F464533

General Info

Members Datasets Scaffolds Average Seq Length
567 188 564 293

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0039451|Ga0466969_0039451_779_1666
Length 286
Sequence MTAKLIDGKAAAAEVREQVATAAASFRTATGRAPGLAVVLVGEHPPSAAYVRMKIKATLEAGMESFEHRIPAETSQQDLLALIDRLNADETVDGILVQLPLPRHVDEQAILTGFHPINVGRLSIGLDSLVPCTPLGCLVLLQRELGDLSGKDAIVIGRSNIVGKPMAQLLLGANCTVTVAHSRSRDLASLTRRADIVVAAVGRPELVRGSWLKPGATVIDVGQERVEQPDGSRKLLGDVAFDEAMEVAGAITPVPGGVGPMTIAMLLRNTVVAAHRRMGLPDPEGL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
3 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
4 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.18
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.35
Rhizoplane 3
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8754477 2162886012 Bacteria 1833
2 JGI24736J21556_1004038 3300001904 Bacteria 2525
3 JGI24740J21852_10000089 3300001979 Bacteria 31515
4 JGI24739J22299_10000097 3300001989 Bacteria 25965
5 JGI24737J22298_10000037 3300001990 Bacteria 37991
6 JGI24737J22298_10000930 3300001990 Bacteria 10388
7 JGI24737J22298_10033425 3300001990 Bacteria 1597
8 JGI24743J22301_10002872 3300001991 Bacteria 2655
9 JGI24735J21928_10004142 3300002067 Bacteria 4898
10 JGI24735J21928_10037844 3300002067 Bacteria 1413
11 JGI24738J21930_10000023 3300002075 Bacteria 29088
12 Ga0065715_10095614 3300005293 Bacteria 4044
13 Ga0070658_10000377 3300005327 Bacteria 38853
14 Ga0070658_10020877 3300005327 Bacteria 5247
15 Ga0070658_10091831 3300005327 Bacteria 2502
16 Ga0070658_10109501 3300005327 Bacteria 2287
17 Ga0070658_10116380 3300005327 Bacteria 2218
18 Ga0070658_10119188 3300005327 Bacteria 2192
19 Ga0070658_10306175 3300005327 Bacteria 1355
20 Ga0070676_10104483 3300005328 Bacteria 1755
21 Ga0070683_100001819 3300005329 Bacteria 16631
22 Ga0070683_100039504 3300005329 Bacteria 4332
23 Ga0070683_100228118 3300005329 Bacteria 1770
24 Ga0070670_100003109 3300005331 Bacteria 13741
25 Ga0070670_100003400 3300005331 Bacteria 13192
26 Ga0070670_100042597 3300005331 Bacteria 3903
27 Ga0070670_100159246 3300005331 Bacteria 1956
28 Ga0070670_100177227 3300005331 Bacteria 1850
29 Ga0070670_100395907 3300005331 Bacteria 1219
30 Ga0070677_10008918 3300005333 Bacteria 3388
31 Ga0070677_10047425 3300005333 Bacteria 1722
32 Ga0070666_10000779 3300005335 Bacteria 19305
33 Ga0070666_10005953 3300005335 Bacteria 7486
34 Ga0070666_10024629 3300005335 Bacteria 3922
35 Ga0070666_10065966 3300005335 Bacteria 2456
36 Ga0070682_100006873 3300005337 Bacteria 6393
37 Ga0068868_100000259 3300005338 Bacteria 36003
38 Ga0068868_100015245 3300005338 Bacteria 5681
39 Ga0068868_100048166 3300005338 Bacteria 3343
40 Ga0068868_100061889 3300005338 Bacteria 2966
41 Ga0070660_100000986 3300005339 Bacteria 19065
42 Ga0070660_100058544 3300005339 Bacteria 2986
43 Ga0070660_100081729 3300005339 Bacteria 2537
44 Ga0070660_100171964 3300005339 Bacteria 1750
45 Ga0070689_100028985 3300005340 Bacteria 4187
46 Ga0070689_100158173 3300005340 Bacteria 1830
47 Ga0070661_100000187 3300005344 Bacteria 51095
48 Ga0070661_100004695 3300005344 Bacteria 9409
49 Ga0070661_100011962 3300005344 Bacteria 6062
50 Ga0070661_100072913 3300005344 Bacteria 2527
51 Ga0070661_100165569 3300005344 Bacteria 1676
52 Ga0070661_100209843 3300005344 Bacteria 1490
53 Ga0070661_100224334 3300005344 Bacteria 1442
54 Ga0070692_10034116 3300005345 Bacteria 2568
55 Ga0070692_10057624 3300005345 Bacteria 2038
56 Ga0070668_100035371 3300005347 Bacteria 3809
57 Ga0070669_100000174 3300005353 Bacteria 56290
58 Ga0070669_100033518 3300005353 Bacteria 3715
59 Ga0070669_100131253 3300005353 Bacteria 1922
60 Ga0070669_100164872 3300005353 Bacteria 1724
61 Ga0070675_100002370 3300005354 Bacteria 14027
62 Ga0070675_100010543 3300005354 Bacteria 7221
63 Ga0070675_100023558 3300005354 Bacteria 4925
64 Ga0070675_100102492 3300005354 Bacteria 2411
65 Ga0070671_100001282 3300005355 Bacteria 18862
66 Ga0070671_100029886 3300005355 Bacteria 4495
67 Ga0070671_100054381 3300005355 Bacteria 3329
68 Ga0070671_100128547 3300005355 Bacteria 2133
69 Ga0070674_100007200 3300005356 Bacteria 6548
70 Ga0070674_100161329 3300005356 Bacteria 1701
71 Ga0070674_100168299 3300005356 Bacteria 1669
72 Ga0070673_100000337 3300005364 Bacteria 24629
73 Ga0070673_100010120 3300005364 Bacteria 6367
74 Ga0070673_100011602 3300005364 Bacteria 6020
75 Ga0070673_100011732 3300005364 Bacteria 5992
76 Ga0070673_100031597 3300005364 Bacteria 3976
77 Ga0070659_100000191 3300005366 Bacteria 47035
78 Ga0070659_100000674 3300005366 Bacteria 24835
79 Ga0070659_100028122 3300005366 Bacteria 4339
80 Ga0070659_100039493 3300005366 Bacteria 3685
81 Ga0070659_100052281 3300005366 Bacteria 3213
82 Ga0070659_100141643 3300005366 Bacteria 1958
83 Ga0070659_100183630 3300005366 Bacteria 1717
84 Ga0070659_100209052 3300005366 Bacteria 1608
85 Ga0070659_100212634 3300005366 Bacteria 1594
86 Ga0070667_100001311 3300005367 Bacteria 22374
87 Ga0070667_100003559 3300005367 Bacteria 13269
88 Ga0070667_100011671 3300005367 Bacteria 7263
89 Ga0070667_100104177 3300005367 Bacteria 2454
90 Ga0070667_100263107 3300005367 Bacteria 1545
91 Ga0070667_100300977 3300005367 Bacteria 1444
92 Ga0070714_100055739 3300005435 Bacteria 3379
93 Ga0070714_100065718 3300005435 Bacteria 3124
94 Ga0070663_100000754 3300005455 Bacteria 17546
95 Ga0070663_100029193 3300005455 Bacteria 3765
96 Ga0070663_100077044 3300005455 Bacteria 2440
97 Ga0070663_100108487 3300005455 Bacteria 2082
98 Ga0070663_100110707 3300005455 Bacteria 2063
99 Ga0070663_100128264 3300005455 Bacteria 1923
100 Ga0070678_100034382 3300005456 Bacteria 3529
101 Ga0070662_100000012 3300005457 Bacteria 129380
102 Ga0070662_100001658 3300005457 Bacteria 13697
103 Ga0070662_100004211 3300005457 Bacteria 9062
104 Ga0070662_100005641 3300005457 Bacteria 8004
105 Ga0070662_100007787 3300005457 Bacteria 6960
106 Ga0070662_100122185 3300005457 Bacteria 1997
107 Ga0070662_100222646 3300005457 Bacteria 1506
108 Ga0068867_100006572 3300005459 Bacteria 8214
109 Ga0068867_100008577 3300005459 Bacteria 7215
110 Ga0068867_100214457 3300005459 Bacteria 1548
111 Ga0070685_10068101 3300005466 Bacteria 2102
112 Ga0070679_100162601 3300005530 Bacteria 2206
113 Ga0070679_100522698 3300005530 Bacteria 1131
114 Ga0070684_100003278 3300005535 Bacteria 12122
115 Ga0070684_100009174 3300005535 Bacteria 7780
116 Ga0070684_100107569 3300005535 Bacteria 2498
117 Ga0068853_100000032 3300005539 Bacteria 114306
118 Ga0068853_100000811 3300005539 Bacteria 21781
119 Ga0068853_100311023 3300005539 Bacteria 1458
120 Ga0070672_100000945 3300005543 Bacteria 17467
121 Ga0070672_100004830 3300005543 Bacteria 8857
122 Ga0070672_100015335 3300005543 Bacteria 5454
123 Ga0070686_100032521 3300005544 Bacteria 3199
124 Ga0070693_100000332 3300005547 Bacteria 21624
125 Ga0070665_100013547 3300005548 Bacteria 8203
126 Ga0070665_100021059 3300005548 Bacteria 6556
127 Ga0070665_100031747 3300005548 Bacteria 5316
128 Ga0070665_100104758 3300005548 Bacteria 2831
129 Ga0068855_100000591 3300005563 Bacteria 44412
130 Ga0068855_100003900 3300005563 Bacteria 18212
131 Ga0070664_100000187 3300005564 Bacteria 43750
132 Ga0070664_100001469 3300005564 Bacteria 18785
133 Ga0070664_100012642 3300005564 Bacteria 6872
134 Ga0070664_100039187 3300005564 Bacteria 3992
135 Ga0070664_100159072 3300005564 Bacteria 1997
136 Ga0070664_100229423 3300005564 Bacteria 1664
137 Ga0070664_100321093 3300005564 Bacteria 1403
138 Ga0068857_100004021 3300005577 Bacteria 12383
139 Ga0068857_100034073 3300005577 Bacteria 4505
140 Ga0068857_100078693 3300005577 Bacteria 2943
141 Ga0068854_100000664 3300005578 Bacteria 20511
142 Ga0068854_100025831 3300005578 Bacteria 4031
143 Ga0068854_100491376 3300005578 Bacteria 1032
144 Ga0068856_100000291 3300005614 Bacteria 54890
145 Ga0068856_100013426 3300005614 Bacteria 7930
146 Ga0068856_100100639 3300005614 Bacteria 2882
147 Ga0068856_100124219 3300005614 Bacteria 2583
148 Ga0068856_100156559 3300005614 Bacteria 2288
149 Ga0068852_100000906 3300005616 Bacteria 19629
150 Ga0068852_100102337 3300005616 Bacteria 2588
151 Ga0068852_100104429 3300005616 Bacteria 2564
152 Ga0068852_100141397 3300005616 Bacteria 2228
153 Ga0068852_100325452 3300005616 Bacteria 1494
154 Ga0068859_100002786 3300005617 Bacteria 17711
155 Ga0068864_100002633 3300005618 Bacteria 14809
156 Ga0068864_100224571 3300005618 Bacteria 1734
157 Ga0068866_10098458 3300005718 Bacteria 1608
158 Ga0068861_100027898 3300005719 Bacteria 4117
159 Ga0068861_100264410 3300005719 Bacteria 1474
160 Ga0068851_10022469 3300005834 Bacteria 3073
161 Ga0068851_10042459 3300005834 Bacteria 2289
162 Ga0068863_100002317 3300005841 Bacteria 18934
163 Ga0068858_100000620 3300005842 Bacteria 36979
164 Ga0068858_100009881 3300005842 Bacteria 9065
165 Ga0068860_100003524 3300005843 Bacteria 16093
166 Ga0097620_100002786 3300006931 Bacteria 17711
167 Ga0105240_10048201 3300009093 Bacteria 5386
168 Ga0105240_10152373 3300009093 Bacteria 2752
169 Ga0105240_10221098 3300009093 Bacteria 2206
170 Ga0105240_10481935 3300009093 Bacteria 1383
171 Ga0105245_10000229 3300009098 Bacteria 53255
172 Ga0105245_10023282 3300009098 Bacteria 5437
173 Ga0105245_10198795 3300009098 Bacteria 1924
174 Ga0105247_10237929 3300009101 Bacteria 1239
175 Ga0105243_10030827 3300009148 Bacteria 4132
176 Ga0105241_10109553 3300009174 Bacteria 2208
177 Ga0105241_10236893 3300009174 Bacteria 1541
178 Ga0105248_10000083 3300009177 Bacteria 110619
179 Ga0105248_10000790 3300009177 Bacteria 35522
180 Ga0105248_10001634 3300009177 Bacteria 24926
181 Ga0105248_10003127 3300009177 Bacteria 18320
182 Ga0105248_10011959 3300009177 Bacteria 9570
183 Ga0105248_10023944 3300009177 Bacteria 6787
184 Ga0105248_10254978 3300009177 Bacteria 1975
185 Ga0105238_10024793 3300009551 Bacteria 6113
186 Ga0105239_10221754 3300010375 Bacteria 2120
187 Ga0105246_10006237 3300011119 Bacteria 7278
188 Ga0157373_10071086 3300013100 Bacteria 2458
189 Ga0157373_10087945 3300013100 Bacteria 2189
190 Ga0157373_10089370 3300013100 Bacteria 2169
191 Ga0157373_10100314 3300013100 Bacteria 2037
192 Ga0157373_10169372 3300013100 Bacteria 1537
193 Ga0157371_10000756 3300013102 Bacteria 37389
194 Ga0157371_10009514 3300013102 Bacteria 7642
195 Ga0157371_10024460 3300013102 Bacteria 4410
196 Ga0157371_10070421 3300013102 Bacteria 2476
197 Ga0157371_10347565 3300013102 Bacteria 1079
198 Ga0157370_10150712 3300013104 Bacteria 2164
199 Ga0157369_10000137 3300013105 Bacteria 103542
200 Ga0157369_10007204 3300013105 Bacteria 12816
201 Ga0157369_10019245 3300013105 Bacteria 7638
202 Ga0157369_10042284 3300013105 Bacteria 4972
203 Ga0157369_10049779 3300013105 Bacteria 4540
204 Ga0157369_10084813 3300013105 Bacteria 3385
205 Ga0157369_10224048 3300013105 Bacteria 1967
206 Ga0157374_10019076 3300013296 Bacteria 6068
207 Ga0157374_10090171 3300013296 Bacteria 2922
208 Ga0157374_10219149 3300013296 Bacteria 1867
209 Ga0157374_10505694 3300013296 Bacteria 1213
210 Ga0157378_10000154 3300013297 Bacteria 64986
211 Ga0157378_10191875 3300013297 Bacteria 1927
212 Ga0163162_10023881 3300013306 Bacteria 6034
213 Ga0157372_10379691 3300013307 Bacteria 1647
214 Ga0157372_10454013 3300013307 Bacteria 1493
215 Ga0157375_10020583 3300013308 Bacteria 6030
216 Ga0157375_10200197 3300013308 Bacteria 2153
217 Ga0157375_10403985 3300013308 Bacteria 1533
218 Ga0163163_10001064 3300014325 Bacteria 23319
219 Ga0182008_10222246 3300014497 Bacteria 966
220 Ga0157376_10090404 3300014969 Bacteria 2649
221 Ga0206353_11586731 3300020082 Bacteria 976
222 Ga0213875_10020399 3300021388 Bacteria 3179
223 Ga0207673_1007899 3300025290 Bacteria 1341
224 Ga0207697_10000187 3300025315 Bacteria 32396
225 Ga0207656_10001253 3300025321 Bacteria 8367
226 Ga0207656_10054507 3300025321 Bacteria 1738
227 Ga0207682_10059230 3300025893 Bacteria 1600
228 Ga0207688_10000595 3300025901 Bacteria 17763
229 Ga0207688_10022437 3300025901 Bacteria 3454
230 Ga0207680_10002585 3300025903 Bacteria 8443
231 Ga0207680_10068629 3300025903 Bacteria 2188
232 Ga0207680_10134016 3300025903 Bacteria 1635
233 Ga0207647_10000090 3300025904 Bacteria 69395
234 Ga0207647_10012986 3300025904 Bacteria 5785
235 Ga0207647_10028131 3300025904 Bacteria 3656
236 Ga0207647_10047898 3300025904 Bacteria 2656
237 Ga0207645_10012721 3300025907 Bacteria 5706
238 Ga0207645_10031056 3300025907 Bacteria 3439
239 Ga0207645_10096039 3300025907 Bacteria 1909
240 Ga0207705_10000030 3300025909 Bacteria 239341
241 Ga0207705_10000072 3300025909 Bacteria 126043
242 Ga0207705_10010411 3300025909 Bacteria 6760
243 Ga0207705_10011473 3300025909 Bacteria 6412
244 Ga0207705_10023019 3300025909 Bacteria 4443
245 Ga0207705_10031771 3300025909 Bacteria 3770
246 Ga0207705_10095609 3300025909 Bacteria 2180
247 Ga0207705_10175862 3300025909 Bacteria 1613
248 Ga0207705_10197535 3300025909 Bacteria 1523
249 Ga0207695_10014730 3300025913 Bacteria 9246
250 Ga0207695_10036058 3300025913 Bacteria 5351
251 Ga0207695_10157091 3300025913 Bacteria 2208
252 Ga0207657_10000176 3300025919 Bacteria 65856
253 Ga0207657_10002682 3300025919 Bacteria 19192
254 Ga0207657_10007866 3300025919 Bacteria 10882
255 Ga0207657_10014374 3300025919 Bacteria 7730
256 Ga0207657_10014766 3300025919 Bacteria 7605
257 Ga0207657_10018127 3300025919 Bacteria 6735
258 Ga0207657_10020297 3300025919 Bacteria 6284
259 Ga0207657_10140627 3300025919 Bacteria 1972
260 Ga0207649_10000810 3300025920 Bacteria 20093
261 Ga0207649_10004374 3300025920 Bacteria 7667
262 Ga0207649_10006147 3300025920 Bacteria 6518
263 Ga0207649_10016042 3300025920 Bacteria 4218
264 Ga0207649_10046477 3300025920 Bacteria 2667
265 Ga0207649_10068215 3300025920 Bacteria 2260
266 Ga0207649_10075884 3300025920 Bacteria 2161
267 Ga0207649_10083466 3300025920 Bacteria 2074
268 Ga0207652_10003111 3300025921 Bacteria 13832
269 Ga0207681_10005702 3300025923 Bacteria 7642
270 Ga0207681_10146085 3300025923 Bacteria 1767
271 Ga0207681_10167103 3300025923 Bacteria 1664
272 Ga0207694_10036262 3300025924 Bacteria 3784
273 Ga0207650_10005079 3300025925 Bacteria 8983
274 Ga0207650_10016751 3300025925 Bacteria 5125
275 Ga0207650_10034652 3300025925 Bacteria 3662
276 Ga0207650_10059964 3300025925 Bacteria 2838
277 Ga0207650_10251182 3300025925 Bacteria 1432
278 Ga0207659_10007264 3300025926 Bacteria 6805
279 Ga0207659_10012137 3300025926 Bacteria 5465
280 Ga0207659_10138795 3300025926 Bacteria 1885
281 Ga0207659_10174596 3300025926 Bacteria 1697
282 Ga0207687_10001063 3300025927 Bacteria 18628
283 Ga0207687_10012657 3300025927 Bacteria 5512
284 Ga0207664_10079535 3300025929 Bacteria 2662
285 Ga0207664_10184904 3300025929 Bacteria 1791
286 Ga0207644_10005196 3300025931 Bacteria 8507
287 Ga0207644_10015754 3300025931 Bacteria 5080
288 Ga0207644_10018835 3300025931 Bacteria 4677
289 Ga0207644_10105072 3300025931 Bacteria 2127
290 Ga0207644_10106168 3300025931 Bacteria 2117
291 Ga0207644_10125658 3300025931 Bacteria 1957
292 Ga0207644_10141283 3300025931 Bacteria 1854
293 Ga0207690_10000245 3300025932 Bacteria 39464
294 Ga0207690_10005573 3300025932 Bacteria 7437
295 Ga0207690_10014951 3300025932 Bacteria 4700
296 Ga0207690_10055336 3300025932 Bacteria 2672
297 Ga0207690_10109546 3300025932 Bacteria 1987
298 Ga0207690_10133771 3300025932 Bacteria 1818
299 Ga0207690_10189570 3300025932 Bacteria 1554
300 Ga0207690_10198959 3300025932 Bacteria 1520
301 Ga0207690_10439908 3300025932 Bacteria 1046
302 Ga0207706_10000041 3300025933 Bacteria 130090
303 Ga0207706_10001429 3300025933 Bacteria 23905
304 Ga0207706_10003596 3300025933 Bacteria 14803
305 Ga0207706_10011213 3300025933 Bacteria 8172
306 Ga0207706_10011368 3300025933 Bacteria 8112
307 Ga0207706_10059459 3300025933 Bacteria 3365
308 Ga0207706_10082581 3300025933 Bacteria 2824
309 Ga0207706_10180054 3300025933 Bacteria 1856
310 Ga0207706_10321123 3300025933 Bacteria 1348
311 Ga0207669_10022495 3300025937 Bacteria 3350
312 Ga0207669_10097778 3300025937 Bacteria 1931
