 |
| 555 | 3300048911 | Ga0496108_0079528 | Ga0496108_0079528_1846_2733 | 295 |
| 556 | 3300048912 | Ga0496109_0000775 | Ga0496109_0000775_3490_4377 | 295 |
| 557 | 3300048912 | Ga0496109_0098706 | Ga0496109_0098706_338_1225 | 295 |
| 558 | 3300048913 | Ga0496110_0005805 | Ga0496110_0005805_2608_3495 | 295 |
| 559 | 3300048913 | Ga0496110_0012933 | Ga0496110_0012933_2871_3758 | 295 |
| 560 | 3300048914 | Ga0496111_0004837 | Ga0496111_0004837_313_1200 | 295 |
| 561 | 3300048914 | Ga0496111_0012279 | Ga0496111_0012279_2512_3399 | 295 |
| 562 | 3300048915 | Ga0496112_0041602 | Ga0496112_0041602_2819_3706 | 295 |
| 563 | 3300048915 | Ga0496112_0055685 | Ga0496112_0055685_637_1524 | 295 |
| 564 | 3300048916 | Ga0496113_0265737 | Ga0496113_0265737_315_1202 | 295 |
| 565 | 3300048917 | Ga0496114_0026396 | Ga0496114_0026396_1673_2560 | 295 |
| 566 | 3300049590 | Ga0501074_0044732 | Ga0501074_0044732_2010_2897 | 295 |
| 567 | 3300061719 | Ga0466962_0068276 | Ga0466962_0068276_336_1223 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF02882
THF_DHG_CYH_C
Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
115
278
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a5o-assembly2.cif.gz_D | crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) | 0.9743 | 2 | 283 |
| 6s4f-assembly1.cif.gz_B | structure of human mthfd2 in complex with th9619 | 0.9679 | 3 | 285 |
| 3l07-assembly1.cif.gz_A | methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. | 0.9671 | 3 | 285 |
| 5tc4-assembly1.cif.gz_A-2 | crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors | 0.9671 | 3 | 285 |
| 6jid-assembly1.cif.gz_A | human mthfd2 in complex with compound 1 | 0.9647 | 3 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9982 | 34 | 114 | 3.40.50.10860 |
| 4cjxA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9965 | 32 | 115 | 3.40.50.10860 |
| af_A0A0R0F3H3_60_174_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9892 | 14 | 125 | 3.40.50.10860 |
| 4a5oB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9877 | 32 | 115 | 3.40.50.10860 |
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.986 | 34 | 114 | 3.40.50.10860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8YXV1-F1-model_v4 | Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | 1.001 | 50 | 179 |
GO:0004477
GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A2S8LSJ0-F1-model_v4 | deleted | 0.9996 | 40 | 122 |
|
| AF-A0A3D1XNB9-F1-model_v4 | deleted | 0.9987 | 41 | 151 |
|
| AF-A0A351V733-F1-model_v4 | methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) | 0.9985 | 48 | 153 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A3B9UJA7-F1-model_v4 | deleted | 0.9982 | 1 | 174 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar