F464489

General Info

Members Datasets Scaffolds Average Seq Length
567 357 1134 265

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100000857|Ga0070696_10000085718
Length 301
Sequence MAETAVCGPERSTSWYAPNPKPSSQPMTTSGVVRIAAVSDVHYSKTSQGMLQSLFAQITESADVLVLAGDLTDYGLAEEARVLAKDLTASLKIPAVGVLGNHDYETGEEKEITRILQDAGVRILDGDTYEVHGVGFAGVRGFCGGFGRGALGAWGEPVIKAFVHEAITEALKLEAALARLTTEHKIAILHYAPIRETVEGEPLEIYPFLGSSRLEEPLSRFEVTAVFHGHAHKGALEGVTAKGIPVYNVSLSLLREHQKDRPPFRVLEVRAGQSRSSETDQIAERRRAGRRAEDRTSAAGG

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
295 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
307 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
308 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
309 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
310 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
324 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
331 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
332 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
335 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
338 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
339 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
340 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
345 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
346 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
347 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
348 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
349 2643221658 Variovorax sp. Root411 Isolate Unclassified
350 2643221672 Variovorax sp. Root434 Isolate Unclassified
351 2738541307 Variovorax sp. GV008 Isolate Unclassified
352 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
353 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
354 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
355 2928070936 Variovorax gossypii 1167 Isolate Unclassified
356 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
357 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.35
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.34
Nodule 0.18
Rhizoplane 2.29
Rhizosphere 78.31
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100000857 3300005546 Bacteria 19652
2 JGI24739J22299_10018622 3300001989 Bacteria 2493
3 JGI25152J39213_1000235 3300002773 Bacteria 37077
4 JGI25152J39213_1004400 3300002773 Bacteria 4442
5 JGI25150J39212_1000384 3300002774 Bacteria 21069
6 JGI25159J45721_1000103 3300002987 Bacteria 40372
7 JGI25159J45721_1006236 3300002987 Bacteria 3603
8 JGI25151J46595_10000696 3300003187 Bacteria 28239
9 JGI25151J46595_10007436 3300003187 Bacteria 5369
10 JGI25406J46586_10031756 3300003203 Unclassified 1971
11 JGI25153J46596_10000298 3300003215 Bacteria 37077
12 rootH1_10034425 3300003323 Bacteria 3555
13 JGI25160J50197_1000255 3300003354 Bacteria 40372
14 JGI25160J50197_1011191 3300003354 Bacteria 3196
15 JGI25161J50226_1000393 3300003374 Bacteria 21899
16 Ga0006562J51391_1086680 3300003578 Bacteria 1320
17 Ga0006562J51391_1102156 3300003578 Bacteria 6070
18 Ga0055526_1000357 3300003771 Bacteria 37077
19 Ga0055526_1003149 3300003771 Bacteria 10685
20 Ga0055537_1000274 3300003773 Bacteria 37077
21 Ga0055537_1006375 3300003773 Bacteria 3004
22 Ga0055524_1000400 3300003775 Bacteria 37077
23 Ga0055524_1003655 3300003775 Bacteria 7383
24 Ga0055536_1000488 3300003781 Bacteria 27544
25 Ga0055536_1002861 3300003781 Bacteria 9506
26 Ga0055534_1000255 3300003784 Bacteria 37077
27 Ga0055534_1005141 3300003784 Bacteria 3590
28 Ga0055528_1000277 3300003790 Bacteria 43644
29 Ga0055528_1013982 3300003790 Bacteria 3004
30 Ga0055530_10000110 3300003791 Bacteria 71015
31 Ga0055540_1000174 3300003792 Bacteria 63200
32 Ga0055540_1002550 3300003792 Bacteria 9494
33 Ga0055531_10000217 3300003794 Bacteria 63200
34 Ga0055531_10002120 3300003794 Bacteria 13606
35 Ga0055531_10003669 3300003794 Bacteria 9674
36 Ga0055543_1000262 3300004625 Bacteria 39412
37 Ga0055543_1000784 3300004625 Bacteria 15737
38 Ga0065165_1000494 3300005262 Bacteria 60929
39 Ga0065165_1011748 3300005262 Bacteria 3616
40 Ga0065712_10000747 3300005290 Bacteria 10305
41 Ga0070658_10004126 3300005327 Bacteria 11903
42 Ga0070658_10019104 3300005327 Bacteria 5489
43 Ga0070658_10120792 3300005327 Bacteria 2177
44 Ga0070658_10139700 3300005327 Bacteria 2023
45 Ga0070658_10170163 3300005327 Unclassified 1830
46 Ga0070676_10035330 3300005328 Bacteria 2874
47 Ga0070683_100000070 3300005329 Bacteria 71930
48 Ga0070683_100096404 3300005329 Bacteria 2782