313 Ga0207669_10179077 3300025937 Bacteria 1518
314 Ga0207691_10000045 3300025940 Bacteria 99798
315 Ga0207691_10005139 3300025940 Bacteria 12634
316 Ga0207691_10013011 3300025940 Bacteria 7967
317 Ga0207691_10128425 3300025940 Bacteria 2241
318 Ga0207711_10001311 3300025941 Bacteria 23539
319 Ga0207711_10001677 3300025941 Bacteria 20395
320 Ga0207711_10002858 3300025941 Bacteria 15138
321 Ga0207711_10003863 3300025941 Bacteria 12888
322 Ga0207711_10009533 3300025941 Bacteria 8098
323 Ga0207711_10189622 3300025941 Bacteria 1873
324 Ga0207689_10000226 3300025942 Bacteria 50110
325 Ga0207661_10000953 3300025944 Bacteria 19059
326 Ga0207661_10005783 3300025944 Bacteria 8719
327 Ga0207661_10043965 3300025944 Bacteria 3527
328 Ga0207661_10084033 3300025944 Bacteria 2636
329 Ga0207679_10000243 3300025945 Bacteria 41706
330 Ga0207679_10008060 3300025945 Bacteria 6698
331 Ga0207679_10112309 3300025945 Bacteria 2153
332 Ga0207667_10006092 3300025949 Bacteria 14659
333 Ga0207667_10063634 3300025949 Bacteria 3854
334 Ga0207667_10201249 3300025949 Bacteria 2043
335 Ga0207667_10228513 3300025949 Bacteria 1905
336 Ga0207651_10000494 3300025960 Bacteria 16521
337 Ga0207651_10012001 3300025960 Bacteria 4878
338 Ga0207651_10013969 3300025960 Bacteria 4619
339 Ga0207651_10034105 3300025960 Bacteria 3292
340 Ga0207651_10076825 3300025960 Bacteria 2388
341 Ga0207668_10027591 3300025972 Bacteria 3700
342 Ga0207668_10060121 3300025972 Bacteria 2666
343 Ga0207668_10315338 3300025972 Bacteria 1296
344 Ga0207640_10004637 3300025981 Bacteria 7459
345 Ga0207640_10124709 3300025981 Bacteria 1852
346 Ga0207658_10004807 3300025986 Bacteria 9347
347 Ga0207658_10008814 3300025986 Bacteria 6848
348 Ga0207658_10174315 3300025986 Bacteria 1775
349 Ga0207658_10353257 3300025986 Bacteria 1280
350 Ga0207658_10462448 3300025986 Bacteria 1125
351 Ga0207677_10003117 3300026023 Bacteria 8747
352 Ga0207677_10018354 3300026023 Bacteria 4196
353 Ga0207677_10030638 3300026023 Bacteria 3437
354 Ga0207677_10143483 3300026023 Bacteria 1832
355 Ga0207677_10190567 3300026023 Bacteria 1621
356 Ga0207703_10002105 3300026035 Bacteria 17519
357 Ga0207703_10002663 3300026035 Bacteria 15352
358 Ga0207703_10079372 3300026035 Bacteria 2730
359 Ga0207639_10000222 3300026041 Bacteria 42464
360 Ga0207639_10006140 3300026041 Bacteria 8157
361 Ga0207639_10033533 3300026041 Bacteria 3788
362 Ga0207678_10004584 3300026067 Bacteria 12425
363 Ga0207678_10004795 3300026067 Bacteria 12143
364 Ga0207678_10009690 3300026067 Bacteria 8475
365 Ga0207678_10021513 3300026067 Bacteria 5656
366 Ga0207678_10039637 3300026067 Bacteria 4088
367 Ga0207678_10056947 3300026067 Bacteria 3364
368 Ga0207678_10087759 3300026067 Bacteria 2658
369 Ga0207678_10100749 3300026067 Bacteria 2467
370 Ga0207678_10181336 3300026067 Bacteria 1798
371 Ga0207702_10000074 3300026078 Bacteria 113070
372 Ga0207702_10044382 3300026078 Bacteria 3736
373 Ga0207702_10245637 3300026078 Bacteria 1679
374 Ga0207702_10467518 3300026078 Bacteria 1226
375 Ga0207702_10543802 3300026078 Bacteria 1135
376 Ga0207641_10024907 3300026088 Bacteria 4933
377 Ga0207648_10002102 3300026089 Bacteria 21704
378 Ga0207648_10008748 3300026089 Bacteria 9757
379 Ga0207648_10222877 3300026089 Bacteria 1676
380 Ga0207676_10001193 3300026095 Bacteria 19504
381 Ga0207676_10005397 3300026095 Bacteria 9048
382 Ga0207676_10007462 3300026095 Bacteria 7760
383 Ga0207676_10030129 3300026095 Bacteria 4070
384 Ga0207674_10000531 3300026116 Bacteria 49979
385 Ga0207674_10030221 3300026116 Bacteria 5698
386 Ga0207674_10125058 3300026116 Bacteria 2537
387 Ga0207674_10127106 3300026116 Bacteria 2514
388 Ga0207675_100044742 3300026118 Bacteria 4137
389 Ga0207675_100075063 3300026118 Bacteria 3164
390 Ga0207698_10000892 3300026142 Bacteria 17333
391 Ga0207698_10031124 3300026142 Bacteria 3848
392 Ga0207698_10089400 3300026142 Bacteria 2515
393 Ga0207698_10412655 3300026142 Bacteria 1294
394 Ga0268266_10049829 3300028379 Bacteria 3592
395 Ga0268266_10055274 3300028379 Bacteria 3412
396 Ga0268266_10083549 3300028379 Bacteria 2787
397 Ga0268265_10501880 3300028380 Bacteria 1143
398 Ga0268264_10147803 3300028381 Bacteria 2103
399 Ga0307408_100047429 3300031548 Bacteria 3077
400 Ga0307408_100077095 3300031548 Bacteria 2481
401 Ga0307408_100365071 3300031548 Bacteria 1229
402 Ga0307405_10017948 3300031731 Bacteria 3894
403 Ga0307405_10026183 3300031731 Bacteria 3362
404 Ga0307405_10100468 3300031731 Bacteria 1939
405 Ga0307405_10103982 3300031731 Bacteria 1910
406 Ga0307405_10118105 3300031731 Bacteria 1809
407 Ga0307413_10003433 3300031824 Bacteria 6664
408 Ga0307413_10004014 3300031824 Bacteria 6325
409 Ga0307413_10099590 3300031824 Bacteria 1916
410 Ga0307410_10005046 3300031852 Bacteria 6936
411 Ga0307410_10067429 3300031852 Bacteria 2468
412 Ga0307410_10141388 3300031852 Bacteria 1781
413 Ga0307406_10028024 3300031901 Bacteria 3400
414 Ga0307406_10077785 3300031901 Bacteria 2196
415 Ga0307406_10079032 3300031901 Bacteria 2180
416 Ga0307406_10108653 3300031901 Bacteria 1905
417 Ga0307406_10170289 3300031901 Bacteria 1575
418 Ga0307407_10039617 3300031903 Bacteria 2621
419 Ga0307407_10060018 3300031903 Bacteria 2217
420 Ga0307407_10130786 3300031903 Bacteria 1605
421 Ga0307412_10011180 3300031911 Bacteria 5194
422 Ga0307412_10020171 3300031911 Bacteria 4052
423 Ga0307412_10120115 3300031911 Bacteria 1891
424 Ga0307412_10205605 3300031911 Bacteria 1498
425 Ga0307409_100071473 3300031995 Bacteria 2759
426 Ga0307409_100129968 3300031995 Bacteria 2150
427 Ga0307409_100181339 3300031995 Bacteria 1864
428 Ga0307409_100287227 3300031995 Bacteria 1523
429 Ga0307409_100289801 3300031995 Bacteria 1518
430 Ga0307409_100436012 3300031995 Bacteria 1261
431 Ga0307416_100014929 3300032002 Bacteria 5344
432 Ga0307416_100169776 3300032002 Bacteria 2029
433 Ga0307416_100546920 3300032002 Bacteria 1230
434 Ga0307414_10020483 3300032004 Bacteria 4123
435 Ga0307414_10037658 3300032004 Bacteria 3241
436 Ga0307414_10069861 3300032004 Bacteria 2526
437 Ga0307414_10099666 3300032004 Bacteria 2183
438 Ga0307414_10243286 3300032004 Bacteria 1491
439 Ga0307411_10016425 3300032005 Bacteria 4188
440 Ga0307411_10018606 3300032005 Bacteria 3990
441 Ga0307415_100039909 3300032126 Bacteria 3106
442 Ga0307415_100197213 3300032126 Bacteria 1594
443 Ga0373943_0029916 3300035170 Bacteria 2575
444 Ga0373955_0247488 3300035172 Bacteria 1068
445 Ga0373931_0052464 3300035691 Bacteria 2174
446 Ga0373935_0252100 3300035692 Bacteria 1235
447 Ga0373933_0031583 3300035724 Bacteria 3072
448 Ga0373925_0044348 3300037068 Bacteria 3302
449 Ga0395899_0000302 3300037312 Bacteria 63367
450 Ga0395899_0017613 3300037312 Bacteria 5440
451 Ga0395899_0019434 3300037312 Bacteria 5161
452 Ga0395899_0032366 3300037312 Bacteria 3927
453 Ga0395899_0044714 3300037312 Bacteria 3299
454 Ga0395899_0046829 3300037312 Bacteria 3220
455 Ga0395899_0053011 3300037312 Bacteria 3004
456 Ga0395899_0090094 3300037312 Bacteria 2224
457 Ga0395899_0122093 3300037312 Bacteria 1865
458 Ga0395899_0123975 3300037312 Bacteria 1848
459 Ga0395899_0193215 3300037312 Bacteria 1423
460 Ga0395899_0233293 3300037312 Bacteria 1269
461 Ga0395900_0000997 3300037418 Bacteria 36770
462 Ga0395900_0002684 3300037418 Bacteria 19451
463 Ga0395900_0007283 3300037418 Bacteria 11451
464 Ga0395900_0009267 3300037418 Bacteria 10092
465 Ga0395900_0017664 3300037418 Bacteria 7280
466 Ga0395900_0023580 3300037418 Bacteria 6295
467 Ga0395900_0027388 3300037418 Bacteria 5837
468 Ga0395900_0166059 3300037418 Bacteria 2249
469 Ga0395900_0237224 3300037418 Bacteria 1831
470 Ga0395900_0275376 3300037418 Bacteria 1676
471 Ga0395900_0383731 3300037418 Bacteria 1372
472 Ga0395900_0427317 3300037418 Bacteria 1284
473 Ga0395900_0594746 3300037418 Bacteria 1047
474 Ga0395898_0000054 3300037466 Bacteria 279561
475 Ga0395898_0014768 3300037466 Bacteria 8016
476 Ga0395898_0051732 3300037466 Bacteria 4016
477 Ga0395898_0053971 3300037466 Bacteria 3923
478 Ga0395898_0054496 3300037466 Bacteria 3902
479 Ga0395898_0085987 3300037466 Bacteria 3031
480 Ga0395898_0193645 3300037466 Bacteria 1942
481 Ga0395905_0000046 3300037471 Bacteria 240463
482 Ga0395905_0001164 3300037471 Bacteria 32823
483 Ga0395905_0043817 3300037471 Bacteria 4198
484 Ga0395905_0047368 3300037471 Bacteria 4029
485 Ga0395905_0084641 3300037471 Bacteria 2971
486 Ga0395905_0129196 3300037471 Bacteria 2376
487 Ga0395905_0259947 3300037471 Bacteria 1621
488 Ga0395905_0373048 3300037471 Bacteria 1320
489 Ga0436364_0089743 3300037853 Bacteria 14523
490 Ga0395901_0000086 3300038443 Bacteria 125359
491 Ga0395901_0000516 3300038443 Bacteria 44694
492 Ga0395901_0002142 3300038443 Bacteria 20180
493 Ga0395901_0004461 3300038443 Bacteria 14121
494 Ga0395901_0007579 3300038443 Bacteria 10963
495 Ga0395901_0027070 3300038443 Bacteria 5889
496 Ga0395901_0041174 3300038443 Bacteria 4786
497 Ga0395901_0061569 3300038443 Bacteria 3905
498 Ga0395901_0150594 3300038443 Bacteria 2444
499 Ga0395901_0183756 3300038443 Bacteria 2193
500 Ga0395901_0283645 3300038443 Bacteria 1720
501 Ga0395901_0337678 3300038443 Bacteria 1557
502 Ga0395901_0556751 3300038443 Bacteria 1161
503 Ga0395901_0677003 3300038443 Bacteria 1032
504 Ga0466969_0039451 3300044656 Bacteria 2371
505 Ga0466966_0001152 3300044684 Bacteria 16994
506 Ga0466966_0003709 3300044684 Bacteria 10071
507 Ga0466966_0022621 3300044684 Bacteria 4124
508 Ga0466966_0029842 3300044684 Bacteria 3545
509 Ga0466961_0029514 3300044693 Bacteria 3524
510 Ga0466961_0041922 3300044693 Bacteria 2934
511 Ga0466963_0015928 3300044694 Bacteria 4667
512 Ga0466963_0029848 3300044694 Bacteria 3513
513 Ga0466963_0081294 3300044694 Bacteria 2194
514 Ga0466971_0014596 3300044719 Bacteria 3458
515 Ga0466970_0001142 3300044765 Bacteria 12860
516 Ga0466970_0002914 3300044765 Bacteria 8290
517 Ga0466957_0008413 3300044842 Bacteria 5867
518 Ga0466957_0043075 3300044842 Bacteria 2732
519 Ga0466959_0020592 3300045049 Bacteria 4859
520 Ga0466959_0021499 3300045049 Bacteria 4758
521 Ga0466959_0110958 3300045049 Bacteria 1957
522 Ga0466959_0164656 3300045049 Bacteria 1557
523 Ga0466958_0000291 3300045836 Bacteria 19576
524 Ga0466958_0027595 3300045836 Bacteria 3361
525 Ga0466958_0093701 3300045836 Bacteria 1860
526 Ga0466958_0204334 3300045836 Bacteria 1257
527 Ga0466958_0254738 3300045836 Bacteria 1123
528 Ga0466967_0126710 3300045976 Bacteria 2366
529 Ga0466967_0559283 3300045976 Bacteria 1126
530 Ga0495620_0099039 3300046515 Bacteria 1163
531 Ga0495663_0061392 3300046525 Bacteria 1182
532 Ga0495598_0006299 3300046537 Bacteria 2675
533 Ga0495633_0055753 3300046558 Bacteria 1857
534 Ga0495668_0190935 3300046616 Bacteria 1122
535 Ga0495623_0070991 3300046679 Bacteria 2168
536 Ga0495669_0001170 3300046684 Bacteria 10906
537 Ga0495669_0009423 3300046684 Bacteria 4116
538 Ga0495669_0012829 3300046684 Bacteria 3567
539 Ga0495669_0014347 3300046684 Bacteria 3387
540 Ga0495669_0096011 3300046684 Bacteria 1373
541 Ga0495670_0011219 3300046691 Bacteria 4404
542 Ga0495602_0046500 3300048088 Bacteria 3920
543 Ga0496100_0037411 3300048903 Bacteria 3068
544 Ga0496101_0003378 3300048904 Bacteria 9953
545 Ga0496101_0353140 3300048904 Bacteria 1156
546 Ga0496105_0099105 3300048908 Bacteria 2406
547 Ga0496106_0050361 3300048909 Bacteria 3139
548 Ga0496107_0144020 3300048910 Bacteria 1761
549 Ga0496108_0079528 3300048911 Bacteria 2776
550 Ga0496109_0000775 3300048912 Bacteria 26550
551 Ga0496109_0098706 3300048912 Bacteria 2708
552 Ga0496110_0005805 3300048913 Bacteria 9702
553 Ga0496110_0012933 3300048913 Bacteria 6882
554 Ga0496111_0004837 3300048914 Bacteria 8544
555 Ga0496111_0012279 3300048914 Bacteria 5795
556 Ga0496112_0041602 3300048915 Bacteria 4496
557 Ga0496112_0055685 3300048915 Bacteria 3890
558 Ga0496113_0265737 3300048916 Bacteria 1371
559 Ga0496114_0026396 3300048917 Bacteria 4755
560 Ga0501074_0044732 3300049590 Bacteria 3204
561 Ga0495612_0041992 3300053078 Bacteria 1866
562 Ga0466962_0002330 3300061719 Bacteria 9001
563 Ga0466962_0049527 3300061719 Bacteria 2008
564 Ga0466962_0068276 3300061719 Bacteria 1697

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002067 JGI24735J21928_10004142 JGI24735J21928_100041422 258
2 3300038443 Ga0395901_0283645 Ga0395901_0283645_47_823 258
3 3300038443 Ga0395901_0677003 Ga0395901_0677003_57_833 258
4 3300061719 Ga0466962_0049527 Ga0466962_0049527_1194_1970 258
5 3300048904 Ga0496101_0353140 Ga0496101_0353140_20_802 260
6 3300037471 Ga0395905_0259947 Ga0395905_0259947_41_832 263
7 3300001979 JGI24740J21852_10000089 JGI24740J21852_1000008923 277
8 3300001991 JGI24743J22301_10002872 JGI24743J22301_100028723 277
9 3300005331 Ga0070670_100177227 Ga0070670_1001772273 277
10 3300005335 Ga0070666_10065966 Ga0070666_100659662 277
11 3300005338 Ga0068868_100048166 Ga0068868_1000481663 277
12 3300005354 Ga0070675_100023558 Ga0070675_1000235582 277
13 3300005364 Ga0070673_100011602 Ga0070673_1000116023 277
14 3300005367 Ga0070667_100104177 Ga0070667_1001041773 277
15 3300005456 Ga0070678_100034382 Ga0070678_1000343824 277
16 3300005457 Ga0070662_100222646 Ga0070662_1002226462 277
17 3300005543 Ga0070672_100015335 Ga0070672_1000153355 277
18 3300005548 Ga0070665_100013547 Ga0070665_1000135473 277
19 3300005564 Ga0070664_100229423 Ga0070664_1002294232 277
20 3300009177 Ga0105248_10254978 Ga0105248_102549783 277
21 3300013296 Ga0157374_10019076 Ga0157374_100190765 277
22 3300013306 Ga0163162_10023881 Ga0163162_100238815 277
23 3300013308 Ga0157375_10020583 Ga0157375_100205834 277
24 3300014969 Ga0157376_10090404 Ga0157376_100904043 277
25 3300025901 Ga0207688_10022437 Ga0207688_100224372 277
26 3300025903 Ga0207680_10068629 Ga0207680_100686292 277
27 3300025925 Ga0207650_10059964 Ga0207650_100599643 277
28 3300025926 Ga0207659_10174596 Ga0207659_101745961 277
29 3300025933 Ga0207706_10180054 Ga0207706_101800543 277
30 3300025940 Ga0207691_10013011 Ga0207691_100130118 277
31 3300025941 Ga0207711_10189622 Ga0207711_101896223 277
32 3300025960 Ga0207651_10012001 Ga0207651_100120014 277
33 3300026023 Ga0207677_10030638 Ga0207677_100306382 277
34 3300026035 Ga0207703_10079372 Ga0207703_100793724 277
35 3300028379 Ga0268266_10083549 Ga0268266_100835493 277
36 3300044694 Ga0466963_0015928 Ga0466963_0015928_2152_3039 279
37 3300031852 Ga0307410_10141388 Ga0307410_101413883 280
38 3300031901 Ga0307406_10108653 Ga0307406_101086533 280
39 3300044684 Ga0466966_0029842 Ga0466966_0029842_1878_2765 281
40 3300045049 Ga0466959_0164656 Ga0466959_0164656_94_981 281
41 3300045836 Ga0466958_0254738 Ga0466958_0254738_27_914 281
42 3300044656 Ga0466969_0039451 Ga0466969_0039451_779_1666 286
43 3300044684 Ga0466966_0003709 Ga0466966_0003709_8920_9807 286
44 3300044693 Ga0466961_0029514 Ga0466961_0029514_685_1572 286
45 3300044719 Ga0466971_0014596 Ga0466971_0014596_2127_3014 286
46 3300044765 Ga0466970_0001142 Ga0466970_0001142_4446_5333 286
47 3300044842 Ga0466957_0008413 Ga0466957_0008413_513_1400 286
48 3300045049 Ga0466959_0110958 Ga0466959_0110958_395_1282 286
49 3300045836 Ga0466958_0000291 Ga0466958_0000291_7265_8152 286
50 3300061719 Ga0466962_0002330 Ga0466962_0002330_2789_3676 286
51 3300021388 Ga0213875_10020399 Ga0213875_100203994 287
52 3300037853 Ga0436364_0089743 Ga0436364_0089743_11344_12231 287
53 3300005327 Ga0070658_10306175 Ga0070658_103061752 289
54 3300025909 Ga0207705_10197535 Ga0207705_101975352 289
55 iso_pu_bacteria 2524023205 2524442918 290
56 iso_pu_bacteria 2744054633 2745082621 290
57 iso_pu_bacteria 2876761206 2876765283 290
58 3300053078 Ga0495612_0041992 Ga0495612_0041992_521_1411 294
59 2162886012 MBSR1b_contig_8754477 MBSR1b_0101.00000990 295
60 3300001904 JGI24736J21556_1004038 JGI24736J21556_10040383 295
61 3300001989 JGI24739J22299_10000097 JGI24739J22299_1000009717 295
62 3300001990 JGI24737J22298_10000037 JGI24737J22298_1000003734 295
63 3300001990 JGI24737J22298_10000930 JGI24737J22298_100009303 295