49 Ga0070690_100383806 3300005330 Bacteria 1028
50 Ga0070670_100000058 3300005331 Bacteria 117188
51 Ga0070670_100043843 3300005331 Bacteria 3845
52 Ga0070670_100084965 3300005331 Unclassified 2719
53 Ga0070670_100539018 3300005331 Unclassified 1040
54 Ga0070677_10033897 3300005333 Bacteria 1969
55 Ga0068869_100002648 3300005334 Bacteria 10819
56 Ga0068869_100042591 3300005334 Bacteria 3255
57 Ga0070682_100000082 3300005337 Bacteria 85071
58 Ga0068868_100000626 3300005338 Bacteria 23775
59 Ga0068868_100233580 3300005338 Bacteria 1543
60 Ga0070660_100034136 3300005339 Unclassified 3842
61 Ga0070660_100098900 3300005339 Bacteria 2310
62 Ga0070689_100004514 3300005340 Bacteria 9429
63 Ga0070689_100013388 3300005340 Bacteria 5933
64 Ga0070689_100044370 3300005340 Bacteria 3420
65 Ga0070687_100005246 3300005343 Bacteria 5238
66 Ga0070687_100011870 3300005343 Bacteria 3827
67 Ga0070687_100174454 3300005343 Bacteria 1282
68 Ga0070661_100187683 3300005344 Unclassified 1575
69 Ga0070661_100427144 3300005344 Bacteria 1051
70 Ga0070692_10001210 3300005345 Bacteria 9160
71 Ga0070668_100446614 3300005347 Unclassified 1111
72 Ga0070669_100000179 3300005353 Bacteria 55254
73 Ga0070669_100001494 3300005353 Bacteria 16898
74 Ga0070669_100103728 3300005353 Bacteria 2149
75 Ga0070675_100006766 3300005354 Bacteria 8809
76 Ga0070671_100017405 3300005355 Bacteria 5821
77 Ga0070671_100188920 3300005355 Bacteria 1746
78 Ga0070674_100001957 3300005356 Bacteria 11249
79 Ga0070674_100017197 3300005356 Bacteria 4544
80 Ga0070688_100017685 3300005365 Bacteria 4095
81 Ga0070688_100022710 3300005365 Bacteria 3681
82 Ga0070688_100026396 3300005365 Bacteria 3451
83 Ga0070659_100061968 3300005366 Unclassified 2956
84 Ga0070667_100158936 3300005367 Bacteria 1989
85 Ga0070709_10000522 3300005434 Bacteria 22720
86 Ga0070709_10017377 3300005434 Bacteria 4125
87 Ga0070714_100042418 3300005435 Bacteria 3844
88 Ga0070713_100000283 3300005436 Bacteria 33501
89 Ga0070713_100050826 3300005436 Bacteria 3426
90 Ga0070713_100306809 3300005436 Bacteria 1463
91 Ga0070711_100017223 3300005439 Bacteria 4598
92 Ga0070711_100243877 3300005439 Bacteria 1406
93 Ga0070705_100448411 3300005440 Bacteria 967
94 Ga0070700_100082253 3300005441 Unclassified 2082
95 Ga0070694_100459764 3300005444 Unclassified 1006
96 Ga0070708_100622808 3300005445 Bacteria 1017
97 Ga0070678_100177858 3300005456 Bacteria 1739
98 Ga0070662_100010945 3300005457 Bacteria 5978
99 Ga0070662_100041864 3300005457 Bacteria 3270
100 Ga0070662_100402553 3300005457 Bacteria 1130
101 Ga0070681_10057184 3300005458 Bacteria 3880
102 Ga0070681_10262216 3300005458 Bacteria 1640
103 Ga0068867_100033167 3300005459 Bacteria 3738
104 Ga0068867_100212318 3300005459 Bacteria 1555
105 Ga0070685_10003767 3300005466 Bacteria 7666
106 Ga0070685_10014843 3300005466 Bacteria 4131
107 Ga0070706_100055231 3300005467 Bacteria 3666
108 Ga0070707_100010087 3300005468 Bacteria 8791
109 Ga0070698_100053151 3300005471 Bacteria 4117
110 Ga0070679_100037703 3300005530 Bacteria 4803
111 Ga0070684_100000185 3300005535 Bacteria 43124
112 Ga0070684_100005306 3300005535 Bacteria 9865
113 Ga0070684_100234625 3300005535 Unclassified 1675
114 Ga0068853_100203974 3300005539 Bacteria 1800
115 Ga0068853_100350043 3300005539 Bacteria 1374
116 Ga0070672_100005515 3300005543 Bacteria 8393
117 Ga0070672_100031997 3300005543 Bacteria 3966
118 Ga0070672_100143028 3300005543 Bacteria 1975
119 Ga0070672_100146917 3300005543 Bacteria 1948
120 Ga0070686_100034273 3300005544 Bacteria 3127
121 Ga0070695_100001161 3300005545 Bacteria 14451
122 Ga0070665_100176239 3300005548 Bacteria 2139
123 Ga0070704_100097697 3300005549 Bacteria 2205
124 Ga0068855_100090561 3300005563 Bacteria 3530
125 Ga0068855_100691883 3300005563 Bacteria 1092
126 Ga0070664_100010731 3300005564 Bacteria 7428
127 Ga0070664_100012963 3300005564 Bacteria 6782
128 Ga0068856_100275657 3300005614 Bacteria 1698
129 Ga0068852_100045996 3300005616 Bacteria 3716
130 Ga0068852_100081174 3300005616 Bacteria 2878
131 Ga0068859_100006570 3300005617 Bacteria 11800
132 Ga0068859_100265049 3300005617 Bacteria 1810
133 Ga0068864_100088322 3300005618 Bacteria 2730
134 Ga0068866_10025412 3300005718 Unclassified 2784
135 Ga0068861_100124215 3300005719 Bacteria 2086
136 Ga0068861_100459019 3300005719 Unclassified 1143
137 Ga0068863_100119705 3300005841 Bacteria 2510
138 Ga0068858_100000390 3300005842 Bacteria 45908
139 Ga0068860_100040565 3300005843 Bacteria 4448
140 Ga0068862_100011756 3300005844 Bacteria 7223
141 Ga0068862_100041958 3300005844 Bacteria 3895
142 Ga0068862_100168402 3300005844 Bacteria 1960
143 Ga0068862_100813485 3300005844 Bacteria 913
144 Ga0081455_10000063 3300005937 Bacteria 115842
145 Ga0081539_10002282 3300005985 Bacteria 27791
146 Ga0070717_10002476 3300006028 Bacteria 13038
147 Ga0070717_10550392 3300006028 Bacteria 1045
148 Ga0070716_100242138 3300006173 Bacteria 1224
149 Ga0070712_100006737 3300006175 Bacteria 7141
150 Ga0097621_100630235 3300006237 Bacteria 982
151 Ga0075370_10001294 3300006353 Bacteria 10693
152 Ga0075370_10021703 3300006353 Bacteria 3518
153 Ga0068871_100217877 3300006358 Unclassified 1653
154 Ga0075428_100235342 3300006844 Bacteria 1976
155 Ga0075431_100076318 3300006847 Bacteria 3458
156 Ga0075431_100408063 3300006847 Bacteria 1359
157 Ga0075433_10062919 3300006852 Bacteria 3250
158 Ga0075433_10392113 3300006852 Bacteria 1225
159 Ga0075434_100057226 3300006871 Bacteria 3875
160 Ga0075434_100147005 3300006871 Bacteria 2377
161 Ga0075434_100342973 3300006871 Bacteria 1515
162 Ga0075429_100039820 3300006880 Bacteria 4090
163 Ga0068865_100026516 3300006881 Bacteria 3821
164 Ga0068865_100704083 3300006881 Unclassified 863
165 Ga0075436_100011176 3300006914 Bacteria 6154
166 Ga0075436_100256138 3300006914 Bacteria 1247
167 Ga0097620_100006570 3300006931 Bacteria 11800
168 Ga0097620_100082393 3300006931 Bacteria 3260
169 Ga0097620_100265046 3300006931 Bacteria 1810
170 Ga0075435_100000133 3300007076 Bacteria 41750
171 Ga0075435_100012497 3300007076 Bacteria 6290
172 Ga0075435_100165722 3300007076 Bacteria 1863
173 Ga0105244_10000473 3300009036 Bacteria 36586
174 Ga0111539_10101607 3300009094 Bacteria 3376
175 Ga0111539_10305940 3300009094 Bacteria 1850
176 Ga0111539_10553590 3300009094 Bacteria 1340
177 Ga0105245_10000084 3300009098 Bacteria 94992
178 Ga0105245_10011933 3300009098 Bacteria 7555
179 Ga0105245_10019860 3300009098 Bacteria 5890
180 Ga0105245_10265732 3300009098 Bacteria 1671
181 Ga0114129_10065825 3300009147 Bacteria 5057
182 Ga0114129_10342929 3300009147 Bacteria 1981
183 Ga0114129_10483250 3300009147 Unclassified 1620
184 Ga0114129_11046803 3300009147 Bacteria 1025
185 Ga0105243_10003779 3300009148 Bacteria 12132
186 Ga0105243_10642642 3300009148 Bacteria 1027
187 Ga0105241_10179910 3300009174 Bacteria 1753
188 Ga0105242_10025115 3300009176 Bacteria 4711
189 Ga0105248_10021143 3300009177 Bacteria 7210
190 Ga0105248_10056875 3300009177 Bacteria 4389
191 Ga0105238_10000021 3300009551 Bacteria 207391
192 Ga0105238_10031637 3300009551 Bacteria 5386
193 Ga0105249_10033530 3300009553 Bacteria 4649
194 Ga0105249_10185653 3300009553 Bacteria 2026
195 Ga0105249_10397791 3300009553 Bacteria 1407
196 Ga0105249_10499268 3300009553 Bacteria 1262
197 Ga0105239_10388311 3300010375 Bacteria 1579
198 Ga0105246_10059073 3300011119 Bacteria 2659
199 Ga0105246_10097365 3300011119 Unclassified 2135
200 Ga0157373_10007382 3300013100 Bacteria 8181
201 Ga0157373_10025221 3300013100 Bacteria 4302
202 Ga0157371_10045190 3300013102 Unclassified 3135
203 Ga0157371_10226236 3300013102 Bacteria 1344
204 Ga0157371_10282410 3300013102 Unclassified 1199
205 Ga0157371_10503256 3300013102 Bacteria 895
206 Ga0157369_10000065 3300013105 Bacteria 144865
207 Ga0157369_10015434 3300013105 Bacteria 8609
208 Ga0157369_10092201 3300013105 Bacteria 3233
209 Ga0157369_10163324 3300013105 Bacteria 2350
210 Ga0157374_10000035 3300013296 Bacteria 180440
211 Ga0157374_10058301 3300013296 Bacteria 3608
212 Ga0157374_10797912 3300013296 Bacteria 960
213 Ga0157378_10004412 3300013297 Bacteria 12388
214 Ga0157378_10005201 3300013297 Bacteria 11422
215 Ga0163162_10114266 3300013306 Bacteria 2799
216 Ga0163162_10114828 3300013306 Bacteria 2792
217 Ga0157372_10012322 3300013307 Bacteria 9112
218 Ga0157372_10116069 3300013307 Bacteria 3069
219 Ga0157372_10208120 3300013307 Bacteria 2267
220 Ga0157372_10274598 3300013307 Bacteria 1959
221 Ga0157372_10293804 3300013307 Unclassified 1890
222 Ga0157375_10000005 3300013308 Bacteria 429412
223 Ga0157375_10000010 3300013308 Bacteria 361011
224 Ga0157375_10000092 3300013308 Bacteria 90157
225 Ga0157375_10044029 3300013308 Bacteria 4332
226 Ga0157375_10177110 3300013308 Bacteria 2283
227 Ga0157375_10435306 3300013308 Bacteria 1477
228 Ga0163163_10076551 3300014325 Bacteria 3341
229 Ga0157380_10006516 3300014326 Bacteria 8231
230 Ga0182008_10005039 3300014497 Bacteria 7596