64 3300001990 JGI24737J22298_10033425 JGI24737J22298_100334253 295
65 3300002067 JGI24735J21928_10037844 JGI24735J21928_100378442 295
66 3300002075 JGI24738J21930_10000023 JGI24738J21930_1000002313 295
67 3300005293 Ga0065715_10095614 Ga0065715_100956145 295
68 3300005327 Ga0070658_10000377 Ga0070658_1000037735 295
69 3300005327 Ga0070658_10020877 Ga0070658_100208775 295
70 3300005327 Ga0070658_10091831 Ga0070658_100918313 295
71 3300005327 Ga0070658_10109501 Ga0070658_101095013 295
72 3300005327 Ga0070658_10116380 Ga0070658_101163802 295
73 3300005327 Ga0070658_10119188 Ga0070658_101191883 295
74 3300005328 Ga0070676_10104483 Ga0070676_101044833 295
75 3300005329 Ga0070683_100001819 Ga0070683_10000181914 295
76 3300005329 Ga0070683_100039504 Ga0070683_1000395043 295
77 3300005329 Ga0070683_100228118 Ga0070683_1002281183 295
78 3300005331 Ga0070670_100003109 Ga0070670_10000310911 295
79 3300005331 Ga0070670_100003400 Ga0070670_1000034009 295
80 3300005331 Ga0070670_100042597 Ga0070670_1000425974 295
81 3300005331 Ga0070670_100159246 Ga0070670_1001592462 295
82 3300005331 Ga0070670_100395907 Ga0070670_1003959071 295
83 3300005333 Ga0070677_10008918 Ga0070677_100089184 295
84 3300005333 Ga0070677_10047425 Ga0070677_100474252 295
85 3300005335 Ga0070666_10000779 Ga0070666_1000077915 295
86 3300005335 Ga0070666_10005953 Ga0070666_100059538 295
87 3300005335 Ga0070666_10024629 Ga0070666_100246292 295
88 3300005337 Ga0070682_100006873 Ga0070682_1000068734 295
89 3300005338 Ga0068868_100000259 Ga0068868_1000002597 295
90 3300005338 Ga0068868_100015245 Ga0068868_1000152457 295
91 3300005338 Ga0068868_100061889 Ga0068868_1000618892 295
92 3300005339 Ga0070660_100000986 Ga0070660_1000009864 295
93 3300005339 Ga0070660_100058544 Ga0070660_1000585443 295
94 3300005339 Ga0070660_100081729 Ga0070660_1000817292 295
95 3300005339 Ga0070660_100171964 Ga0070660_1001719642 295
96 3300005340 Ga0070689_100028985 Ga0070689_1000289852 295
97 3300005340 Ga0070689_100158173 Ga0070689_1001581733 295
98 3300005344 Ga0070661_100000187 Ga0070661_10000018735 295
99 3300005344 Ga0070661_100004695 Ga0070661_10000469512 295
100 3300005344 Ga0070661_100011962 Ga0070661_1000119627 295
101 3300005344 Ga0070661_100072913 Ga0070661_1000729133 295
102 3300005344 Ga0070661_100165569 Ga0070661_1001655693 295
103 3300005344 Ga0070661_100209843 Ga0070661_1002098432 295
104 3300005344 Ga0070661_100224334 Ga0070661_1002243342 295
105 3300005345 Ga0070692_10034116 Ga0070692_100341162 295
106 3300005345 Ga0070692_10057624 Ga0070692_100576242 295
107 3300005347 Ga0070668_100035371 Ga0070668_1000353714 295
108 3300005353 Ga0070669_100000174 Ga0070669_10000017423 295
109 3300005353 Ga0070669_100033518 Ga0070669_1000335184 295
110 3300005353 Ga0070669_100131253 Ga0070669_1001312532 295
111 3300005353 Ga0070669_100164872 Ga0070669_1001648722 295
112 3300005354 Ga0070675_100002370 Ga0070675_10000237010 295
113 3300005354 Ga0070675_100010543 Ga0070675_1000105434 295
114 3300005354 Ga0070675_100102492 Ga0070675_1001024923 295
115 3300005355 Ga0070671_100001282 Ga0070671_10000128226 295
116 3300005355 Ga0070671_100029886 Ga0070671_1000298862 295
117 3300005355 Ga0070671_100054381 Ga0070671_1000543812 295
118 3300005355 Ga0070671_100128547 Ga0070671_1001285473 295
119 3300005356 Ga0070674_100007200 Ga0070674_1000072003 295
120 3300005356 Ga0070674_100161329 Ga0070674_1001613291 295
121 3300005356 Ga0070674_100168299 Ga0070674_1001682992 295
122 3300005364 Ga0070673_100000337 Ga0070673_10000033717 295
123 3300005364 Ga0070673_100010120 Ga0070673_1000101204 295
124 3300005364 Ga0070673_100011732 Ga0070673_1000117324 295
125 3300005364 Ga0070673_100031597 Ga0070673_1000315973 295
126 3300005366 Ga0070659_100000191 Ga0070659_10000019115 295
127 3300005366 Ga0070659_100000674 Ga0070659_10000067420 295
128 3300005366 Ga0070659_100028122 Ga0070659_1000281225 295
129 3300005366 Ga0070659_100039493 Ga0070659_1000394934 295
130 3300005366 Ga0070659_100052281 Ga0070659_1000522814 295
131 3300005366 Ga0070659_100141643 Ga0070659_1001416432 295
132 3300005366 Ga0070659_100183630 Ga0070659_1001836302 295
133 3300005366 Ga0070659_100209052 Ga0070659_1002090521 295
134 3300005366 Ga0070659_100212634 Ga0070659_1002126342 295
135 3300005367 Ga0070667_100001311 Ga0070667_1000013113 295
136 3300005367 Ga0070667_100003559 Ga0070667_1000035594 295
137 3300005367 Ga0070667_100011671 Ga0070667_1000116718 295
138 3300005367 Ga0070667_100263107 Ga0070667_1002631072 295
139 3300005367 Ga0070667_100300977 Ga0070667_1003009772 295
140 3300005435 Ga0070714_100055739 Ga0070714_1000557393 295
141 3300005435 Ga0070714_100065718 Ga0070714_1000657184 295
142 3300005455 Ga0070663_100000754 Ga0070663_1000007541 295
143 3300005455 Ga0070663_100029193 Ga0070663_1000291932 295
144 3300005455 Ga0070663_100077044 Ga0070663_1000770442 295
145 3300005455 Ga0070663_100108487 Ga0070663_1001084873 295
146 3300005455 Ga0070663_100110707 Ga0070663_1001107072 295
147 3300005455 Ga0070663_100128264 Ga0070663_1001282642 295
148 3300005457 Ga0070662_100000012 Ga0070662_10000001238 295
149 3300005457 Ga0070662_100001658 Ga0070662_1000016584 295
150 3300005457 Ga0070662_100004211 Ga0070662_10000421117 295
151 3300005457 Ga0070662_100005641 Ga0070662_1000056412 295
152 3300005457 Ga0070662_100007787 Ga0070662_1000077878 295
153 3300005457 Ga0070662_100122185 Ga0070662_1001221851 295
154 3300005459 Ga0068867_100006572 Ga0068867_1000065725 295
155 3300005459 Ga0068867_100008577 Ga0068867_1000085771 295
156 3300005459 Ga0068867_100214457 Ga0068867_1002144572 295
157 3300005466 Ga0070685_10068101 Ga0070685_100681013 295
158 3300005530 Ga0070679_100162601 Ga0070679_1001626012 295
159 3300005530 Ga0070679_100522698 Ga0070679_1005226981 295
160 3300005535 Ga0070684_100003278 Ga0070684_10000327813 295
161 3300005535 Ga0070684_100009174 Ga0070684_1000091746 295
162 3300005535 Ga0070684_100107569 Ga0070684_1001075693 295
163 3300005539 Ga0068853_100000032 Ga0068853_10000003287 295
164 3300005539 Ga0068853_100000811 Ga0068853_10000081127 295
165 3300005539 Ga0068853_100311023 Ga0068853_1003110231 295
166 3300005543 Ga0070672_100000945 Ga0070672_10000094516 295
167 3300005543 Ga0070672_100004830 Ga0070672_1000048304 295
168 3300005544 Ga0070686_100032521 Ga0070686_1000325213 295
169 3300005547 Ga0070693_100000332 Ga0070693_10000033210 295
170 3300005548 Ga0070665_100021059 Ga0070665_1000210599 295
171 3300005548 Ga0070665_100031747 Ga0070665_1000317477 295
172 3300005548 Ga0070665_100104758 Ga0070665_1001047582 295
173 3300005563 Ga0068855_100000591 Ga0068855_10000059111 295
174 3300005563 Ga0068855_100003900 Ga0068855_10000390025 295
175 3300005564 Ga0070664_100000187 Ga0070664_10000018726 295
176 3300005564 Ga0070664_100001469 Ga0070664_10000146922 295
177 3300005564 Ga0070664_100012642 Ga0070664_1000126426 295
178 3300005564 Ga0070664_100039187 Ga0070664_1000391872 295
179 3300005564 Ga0070664_100159072 Ga0070664_1001590723 295
180 3300005564 Ga0070664_100321093 Ga0070664_1003210932 295
181 3300005577 Ga0068857_100004021 Ga0068857_1000040214 295
182 3300005577 Ga0068857_100034073 Ga0068857_1000340736 295
183 3300005577 Ga0068857_100078693 Ga0068857_1000786933 295
184 3300005578 Ga0068854_100000664 Ga0068854_1000006643 295
185 3300005578 Ga0068854_100025831 Ga0068854_1000258313 295
186 3300005578 Ga0068854_100491376 Ga0068854_1004913761 295
187 3300005614 Ga0068856_100000291 Ga0068856_10000029135 295
188 3300005614 Ga0068856_100013426 Ga0068856_1000134267 295
189 3300005614 Ga0068856_100100639 Ga0068856_1001006393 295
190 3300005614 Ga0068856_100124219 Ga0068856_1001242192 295
191 3300005614 Ga0068856_100156559 Ga0068856_1001565592 295
192 3300005616 Ga0068852_100000906 Ga0068852_10000090611 295
193 3300005616 Ga0068852_100102337 Ga0068852_1001023373 295
194 3300005616 Ga0068852_100104429 Ga0068852_1001044293 295
195 3300005616 Ga0068852_100141397 Ga0068852_1001413972 295
196 3300005616 Ga0068852_100325452 Ga0068852_1003254522 295