231 Ga0182008_10007047 3300014497 Bacteria 6230
232 Ga0157377_10000007 3300014745 Bacteria 402005
233 Ga0157377_10062334 3300014745 Bacteria 2133
234 Ga0157376_10000015 3300014969 Bacteria 275370
235 Ga0157376_10007297 3300014969 Bacteria 7871
236 Ga0157376_10345044 3300014969 Bacteria 1423
237 Ga0182006_1002080 3300015261 Bacteria 11189
238 Ga0182007_10000410 3300015262 Bacteria 26353
239 Ga0183362_10002 3300015683 Bacteria 1432711
240 Ga0163161_10289126 3300017792 Bacteria 1288
241 Ga0213873_10000188 3300021358 Bacteria 11272
242 Ga0213876_10000008 3300021384 Bacteria 506740
243 Ga0213876_10052847 3300021384 Bacteria 2147
244 Ga0209436_100387 3300025208 Bacteria 19886
245 Ga0209436_101360 3300025208 Bacteria 8654
246 Ga0207425_1000087 3300025245 Bacteria 93219
247 Ga0209129_1000007 3300025258 Bacteria 771325
248 Ga0209565_1000038 3300025263 Bacteria 286433
249 Ga0209565_1002340 3300025263 Bacteria 6922
250 Ga0209673_1000080 3300025273 Bacteria 223503
251 Ga0209673_1000190 3300025273 Bacteria 123411
252 Ga0209130_1000137 3300025284 Bacteria 116784
253 Ga0209130_1000823 3300025284 Bacteria 26100
254 Ga0209675_1000102 3300025291 Bacteria 123742
255 Ga0209676_1000125 3300025292 Bacteria 191565
256 Ga0209676_1000152 3300025292 Bacteria 166700
257 Ga0209676_1004374 3300025292 Bacteria 7904
258 Ga0209025_1000056 3300025294 Bacteria 316188
259 Ga0209025_1000096 3300025294 Bacteria 239153
260 Ga0209564_1000073 3300025295 Bacteria 288080
261 Ga0209564_1000918 3300025295 Bacteria 38443
262 Ga0209758_1000044 3300025297 Bacteria 398448
263 Ga0209758_1003676 3300025297 Bacteria 13645
264 Ga0209050_1000012 3300025298 Bacteria 813717
265 Ga0209050_1000210 3300025298 Bacteria 129834
266 Ga0209256_1000020 3300025299 Bacteria 542402
267 Ga0209256_1000969 3300025299 Bacteria 34493
268 Ga0207426_1000001 3300025302 Bacteria 1341301
269 Ga0207426_1000795 3300025302 Bacteria 34244
270 Ga0209051_1000074 3300025303 Bacteria 208667
271 Ga0209051_1000332 3300025303 Bacteria 71041
272 Ga0209051_1009665 3300025303 Bacteria 4949
273 Ga0209257_1000024 3300025304 Bacteria 726068
274 Ga0209257_1000072 3300025304 Bacteria 332791
275 Ga0209257_1000222 3300025304 Bacteria 134717
276 Ga0207697_10057714 3300025315 Bacteria 1611
277 Ga0207655_1006163 3300025728 Bacteria 8000
278 Ga0207642_10018001 3300025899 Unclassified 2701
279 Ga0207688_10337169 3300025901 Bacteria 927
280 Ga0207699_10000047 3300025906 Bacteria 109818
281 Ga0207699_10289678 3300025906 Bacteria 1140
282 Ga0207705_10007249 3300025909 Bacteria 8161
283 Ga0207705_10098683 3300025909 Bacteria 2146
284 Ga0207705_10130378 3300025909 Unclassified 1871
285 Ga0207705_10130735 3300025909 Bacteria 1869
286 Ga0207684_10049061 3300025910 Bacteria 3582
287 Ga0207654_10044985 3300025911 Bacteria 2510
288 Ga0207707_10078188 3300025912 Bacteria 2889
289 Ga0207707_10193382 3300025912 Bacteria 1775
290 Ga0207695_10053804 3300025913 Bacteria 4207
291 Ga0207693_10013090 3300025915 Bacteria 6693
292 Ga0207663_10011787 3300025916 Bacteria 4707
293 Ga0207663_10048559 3300025916 Bacteria 2628
294 Ga0207660_10020100 3300025917 Bacteria 4478
295 Ga0207662_10011723 3300025918 Bacteria 4869
296 Ga0207662_10023335 3300025918 Bacteria 3554
297 Ga0207657_10001562 3300025919 Bacteria 24567
298 Ga0207657_10108116 3300025919 Bacteria 2299
299 Ga0207649_10210302 3300025920 Bacteria 1379
300 Ga0207649_10343494 3300025920 Bacteria 1103
301 Ga0207652_10051119 3300025921 Bacteria 3543
302 Ga0207646_10010948 3300025922 Bacteria 8807
303 Ga0207681_10000044 3300025923 Bacteria 128566
304 Ga0207681_10003457 3300025923 Bacteria 9845
305 Ga0207694_10000002 3300025924 Bacteria 1165763
306 Ga0207694_10000003 3300025924 Bacteria 1165533
307 Ga0207650_10000944 3300025925 Bacteria 21853
308 Ga0207650_10030845 3300025925 Bacteria 3866
309 Ga0207650_10661085 3300025925 Bacteria 881
310 Ga0207659_10307486 3300025926 Bacteria 1304
311 Ga0207687_10000019 3300025927 Bacteria 234280
312 Ga0207687_10011671 3300025927 Bacteria 5744
313 Ga0207700_10340374 3300025928 Bacteria 1304
314 Ga0207700_10482620 3300025928 Bacteria 1095
315 Ga0207664_10102360 3300025929 Bacteria 2368
316 Ga0207644_10145690 3300025931 Bacteria 1828
317 Ga0207690_10042295 3300025932 Bacteria 2991
318 Ga0207690_10075612 3300025932 Bacteria 2336
319 Ga0207706_10002425 3300025933 Bacteria 18199
320 Ga0207706_10068712 3300025933 Unclassified 3117
321 Ga0207706_10139772 3300025933 Bacteria 2130
322 Ga0207686_10002285 3300025934 Bacteria 10504