197 3300005617 Ga0068859_100002786 Ga0068859_10000278614 295
198 3300005618 Ga0068864_100002633 Ga0068864_10000263320 295
199 3300005618 Ga0068864_100224571 Ga0068864_1002245712 295
200 3300005718 Ga0068866_10098458 Ga0068866_100984582 295
201 3300005719 Ga0068861_100027898 Ga0068861_1000278984 295
202 3300005719 Ga0068861_100264410 Ga0068861_1002644103 295
203 3300005834 Ga0068851_10022469 Ga0068851_100224693 295
204 3300005834 Ga0068851_10042459 Ga0068851_100424592 295
205 3300005841 Ga0068863_100002317 Ga0068863_10000231715 295
206 3300005842 Ga0068858_100000620 Ga0068858_10000062018 295
207 3300005842 Ga0068858_100009881 Ga0068858_1000098819 295
208 3300005843 Ga0068860_100003524 Ga0068860_1000035248 295
209 3300006931 Ga0097620_100002786 Ga0097620_10000278614 295
210 3300009093 Ga0105240_10048201 Ga0105240_100482012 295
211 3300009093 Ga0105240_10152373 Ga0105240_101523733 295
212 3300009093 Ga0105240_10221098 Ga0105240_102210982 295
213 3300009093 Ga0105240_10481935 Ga0105240_104819352 295
214 3300009098 Ga0105245_10000229 Ga0105245_1000022927 295
215 3300009098 Ga0105245_10023282 Ga0105245_100232827 295
216 3300009098 Ga0105245_10198795 Ga0105245_101987953 295
217 3300009101 Ga0105247_10237929 Ga0105247_102379292 295
218 3300009148 Ga0105243_10030827 Ga0105243_100308273 295
219 3300009174 Ga0105241_10109553 Ga0105241_101095533 295
220 3300009174 Ga0105241_10236893 Ga0105241_102368933 295
221 3300009177 Ga0105248_10000083 Ga0105248_1000008382 295
222 3300009177 Ga0105248_10000790 Ga0105248_1000079013 295
223 3300009177 Ga0105248_10001634 Ga0105248_100016343 295
224 3300009177 Ga0105248_10003127 Ga0105248_1000312712 295
225 3300009177 Ga0105248_10011959 Ga0105248_1001195914 295
226 3300009177 Ga0105248_10023944 Ga0105248_100239442 295
227 3300009551 Ga0105238_10024793 Ga0105238_100247937 295
228 3300010375 Ga0105239_10221754 Ga0105239_102217542 295
229 3300011119 Ga0105246_10006237 Ga0105246_100062372 295
230 3300013100 Ga0157373_10071086 Ga0157373_100710864 295
231 3300013100 Ga0157373_10087945 Ga0157373_100879453 295
232 3300013100 Ga0157373_10089370 Ga0157373_100893702 295
233 3300013100 Ga0157373_10100314 Ga0157373_101003142 295
234 3300013100 Ga0157373_10169372 Ga0157373_101693722 295
235 3300013102 Ga0157371_10000756 Ga0157371_1000075633 295
236 3300013102 Ga0157371_10009514 Ga0157371_100095142 295
237 3300013102 Ga0157371_10024460 Ga0157371_100244605 295
238 3300013102 Ga0157371_10070421 Ga0157371_100704212 295
239 3300013102 Ga0157371_10347565 Ga0157371_103475652 295
240 3300013104 Ga0157370_10150712 Ga0157370_101507123 295
241 3300013105 Ga0157369_10000137 Ga0157369_1000013798 295
242 3300013105 Ga0157369_10007204 Ga0157369_1000720412 295
243 3300013105 Ga0157369_10019245 Ga0157369_100192453 295
244 3300013105 Ga0157369_10042284 Ga0157369_100422841 295
245 3300013105 Ga0157369_10049779 Ga0157369_100497794 295
246 3300013105 Ga0157369_10084813 Ga0157369_100848132 295
247 3300013105 Ga0157369_10224048 Ga0157369_102240483 295
248 3300013296 Ga0157374_10090171 Ga0157374_100901713 295
249 3300013296 Ga0157374_10219149 Ga0157374_102191493 295
250 3300013296 Ga0157374_10505694 Ga0157374_105056941 295
251 3300013297 Ga0157378_10000154 Ga0157378_1000015438 295
252 3300013297 Ga0157378_10191875 Ga0157378_101918753 295
253 3300013307 Ga0157372_10379691 Ga0157372_103796912 295
254 3300013307 Ga0157372_10454013 Ga0157372_104540132 295
255 3300013308 Ga0157375_10200197 Ga0157375_102001973 295
256 3300013308 Ga0157375_10403985 Ga0157375_104039852 295
257 3300014325 Ga0163163_10001064 Ga0163163_100010648 295
258 3300014497 Ga0182008_10222246 Ga0182008_102222461 295
259 3300020082 Ga0206353_11586731 Ga0206353_115867311 295
260 3300025290 Ga0207673_1007899 Ga0207673_10078992 295
261 3300025315 Ga0207697_10000187 Ga0207697_1000018733 295
262 3300025321 Ga0207656_10001253 Ga0207656_100012535 295
263 3300025321 Ga0207656_10054507 Ga0207656_100545072 295
264 3300025893 Ga0207682_10059230 Ga0207682_100592302 295
265 3300025901 Ga0207688_10000595 Ga0207688_1000059527 295
266 3300025903 Ga0207680_10002585 Ga0207680_100025858 295
267 3300025903 Ga0207680_10134016 Ga0207680_101340162 295
268 3300025904 Ga0207647_10000090 Ga0207647_1000009027 295
269 3300025904 Ga0207647_10012986 Ga0207647_100129862 295
270 3300025904 Ga0207647_10028131 Ga0207647_100281313 295
271 3300025904 Ga0207647_10047898 Ga0207647_100478983 295
272 3300025907 Ga0207645_10012721 Ga0207645_100127214 295
273 3300025907 Ga0207645_10031056 Ga0207645_100310563 295
274 3300025907 Ga0207645_10096039 Ga0207645_100960392 295
275 3300025909 Ga0207705_10000030 Ga0207705_10000030210 295
276 3300025909 Ga0207705_10000072 Ga0207705_1000007287 295
277 3300025909 Ga0207705_10010411 Ga0207705_100104114 295
278 3300025909 Ga0207705_10011473 Ga0207705_100114733 295
279 3300025909 Ga0207705_10023019 Ga0207705_100230192 295
280 3300025909 Ga0207705_10031771 Ga0207705_100317713 295
281 3300025909 Ga0207705_10095609 Ga0207705_100956093 295
282 3300025909 Ga0207705_10175862 Ga0207705_101758622 295
283 3300025913 Ga0207695_10014730 Ga0207695_100147307 295
284 3300025913 Ga0207695_10036058 Ga0207695_100360586 295
285 3300025913 Ga0207695_10157091 Ga0207695_101570911 295
286 3300025919 Ga0207657_10000176 Ga0207657_1000017638 295
287 3300025919 Ga0207657_10002682 Ga0207657_100026824 295
288 3300025919 Ga0207657_10007866 Ga0207657_100078667 295
289 3300025919 Ga0207657_10014374 Ga0207657_100143745 295
290 3300025919 Ga0207657_10014766 Ga0207657_100147663 295
291 3300025919 Ga0207657_10018127 Ga0207657_100181273 295
292 3300025919 Ga0207657_10020297 Ga0207657_100202976 295
293 3300025919 Ga0207657_10140627 Ga0207657_101406273 295
294 3300025920 Ga0207649_10000810 Ga0207649_1000081017 295
295 3300025920 Ga0207649_10004374 Ga0207649_100043745 295
296 3300025920 Ga0207649_10006147 Ga0207649_100061477 295
297 3300025920 Ga0207649_10016042 Ga0207649_100160424 295
298 3300025920 Ga0207649_10046477 Ga0207649_100464773 295
299 3300025920 Ga0207649_10068215 Ga0207649_100682153 295
300 3300025920 Ga0207649_10075884 Ga0207649_100758842 295
301 3300025920 Ga0207649_10083466 Ga0207649_100834663 295
302 3300025921 Ga0207652_10003111 Ga0207652_100031116 295
303 3300025923 Ga0207681_10005702 Ga0207681_100057028 295
304 3300025923 Ga0207681_10146085 Ga0207681_101460852 295
305 3300025923 Ga0207681_10167103 Ga0207681_101671032 295
306 3300025924 Ga0207694_10036262 Ga0207694_100362624 295
307 3300025925 Ga0207650_10005079 Ga0207650_100050799 295
308 3300025925 Ga0207650_10016751 Ga0207650_100167513 295
309 3300025925 Ga0207650_10034652 Ga0207650_100346524 295
310 3300025925 Ga0207650_10251182 Ga0207650_102511822 295
311 3300025926 Ga0207659_10007264 Ga0207659_100072644 295
312 3300025926 Ga0207659_10012137 Ga0207659_100121374 295
313 3300025926 Ga0207659_10138795 Ga0207659_101387952 295
314 3300025927 Ga0207687_10001063 Ga0207687_1000106310 295
315 3300025927 Ga0207687_10012657 Ga0207687_100126577 295
316 3300025929 Ga0207664_10079535 Ga0207664_100795353 295
317 3300025929 Ga0207664_10184904 Ga0207664_101849043 295
318 3300025931 Ga0207644_10005196 Ga0207644_100051964 295
319 3300025931 Ga0207644_10015754 Ga0207644_100157544 295
320 3300025931 Ga0207644_10018835 Ga0207644_100188354 295
321 3300025931 Ga0207644_10105072 Ga0207644_101050722 295
322 3300025931 Ga0207644_10106168 Ga0207644_101061683 295
323 3300025931 Ga0207644_10125658 Ga0207644_101256582 295
324 3300025931 Ga0207644_10141283 Ga0207644_101412831 295
325 3300025932 Ga0207690_10000245 Ga0207690_1000024519 295
326 3300025932 Ga0207690_10005573 Ga0207690_100055735 295
327 3300025932 Ga0207690_10014951 Ga0207690_100149515 295
328 3300025932 Ga0207690_10055336 Ga0207690_100553363 295
329 3300025932 Ga0207690_10109546 Ga0207690_101095463 295
330 3300025932 Ga0207690_10133771 Ga0207690_101337712 295
331 3300025932 Ga0207690_10189570 Ga0207690_101895702 295
332 3300025932 Ga0207690_10198959 Ga0207690_101989592 295