323 Ga0207670_10003829 3300025936 Bacteria 8010
324 Ga0207670_10026579 3300025936 Bacteria 3649
325 Ga0207669_10021810 3300025937 Bacteria 3389
326 Ga0207669_10178320 3300025937 Bacteria 1520
327 Ga0207704_10018968 3300025938 Bacteria 3603
328 Ga0207704_10157074 3300025938 Bacteria 1613
329 Ga0207704_10175954 3300025938 Bacteria 1541
330 Ga0207704_10275562 3300025938 Bacteria 1276
331 Ga0207665_10122127 3300025939 Bacteria 1841
332 Ga0207691_10009862 3300025940 Bacteria 9168
333 Ga0207691_10011184 3300025940 Bacteria 8612
334 Ga0207691_10158285 3300025940 Bacteria 1988
335 Ga0207711_10033570 3300025941 Bacteria 4344
336 Ga0207661_10000002 3300025944 Bacteria 816104
337 Ga0207661_10234630 3300025944 Bacteria 1626
338 Ga0207679_10030080 3300025945 Bacteria 3788
339 Ga0207679_10030990 3300025945 Unclassified 3740
340 Ga0207679_10049921 3300025945 Bacteria 3054
341 Ga0207679_10054844 3300025945 Bacteria 2936
342 Ga0207679_10055518 3300025945 Bacteria 2920
343 Ga0207679_10095742 3300025945 Bacteria 2308
344 Ga0207667_10187791 3300025949 Bacteria 2121
345 Ga0207651_10023151 3300025960 Bacteria 3814
346 Ga0207712_10027714 3300025961 Bacteria 3784
347 Ga0207668_10046407 3300025972 Unclassified 2968
348 Ga0207668_10217522 3300025972 Bacteria 1532
349 Ga0207640_10002165 3300025981 Bacteria 10562
350 Ga0207677_10000003 3300026023 Bacteria 450061
351 Ga0207677_10000118 3300026023 Bacteria 64771
352 Ga0207677_10164249 3300026023 Bacteria 1729
353 Ga0207677_10206160 3300026023 Bacteria 1566
354 Ga0207703_10000019 3300026035 Bacteria 254885
355 Ga0207639_10000005 3300026041 Bacteria 579948
356 Ga0207639_10099487 3300026041 Bacteria 2347
357 Ga0207639_10103701 3300026041 Unclassified 2305
358 Ga0207708_10045257 3300026075 Unclassified 3354
359 Ga0207708_10211908 3300026075 Bacteria 1549
360 Ga0207702_10130048 3300026078 Bacteria 2264
361 Ga0207648_10026533 3300026089 Bacteria 5147
362 Ga0207648_10043374 3300026089 Bacteria 3948
363 Ga0207648_10098903 3300026089 Bacteria 2555
364 Ga0207676_10000002 3300026095 Bacteria 1198607
365 Ga0207676_10170771 3300026095 Bacteria 1894
366 Ga0207674_10067547 3300026116 Bacteria 3599
367 Ga0207675_100140710 3300026118 Bacteria 2292
368 Ga0207675_100192311 3300026118 Bacteria 1957
369 Ga0207675_100574421 3300026118 Bacteria 1128
370 Ga0207675_100625531 3300026118 Unclassified 1081
371 Ga0207683_10127994 3300026121 Bacteria 2283
372 Ga0207698_10118108 3300026142 Bacteria 2239
373 Ga0207698_10332783 3300026142 Bacteria 1427
374 Ga0207428_10169479 3300027907 Bacteria 1654
375 Ga0268266_10000161 3300028379 Bacteria 125387
376 Ga0268266_10086210 3300028379 Bacteria 2745
377 Ga0268265_10045414 3300028380 Bacteria 3278
378 Ga0268264_10160681 3300028381 Bacteria 2023
379 Ga0307511_10000120 3300030521 Bacteria 71419
380 Ga0307408_100013382 3300031548 Bacteria 5444
381 Ga0307408_100459734 3300031548 Bacteria 1106
382 Ga0307514_10000882 3300031649 Bacteria 46955
383 Ga0307514_10017982 3300031649 Bacteria 5807
384 Ga0307413_10258623 3300031824 Bacteria 1296
385 Ga0307410_10038753 3300031852 Bacteria 3124
386 Ga0307410_10049539 3300031852 Bacteria 2820
387 Ga0307406_10001674 3300031901 Bacteria 12184
388 Ga0307407_10044544 3300031903 Bacteria 2501
389 Ga0307409_100127949 3300031995 Bacteria 2164
390 Ga0307409_100179172 3300031995 Bacteria 1874
391 Ga0307409_100807227 3300031995 Bacteria 946
392 Ga0307416_100029950 3300032002 Bacteria 4076
393 Ga0307416_100044388 3300032002 Bacteria 3490
394 Ga0307414_10164450 3300032004 Unclassified 1767
395 Ga0307411_10028290 3300032005 Bacteria 3406
396 Ga0373941_0007738 3300035115 Bacteria 2641
397 Ga0373954_0051148 3300035118 Unclassified 1940
398 Ga0373956_0002070 3300035119 Bacteria 8314
399 Ga0373943_0016065 3300035170 Bacteria 3409
400 Ga0373946_0098698 3300035171 Unclassified 1306
401 Ga0373955_0002406 3300035172 Bacteria 8158
402 Ga0373924_0010339 3300035410 Bacteria 3436
403 Ga0373935_0085053 3300035692 Bacteria 2061
404 Ga0373927_0025872 3300035695 Bacteria 3836
405 Ga0373933_0001445 3300035724 Bacteria 13889
406 Ga0373947_0296245 3300035725 Bacteria 1078
407 Ga0373937_0001930 3300036401 Bacteria 17351
408 Ga0395905_0464216 3300037471 Bacteria 1165
409 Ga0395901_0375120 3300038443 Bacteria 1465
410 Ga0436365_0628773 3300039437 Bacteria 2167
411 Ga0436365_0728396 3300039437 Bacteria 1677
412 Ga0436365_1347761 3300039437 Bacteria 136063
413 Ga0436365_1552765 3300039437 Bacteria 3321
414 Ga0436362_0235247 3300039453 Bacteria 31191