333 3300025932 Ga0207690_10439908 Ga0207690_104399081 295
334 3300025933 Ga0207706_10000041 Ga0207706_1000004188 295
335 3300025933 Ga0207706_10001429 Ga0207706_1000142927 295
336 3300025933 Ga0207706_10003596 Ga0207706_1000359611 295
337 3300025933 Ga0207706_10011213 Ga0207706_1001121315 295
338 3300025933 Ga0207706_10011368 Ga0207706_1001136813 295
339 3300025933 Ga0207706_10059459 Ga0207706_100594595 295
340 3300025933 Ga0207706_10082581 Ga0207706_100825814 295
341 3300025933 Ga0207706_10321123 Ga0207706_103211232 295
342 3300025937 Ga0207669_10022495 Ga0207669_100224953 295
343 3300025937 Ga0207669_10097778 Ga0207669_100977783 295
344 3300025937 Ga0207669_10179077 Ga0207669_101790772 295
345 3300025940 Ga0207691_10000045 Ga0207691_1000004597 295
346 3300025940 Ga0207691_10005139 Ga0207691_1000513919 295
347 3300025940 Ga0207691_10128425 Ga0207691_101284252 295
348 3300025941 Ga0207711_10001311 Ga0207711_100013114 295
349 3300025941 Ga0207711_10001677 Ga0207711_1000167712 295
350 3300025941 Ga0207711_10002858 Ga0207711_100028587 295
351 3300025941 Ga0207711_10003863 Ga0207711_100038637 295
352 3300025941 Ga0207711_10009533 Ga0207711_100095334 295
353 3300025942 Ga0207689_10000226 Ga0207689_1000022627 295
354 3300025944 Ga0207661_10000953 Ga0207661_1000095314 295
355 3300025944 Ga0207661_10005783 Ga0207661_100057836 295
356 3300025944 Ga0207661_10043965 Ga0207661_100439654 295
357 3300025944 Ga0207661_10084033 Ga0207661_100840333 295
358 3300025945 Ga0207679_10000243 Ga0207679_1000024330 295
359 3300025945 Ga0207679_10008060 Ga0207679_100080606 295
360 3300025945 Ga0207679_10112309 Ga0207679_101123093 295
361 3300025949 Ga0207667_10006092 Ga0207667_1000609211 295
362 3300025949 Ga0207667_10063634 Ga0207667_100636344 295
363 3300025949 Ga0207667_10201249 Ga0207667_102012493 295
364 3300025949 Ga0207667_10228513 Ga0207667_102285132 295
365 3300025960 Ga0207651_10000494 Ga0207651_1000049416 295
366 3300025960 Ga0207651_10013969 Ga0207651_100139694 295
367 3300025960 Ga0207651_10034105 Ga0207651_100341053 295
368 3300025960 Ga0207651_10076825 Ga0207651_100768253 295
369 3300025972 Ga0207668_10027591 Ga0207668_100275913 295
370 3300025972 Ga0207668_10060121 Ga0207668_100601214 295
371 3300025972 Ga0207668_10315338 Ga0207668_103153382 295
372 3300025981 Ga0207640_10004637 Ga0207640_100046378 295
373 3300025981 Ga0207640_10124709 Ga0207640_101247093 295
374 3300025986 Ga0207658_10004807 Ga0207658_100048074 295
375 3300025986 Ga0207658_10008814 Ga0207658_100088142 295
376 3300025986 Ga0207658_10174315 Ga0207658_101743153 295
377 3300025986 Ga0207658_10353257 Ga0207658_103532572 295
378 3300025986 Ga0207658_10462448 Ga0207658_104624482 295
379 3300026023 Ga0207677_10003117 Ga0207677_100031177 295
380 3300026023 Ga0207677_10018354 Ga0207677_100183544 295
381 3300026023 Ga0207677_10143483 Ga0207677_101434832 295
382 3300026023 Ga0207677_10190567 Ga0207677_101905673 295
383 3300026035 Ga0207703_10002105 Ga0207703_1000210513 295
384 3300026035 Ga0207703_10002663 Ga0207703_100026633 295
385 3300026041 Ga0207639_10000222 Ga0207639_100002228 295
386 3300026041 Ga0207639_10006140 Ga0207639_1000614010 295
387 3300026041 Ga0207639_10033533 Ga0207639_100335334 295
388 3300026067 Ga0207678_10004584 Ga0207678_100045844 295
389 3300026067 Ga0207678_10004795 Ga0207678_100047959 295
390 3300026067 Ga0207678_10009690 Ga0207678_100096908 295
391 3300026067 Ga0207678_10021513 Ga0207678_100215136 295
392 3300026067 Ga0207678_10039637 Ga0207678_100396373 295
393 3300026067 Ga0207678_10056947 Ga0207678_100569472 295
394 3300026067 Ga0207678_10087759 Ga0207678_100877593 295
395 3300026067 Ga0207678_10100749 Ga0207678_101007493 295
396 3300026067 Ga0207678_10181336 Ga0207678_101813362 295
397 3300026078 Ga0207702_10000074 Ga0207702_1000007424 295
398 3300026078 Ga0207702_10044382 Ga0207702_100443824 295
399 3300026078 Ga0207702_10245637 Ga0207702_102456372 295
400 3300026078 Ga0207702_10467518 Ga0207702_104675182 295
401 3300026078 Ga0207702_10543802 Ga0207702_105438022 295
402 3300026088 Ga0207641_10024907 Ga0207641_100249073 295
403 3300026089 Ga0207648_10002102 Ga0207648_100021026 295
404 3300026089 Ga0207648_10008748 Ga0207648_100087488 295
405 3300026089 Ga0207648_10222877 Ga0207648_102228772 295
406 3300026095 Ga0207676_10001193 Ga0207676_100011938 295
407 3300026095 Ga0207676_10005397 Ga0207676_100053974 295
408 3300026095 Ga0207676_10007462 Ga0207676_100074624 295
409 3300026095 Ga0207676_10030129 Ga0207676_100301294 295
410 3300026116 Ga0207674_10000531 Ga0207674_1000053118 295
411 3300026116 Ga0207674_10030221 Ga0207674_100302213 295
412 3300026116 Ga0207674_10125058 Ga0207674_101250582 295
413 3300026116 Ga0207674_10127106 Ga0207674_101271062 295
414 3300026118 Ga0207675_100044742 Ga0207675_1000447424 295
415 3300026118 Ga0207675_100075063 Ga0207675_1000750634 295
416 3300026142 Ga0207698_10000892 Ga0207698_1000089213 295
417 3300026142 Ga0207698_10031124 Ga0207698_100311242 295
418 3300026142 Ga0207698_10089400 Ga0207698_100894003 295
419 3300026142 Ga0207698_10412655 Ga0207698_104126552 295
420 3300028379 Ga0268266_10049829 Ga0268266_100498292 295
421 3300028379 Ga0268266_10055274 Ga0268266_100552744 295
422 3300028380 Ga0268265_10501880 Ga0268265_105018802 295
423 3300028381 Ga0268264_10147803 Ga0268264_101478033 295
424 3300031548 Ga0307408_100047429 Ga0307408_1000474293 295
425 3300031548 Ga0307408_100077095 Ga0307408_1000770953 295
426 3300031548 Ga0307408_100365071 Ga0307408_1003650711 295
427 3300031731 Ga0307405_10017948 Ga0307405_100179482 295
428 3300031731 Ga0307405_10026183 Ga0307405_100261834 295
429 3300031731 Ga0307405_10100468 Ga0307405_101004682 295
430 3300031731 Ga0307405_10103982 Ga0307405_101039822 295
431 3300031731 Ga0307405_10118105 Ga0307405_101181052 295
432 3300031824 Ga0307413_10003433 Ga0307413_100034332 295
433 3300031824 Ga0307413_10004014 Ga0307413_100040144 295
434 3300031824 Ga0307413_10099590 Ga0307413_100995902 295
435 3300031852 Ga0307410_10005046 Ga0307410_100050467 295
436 3300031852 Ga0307410_10067429 Ga0307410_100674292 295
437 3300031901 Ga0307406_10028024 Ga0307406_100280241 295
438 3300031901 Ga0307406_10077785 Ga0307406_100777853 295
439 3300031901 Ga0307406_10079032 Ga0307406_100790322 295
440 3300031901 Ga0307406_10170289 Ga0307406_101702892 295
441 3300031903 Ga0307407_10039617 Ga0307407_100396172 295
442 3300031903 Ga0307407_10060018 Ga0307407_100600183 295
443 3300031903 Ga0307407_10130786 Ga0307407_101307862 295
444 3300031911 Ga0307412_10011180 Ga0307412_100111803 295
445 3300031911 Ga0307412_10020171 Ga0307412_100201714 295
446 3300031911 Ga0307412_10120115 Ga0307412_101201153 295
447 3300031911 Ga0307412_10205605 Ga0307412_102056052 295
448 3300031995 Ga0307409_100071473 Ga0307409_1000714734 295
449 3300031995 Ga0307409_100129968 Ga0307409_1001299682 295
450 3300031995 Ga0307409_100181339 Ga0307409_1001813391 295
451 3300031995 Ga0307409_100287227 Ga0307409_1002872273 295
452 3300031995 Ga0307409_100289801 Ga0307409_1002898012 295
453 3300031995 Ga0307409_100436012 Ga0307409_1004360122 295
454 3300032002 Ga0307416_100014929 Ga0307416_1000149293 295
455 3300032002 Ga0307416_100169776 Ga0307416_1001697763 295
456 3300032002 Ga0307416_100546920 Ga0307416_1005469202 295
457 3300032004 Ga0307414_10020483 Ga0307414_100204832 295
458 3300032004 Ga0307414_10037658 Ga0307414_100376583 295
459 3300032004 Ga0307414_10069861 Ga0307414_100698614 295
460 3300032004 Ga0307414_10099666 Ga0307414_100996662 295
461 3300032004 Ga0307414_10243286 Ga0307414_102432862 295
462 3300032005 Ga0307411_10016425 Ga0307411_100164255 295
463 3300032005 Ga0307411_10018606 Ga0307411_100186065 295
464 3300032126 Ga0307415_100039909 Ga0307415_1000399093 295
465 3300032126 Ga0307415_100197213 Ga0307415_1001972132 295
466 3300035170 Ga0373943_0029916 Ga0373943_0029916_85_972 295
467 3300035172 Ga0373955_0247488 Ga0373955_0247488_159_1046 295
468 3300035691 Ga0373931_0052464 Ga0373931_0052464_992_1879 295
469 3300035692 Ga0373935_0252100 Ga0373935_0252100_333_1220 295
470 3300035724 Ga0373933_0031583 Ga0373933_0031583_716_1603 295
471 3300037068 Ga0373925_0044348 Ga0373925_0044348_19_906 295
472 3300037312 Ga0395899_0000302 Ga0395899_0000302_27492_28379 295
473 3300037312 Ga0395899_0017613 Ga0395899_0017613_93_980 295
474 3300037312 Ga0395899_0019434 Ga0395899_0019434_2902_3789 295
475 3300037312 Ga0395899_0032366 Ga0395899_0032366_2809_3696 295
476 3300037312 Ga0395899_0044714 Ga0395899_0044714_1834_2721 295
477 3300037312 Ga0395899_0046829 Ga0395899_0046829_1243_2130 295
478 3300037312 Ga0395899_0053011 Ga0395899_0053011_447_1334 295
479 3300037312 Ga0395899_0090094 Ga0395899_0090094_307_1194 295
480 3300037312 Ga0395899_0122093 Ga0395899_0122093_217_1104 295
481 3300037312 Ga0395899_0123975 Ga0395899_0123975_837_1724 295
482 3300037312 Ga0395899_0193215 Ga0395899_0193215_136_1023 295
483 3300037312 Ga0395899_0233293 Ga0395899_0233293_132_1019 295
484 3300037418 Ga0395900_0000997 Ga0395900_0000997_21512_22399 295
485 3300037418 Ga0395900_0002684 Ga0395900_0002684_15238_16125 295
486 3300037418 Ga0395900_0007283 Ga0395900_0007283_1671_2558 295
487 3300037418 Ga0395900_0009267 Ga0395900_0009267_7308_8195 295
488 3300037418 Ga0395900_0017664 Ga0395900_0017664_3067_3954 295
489 3300037418 Ga0395900_0023580 Ga0395900_0023580_4461_5348 295
490 3300037418 Ga0395900_0027388 Ga0395900_0027388_4141_5028 295
491 3300037418 Ga0395900_0166059 Ga0395900_0166059_752_1639 295
492 3300037418 Ga0395900_0237224 Ga0395900_0237224_890_1777 295
493 3300037418 Ga0395900_0275376 Ga0395900_0275376_89_976 295
494 3300037418 Ga0395900_0383731 Ga0395900_0383731_139_1026 295
495 3300037418 Ga0395900_0427317 Ga0395900_0427317_204_1091 295
496 3300037418 Ga0395900_0594746 Ga0395900_0594746_106_993 295
497 3300037466 Ga0395898_0000054 Ga0395898_0000054_74826_75713 295
498 3300037466 Ga0395898_0014768 Ga0395898_0014768_314_1201 295
499 3300037466 Ga0395898_0051732 Ga0395898_0051732_1037_1924 295
500 3300037466 Ga0395898_0053971 Ga0395898_0053971_2190_3077 295
501 3300037466 Ga0395898_0054496 Ga0395898_0054496_1960_2847 295
502 3300037466 Ga0395898_0085987 Ga0395898_0085987_229_1116 295
503 3300037466 Ga0395898_0193645 Ga0395898_0193645_327_1214 295
504 3300037471 Ga0395905_0000046 Ga0395905_0000046_35832_36719 295
505 3300037471 Ga0395905_0001164 Ga0395905_0001164_14357_15244 295
506 3300037471 Ga0395905_0043817 Ga0395905_0043817_1083_1970 295
507 3300037471 Ga0395905_0047368 Ga0395905_0047368_1426_2313 295
508 3300037471 Ga0395905_0084641 Ga0395905_0084641_847_1734 295
509 3300037471 Ga0395905_0129196 Ga0395905_0129196_941_1828 295
510 3300037471 Ga0395905_0373048 Ga0395905_0373048_349_1236 295
511 3300038443 Ga0395901_0000086 Ga0395901_0000086_8628_9515 295
512 3300038443 Ga0395901_0000516 Ga0395901_0000516_28439_29326 295
513 3300038443 Ga0395901_0002142 Ga0395901_0002142_17703_18590 295
514 3300038443 Ga0395901_0004461 Ga0395901_0004461_8038_8925 295
515 3300038443 Ga0395901_0007579 Ga0395901_0007579_2937_3824 295
516 3300038443 Ga0395901_0027070 Ga0395901_0027070_222_1109 295
517 3300038443 Ga0395901_0041174 Ga0395901_0041174_3495_4382 295
518 3300038443 Ga0395901_0061569 Ga0395901_0061569_2806_3693 295
519 3300038443 Ga0395901_0150594 Ga0395901_0150594_1355_2242 295
520 3300038443 Ga0395901_0183756 Ga0395901_0183756_35_922 295
521 3300038443 Ga0395901_0337678 Ga0395901_0337678_403_1290 295
522 3300038443 Ga0395901_0556751 Ga0395901_0556751_203_1090 295
523 3300044684 Ga0466966_0001152 Ga0466966_0001152_5990_6877 295
524 3300044684 Ga0466966_0022621 Ga0466966_0022621_2537_3424 295
525 3300044693 Ga0466961_0041922 Ga0466961_0041922_1768_2655 295
526 3300044694 Ga0466963_0029848 Ga0466963_0029848_499_1386 295
527 3300044694 Ga0466963_0081294 Ga0466963_0081294_50_937 295
528 3300044765 Ga0466970_0002914 Ga0466970_0002914_1116_2003 295
529 3300044842 Ga0466957_0043075 Ga0466957_0043075_510_1397 295
530 3300045049 Ga0466959_0020592 Ga0466959_0020592_395_1282 295
531 3300045049 Ga0466959_0021499 Ga0466959_0021499_374_1261 295
532 3300045836 Ga0466958_0027595 Ga0466958_0027595_1212_2099 295
533 3300045836 Ga0466958_0093701 Ga0466958_0093701_667_1554 295
534 3300045836 Ga0466958_0204334 Ga0466958_0204334_45_932 295
535 3300045976 Ga0466967_0126710 Ga0466967_0126710_985_1872 295
536 3300045976 Ga0466967_0559283 Ga0466967_0559283_76_963 295
537 3300046515 Ga0495620_0099039 Ga0495620_0099039_216_1103 295
538 3300046525 Ga0495663_0061392 Ga0495663_0061392_19_906 295
539 3300046537 Ga0495598_0006299 Ga0495598_0006299_829_1716 295
540 3300046558 Ga0495633_0055753 Ga0495633_0055753_543_1430 295
541 3300046616 Ga0495668_0190935 Ga0495668_0190935_178_1065 295
542 3300046679 Ga0495623_0070991 Ga0495623_0070991_135_1022 295
543 3300046684 Ga0495669_0001170 Ga0495669_0001170_7038_7925 295
544 3300046684 Ga0495669_0009423 Ga0495669_0009423_2266_3153 295
545 3300046684 Ga0495669_0012829 Ga0495669_0012829_1597_2484 295
546 3300046684 Ga0495669_0014347 Ga0495669_0014347_747_1634 295
547 3300046684 Ga0495669_0096011 Ga0495669_0096011_17_904 295
548 3300046691 Ga0495670_0011219 Ga0495670_0011219_1982_2869 295
549 3300048088 Ga0495602_0046500 Ga0495602_0046500_2044_2931 295
550 3300048903 Ga0496100_0037411 Ga0496100_0037411_547_1434 295
551 3300048904 Ga0496101_0003378 Ga0496101_0003378_6540_7427 295
552 3300048908 Ga0496105_0099105 Ga0496105_0099105_794_1681 295
553 3300048909 Ga0496106_0050361 Ga0496106_0050361_1668_2555 295
554 3300048910 Ga0496107_0144020 Ga0496107_0144020_416_1303 295
555 3300048911 Ga0496108_0079528 Ga0496108_0079528_1846_2733 295
556 3300048912 Ga0496109_0000775 Ga0496109_0000775_3490_4377 295
557 3300048912 Ga0496109_0098706 Ga0496109_0098706_338_1225 295
558 3300048913 Ga0496110_0005805 Ga0496110_0005805_2608_3495 295
559 3300048913 Ga0496110_0012933 Ga0496110_0012933_2871_3758 295
560 3300048914 Ga0496111_0004837 Ga0496111_0004837_313_1200 295
561 3300048914 Ga0496111_0012279 Ga0496111_0012279_2512_3399 295
562 3300048915 Ga0496112_0041602 Ga0496112_0041602_2819_3706 295
563 3300048915 Ga0496112_0055685 Ga0496112_0055685_637_1524 295
564 3300048916 Ga0496113_0265737 Ga0496113_0265737_315_1202 295
565 3300048917 Ga0496114_0026396 Ga0496114_0026396_1673_2560 295
566 3300049590 Ga0501074_0044732 Ga0501074_0044732_2010_2897 295
567 3300061719 Ga0466962_0068276 Ga0466962_0068276_336_1223 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

115

278

0.98

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

6

117

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.9743 2 283
6s4f-assembly1.cif.gz_B structure of human mthfd2 in complex with th9619 0.9679 3 285
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9671 3 285
5tc4-assembly1.cif.gz_A-2 crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (mthfd2) in complex with ly345899 and cofactors 0.9671 3 285
6jid-assembly1.cif.gz_A human mthfd2 in complex with compound 1 0.9647 3 285
ID Description Score Start End Superfamily
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9982 34 114 3.40.50.10860
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9965 32 115 3.40.50.10860
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9892 14 125 3.40.50.10860
4a5oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9877 32 115 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.986 34 114 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A3B8YXV1-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 1.001 50 179 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A2S8LSJ0-F1-model_v4 deleted 0.9996 40 122
AF-A0A3D1XNB9-F1-model_v4 deleted 0.9987 41 151
AF-A0A351V733-F1-model_v4 methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) 0.9985 48 153 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A3B9UJA7-F1-model_v4 deleted 0.9982 1 174

Feature Viewer

pLDDT pTM Quality
92.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map