415 Ga0439439_0007367 3300041406 Bacteria 2572
416 Ga0439433_0002532 3300041999 Bacteria 3880
417 Ga0451577_0521405 3300042876 Bacteria 1079
418 Ga0466965_0064929 3300044683 Bacteria 1828
419 Ga0466966_0102829 3300044684 Bacteria 1766
420 Ga0466964_0225982 3300044706 Bacteria 911
421 Ga0466957_0129248 3300044842 Bacteria 1617
422 Ga0466960_0013392 3300044901 Bacteria 3484
423 Ga0451576_0069960 3300045051 Bacteria 3653
424 Ga0451576_0371385 3300045051 Bacteria 1499
425 Ga0451576_0644167 3300045051 Unclassified 1113
426 Ga0466967_0058979 3300045976 Bacteria 3395
427 Ga0495627_008085 3300046453 Bacteria 3966
428 Ga0495627_013164 3300046453 Bacteria 2915
429 Ga0495603_0003653 3300046455 Bacteria 9152
430 Ga0495629_0021831 3300046459 Bacteria 4569
431 Ga0495651_0004656 3300046462 Bacteria 10492
432 Ga0495653_0001393 3300046463 Bacteria 18789
433 Ga0495580_0051402 3300046472 Bacteria 2913
434 Ga0495639_0003404 3300046475 Bacteria 6892
435 Ga0495584_0060647 3300046491 Bacteria 1902
436 Ga0495608_0006422 3300046511 Bacteria 8351
437 Ga0495618_0034416 3300046514 Bacteria 3177
438 Ga0495620_0013561 3300046515 Bacteria 4170
439 Ga0495628_0005975 3300046516 Bacteria 10656
440 Ga0495630_0024620 3300046517 Bacteria 4448
441 Ga0495630_0035866 3300046517 Bacteria 3706
442 Ga0495630_0388714 3300046517 Unclassified 1069
443 Ga0495663_0014767 3300046525 Bacteria 2193
444 Ga0495663_0083953 3300046525 Bacteria 1029
445 Ga0495642_0004401 3300046528 Bacteria 5471
446 Ga0495665_0006491 3300046531 Bacteria 6316
447 Ga0495587_0014305 3300046536 Bacteria 4980
448 Ga0495667_0002273 3300046559 Bacteria 12868
449 Ga0495668_0057049 3300046616 Bacteria 2155
450 Ga0495635_0024175 3300046663 Bacteria 4236
451 Ga0495635_0070717 3300046663 Bacteria 2392
452 Ga0495659_0002603 3300046664 Bacteria 5816
453 Ga0495588_0002393 3300046674 Bacteria 8021
454 Ga0495657_0001659 3300046675 Bacteria 19132
455 Ga0495599_0001120 3300046678 Bacteria 15098
456 Ga0495623_0001915 3300046679 Bacteria 13972
457 Ga0495646_0004080 3300046680 Bacteria 9164
458 Ga0495658_0000823 3300046683 Bacteria 16636
459 Ga0495669_0281379 3300046684 Bacteria 800
460 Ga0495613_0002037 3300046689 Bacteria 15348
461 Ga0495613_0036991 3300046689 Bacteria 3619
462 Ga0495613_0053562 3300046689 Bacteria 2969
463 Ga0495600_0001151 3300046809 Bacteria 14442
464 Ga0495660_0171571 3300046810 Bacteria 1056
465 Ga0495581_0010289 3300047315 Bacteria 5410
466 Ga0495581_0071142 3300047315 Bacteria 2012
467 Ga0495581_0150721 3300047315 Unclassified 1358
468 Ga0495604_0034284 3300047317 Bacteria 4016
469 Ga0495674_0025478 3300047319 Bacteria 5422
470 Ga0495675_0001344 3300047444 Bacteria 14904
471 Ga0495675_0150864 3300047444 Unclassified 1436
472 Ga0495679_010056 3300047446 Bacteria 3743
473 Ga0495684_0001451 3300047471 Bacteria 18968
474 Ga0495593_0002104 3300047673 Bacteria 11902
475 Ga0495593_0020265 3300047673 Bacteria 3724
476 Ga0495602_0002419 3300048088 Bacteria 18987
477 Ga0495614_0064571 3300048089 Bacteria 1574
478 Ga0496101_0064461 3300048904 Bacteria 2669
479 Ga0496104_0024593 3300048907 Bacteria 5541
480 Ga0496104_0418421 3300048907 Bacteria 1252
481 Ga0496106_0026309 3300048909 Bacteria 4332
482 Ga0496106_0158057 3300048909 Bacteria 1791
483 Ga0496108_0139780 3300048911 Bacteria 2086
484 Ga0496109_0114334 3300048912 Bacteria 2511
485 Ga0496111_0125881 3300048914 Bacteria 1894
486 Ga0496112_0007161 3300048915 Bacteria 9876
487 Ga0496113_0009884 3300048916 Bacteria 6284
488 Ga0496117_0014282 3300048920 Bacteria 6852
489 Ga0496118_0006217 3300048921 Bacteria 13211
490 Ga0496122_0086022 3300048925 Bacteria 2166
491 Ga0496123_0005675 3300048926 Bacteria 12456
492 Ga0496125_0009533 3300048928 Bacteria 9963
493 Ga0501292_008178 3300049515 Bacteria 1525
494 Ga0501303_000752 3300049526 Bacteria 2448
495 Ga0501032_0084973 3300049569 Bacteria 2104
496 Ga0501034_0028071 3300049571 Bacteria 5724
497 Ga0501043_0033566 3300049579 Bacteria 4039
498 Ga0501046_0440365 3300049580 Bacteria 938
499 Ga0501047_0013044 3300049581 Bacteria 7871
500 Ga0501070_0005028 3300049586 Bacteria 11280
501 Ga0501071_0029020 3300049587 Bacteria 3902
502 Ga0501073_0010964 3300049589 Bacteria 6631
503 Ga0501075_0021642 3300049591 Bacteria 4690
504 Ga0501076_0007927 3300049592 Bacteria 7747
505 Ga0501206_004416 3300049653 Bacteria 1788
506 Ga0501222_000017 3300049662 Bacteria 75770
507 Ga0501249_020619 3300049679 Bacteria 1434
508 Ga0501259_031118 3300049688 Unclassified 1008
509 Ga0501081_0015559 3300049743 Bacteria 5022
510 Ga0501083_0001830 3300049744 Bacteria 14585
511 Ga0501273_002680 3300049770 Bacteria 1832
512 Ga0501045_0072045 3300049824 Bacteria 2544
513 nmdc:mga07m45_3535_c1 3300050496 Bacteria 7548
514 nmdc:mga07m45_51236_c1 3300050496 Bacteria 2328
515 nmdc:mga05p37_119152_c1 3300050507 Bacteria 3243
516 nmdc:mga05p37_248346_c1 3300050507 Bacteria 2135
517 nmdc:mga05p37_664817_c1 3300050507 Bacteria 1164
518 nmdc:mga09592_45446_c1 3300050508 Bacteria 3699
519 nmdc:mga06r32_313143_c1 3300050510 Unclassified 1555
520 nmdc:mga0n895_112310_c1 3300050512 Bacteria 2742
521 nmdc:mga0n895_24858_c1 3300050512 Bacteria 5651
522 nmdc:mga0n895_29291_c1 3300050512 Bacteria 5249
523 nmdc:mga0n895_95575_c1 3300050512 Bacteria 2976
524 nmdc:mga0rr50_152210_c1 3300050513 Bacteria 1870
525 nmdc:mga0rr50_1564_c1 3300050513 Bacteria 9064
526 nmdc:mga0rr50_96_c1 3300050513 Bacteria 49211
527 nmdc:mga08x19_1295_c1 3300050514 Bacteria 15530
528 nmdc:mga08x19_236967_c1 3300050514 Bacteria 1257
529 nmdc:mga0sz30_145835_c1 3300050516 Bacteria 1046
530 Ga0495601_0010716 3300053077 Bacteria 5468
531 Ga0500610_0000923 3300053079 Bacteria 9494
532 Ga0495655_0016137 3300053083 Bacteria 1603
533 Ga0495619_0017326 3300053085 Bacteria 4562
534 Ga0495619_0064611 3300053085 Bacteria 2440
535 Ga0500643_001142 3300053087 Bacteria 15853
536 Ga0500651_0000112 3300053093 Bacteria 49988
537 Ga0500566_0086524 3300053094 Bacteria 1737
538 Ga0500641_0070988 3300053096 Bacteria 1466
539 Ga0500571_000133 3300053110 Bacteria 25072
540 Ga0500593_000508 3300053117 Bacteria 15279
541 Ga0500655_013960 3300053133 Bacteria 1468
542 Ga0500658_0000530 3300053134 Bacteria 16101
543 Ga0500564_016146 3300053138 Bacteria 3378
544 Ga0500574_001228 3300053141 Bacteria 3716
545 Ga0500616_0048376 3300053153 Bacteria 2255
546 Ga0500627_0000142 3300053158 Bacteria 21143
547 Ga0500634_0066761 3300053161 Bacteria 1894
548 Ga0500638_000080 3300053162 Bacteria 17226
549 Ga0500625_093304 3300053729 Bacteria 1282
550 Ga0501084_0367680 3300054114 Bacteria 1215
551 Ga0590075_012752 3300059424 Bacteria 2043
552 Ga0501082_0043920 3300060353 Bacteria 3855
553 Ga0501082_0257828 3300060353 Bacteria 1517
554 2513229015 2513020051 Bacteria 6053213
555 2599628070 2599185214 Bacteria 8209958
556 2599677984 2599185226 Bacteria 8233575
557 2599685690 2599185227 Bacteria 8246414
558 2599697590 2599185229 Bacteria 8216126
559 2644329077 2643221658 Bacteria 6064537
560 2644401831 2643221672 Bacteria 6322190
561 2738881226 2738541307 Bacteria 8606193
562 2831272067 2831265667 Bacteria 7184833
563 2838059881 2838054893 Bacteria 7451788
564 2904546360 2904541872 Bacteria 8915136
565 2928077032 2928070936 Bacteria 8062541
566 2929164170 2929160207 Bacteria 9075316
567 2945972736 2945972063 Bacteria 6086495
568 Ga0070696_100000857
569 JGI24739J22299_10018622
570 JGI25152J39213_1000235
571 JGI25152J39213_1004400
572 JGI25150J39212_1000384
573 JGI25159J45721_1000103
574 JGI25159J45721_1006236
575 JGI25151J46595_10000696
576 JGI25151J46595_10007436
577 JGI25406J46586_10031756
578 JGI25153J46596_10000298
579 rootH1_10034425
580 JGI25160J50197_1000255
581 JGI25160J50197_1011191
582 JGI25161J50226_1000393
583 Ga0006562J51391_1086680
584 Ga0006562J51391_1102156
585 Ga0055526_1000357
586 Ga0055526_1003149
587 Ga0055537_1000274
588 Ga0055537_1006375
589 Ga0055524_1000400
590 Ga0055524_1003655
591 Ga0055536_1000488
592 Ga0055536_1002861
593 Ga0055534_1000255
594 Ga0055534_1005141
595 Ga0055528_1000277
596 Ga0055528_1013982
597 Ga0055530_10000110
598 Ga0055540_1000174
599 Ga0055540_1002550
600 Ga0055531_10000217
601 Ga0055531_10002120
602 Ga0055531_10003669
603 Ga0055543_1000262
604 Ga0055543_1000784
605 Ga0065165_1000494
606 Ga0065165_1011748
607 Ga0065712_10000747
608 Ga0070658_10004126
609 Ga0070658_10019104
610 Ga0070658_10120792
611 Ga0070658_10139700
612 Ga0070658_10170163
613 Ga0070676_10035330
614 Ga0070683_100000070
615 Ga0070683_100096404
616 Ga0070690_100383806
617 Ga0070670_100000058
618 Ga0070670_100043843
619 Ga0070670_100084965
620 Ga0070670_100539018
621 Ga0070677_10033897
622 Ga0068869_100002648
623 Ga0068869_100042591
624 Ga0070682_100000082
625 Ga0068868_100000626
626 Ga0068868_100233580
627 Ga0070660_100034136
628 Ga0070660_100098900
629 Ga0070689_100004514
630 Ga0070689_100013388
631 Ga0070689_100044370
632 Ga0070687_100005246
633 Ga0070687_100011870
634 Ga0070687_100174454
635 Ga0070661_100187683
636 Ga0070661_100427144
637 Ga0070692_10001210
638 Ga0070668_100446614
639 Ga0070669_100000179
640 Ga0070669_100001494
641 Ga0070669_100103728
642 Ga0070675_100006766
643 Ga0070671_100017405
644 Ga0070671_100188920
645 Ga0070674_100001957
646 Ga0070674_100017197
647 Ga0070688_100017685
648 Ga0070688_100022710
649 Ga0070688_100026396
650 Ga0070659_100061968
651 Ga0070667_100158936
652 Ga0070709_10000522
653 Ga0070709_10017377
654 Ga0070714_100042418
655 Ga0070713_100000283
656 Ga0070713_100050826
657 Ga0070713_100306809
658 Ga0070711_100017223
659 Ga0070711_100243877
660 Ga0070705_100448411
661 Ga0070700_100082253
662 Ga0070694_100459764
663 Ga0070708_100622808
664 Ga0070678_100177858
665 Ga0070662_100010945
666 Ga0070662_100041864
667 Ga0070662_100402553
668 Ga0070681_10057184
669 Ga0070681_10262216
670 Ga0068867_100033167
671 Ga0068867_100212318
672 Ga0070685_10003767
673 Ga0070685_10014843
674 Ga0070706_100055231
675 Ga0070707_100010087
676 Ga0070698_100053151
677 Ga0070679_100037703
678 Ga0070684_100000185
679 Ga0070684_100005306
680 Ga0070684_100234625
681 Ga0068853_100203974
682 Ga0068853_100350043
683 Ga0070672_100005515
684 Ga0070672_100031997
685 Ga0070672_100143028
686 Ga0070672_100146917
687 Ga0070686_100034273
688 Ga0070695_100001161
689 Ga0070665_100176239
690 Ga0070704_100097697
691 Ga0068855_100090561
692 Ga0068855_100691883
693 Ga0070664_100010731
694 Ga0070664_100012963
695 Ga0068856_100275657
696 Ga0068852_100045996
697 Ga0068852_100081174
698 Ga0068859_100006570
699 Ga0068859_100265049
700 Ga0068864_100088322
701 Ga0068866_10025412
702 Ga0068861_100124215
703 Ga0068861_100459019
704 Ga0068863_100119705
705 Ga0068858_100000390
706 Ga0068860_100040565
707 Ga0068862_100011756
708 Ga0068862_100041958
709 Ga0068862_100168402
710 Ga0068862_100813485
711 Ga0081455_10000063
712 Ga0081539_10002282
713 Ga0070717_10002476
714 Ga0070717_10550392
715 Ga0070716_100242138
716 Ga0070712_100006737
717 Ga0097621_100630235
718 Ga0075370_10001294
719 Ga0075370_10021703
720 Ga0068871_100217877
721 Ga0075428_100235342
722 Ga0075431_100076318
723 Ga0075431_100408063
724 Ga0075433_10062919
725 Ga0075433_10392113
726 Ga0075434_100057226
727 Ga0075434_100147005
728 Ga0075434_100342973
729 Ga0075429_100039820
730 Ga0068865_100026516
731 Ga0068865_100704083
732 Ga0075436_100011176
733 Ga0075436_100256138
734 Ga0097620_100006570
735 Ga0097620_100082393
736 Ga0097620_100265046
737 Ga0075435_100000133
738 Ga0075435_100012497
739 Ga0075435_100165722
740 Ga0105244_10000473
741 Ga0111539_10101607
742 Ga0111539_10305940
743 Ga0111539_10553590
744 Ga0105245_10000084
745 Ga0105245_10011933
746 Ga0105245_10019860
747 Ga0105245_10265732
748 Ga0114129_10065825
749 Ga0114129_10342929
750 Ga0114129_10483250
751 Ga0114129_11046803
752 Ga0105243_10003779
753 Ga0105243_10642642
754 Ga0105241_10179910
755 Ga0105242_10025115
756 Ga0105248_10021143
757 Ga0105248_10056875
758 Ga0105238_10000021
759 Ga0105238_10031637
760 Ga0105249_10033530
761 Ga0105249_10185653
762 Ga0105249_10397791
763 Ga0105249_10499268
764 Ga0105239_10388311
765 Ga0105246_10059073
766 Ga0105246_10097365
767 Ga0157373_10007382
768 Ga0157373_10025221
769 Ga0157371_10045190
770 Ga0157371_10226236
771 Ga0157371_10282410
772 Ga0157371_10503256
773 Ga0157369_10000065
774 Ga0157369_10015434
775 Ga0157369_10092201
776 Ga0157369_10163324
777 Ga0157374_10000035
778 Ga0157374_10058301
779 Ga0157374_10797912
780 Ga0157378_10004412
781 Ga0157378_10005201
782 Ga0163162_10114266
783 Ga0163162_10114828
784 Ga0157372_10012322
785 Ga0157372_10116069
786 Ga0157372_10208120
787 Ga0157372_10274598
788 Ga0157372_10293804
789 Ga0157375_10000005
790 Ga0157375_10000010
791 Ga0157375_10000092
792 Ga0157375_10044029
793 Ga0157375_10177110
794 Ga0157375_10435306
795 Ga0163163_10076551
796 Ga0157380_10006516
797 Ga0182008_10005039
798 Ga0182008_10007047
799 Ga0157377_10000007
800 Ga0157377_10062334
801 Ga0157376_10000015
802 Ga0157376_10007297
803 Ga0157376_10345044
804 Ga0182006_1002080
805 Ga0182007_10000410
806 Ga0183362_10002
807 Ga0163161_10289126
808 Ga0213873_10000188
809 Ga0213876_10000008
810 Ga0213876_10052847
811 Ga0209436_100387
812 Ga0209436_101360
813 Ga0207425_1000087
814 Ga0209129_1000007
815 Ga0209565_1000038
816 Ga0209565_1002340
817 Ga0209673_1000080
818 Ga0209673_1000190
819 Ga0209130_1000137
820 Ga0209130_1000823
821 Ga0209675_1000102
822 Ga0209676_1000125
823 Ga0209676_1000152
824 Ga0209676_1004374
825 Ga0209025_1000056
826 Ga0209025_1000096
827 Ga0209564_1000073
828 Ga0209564_1000918
829 Ga0209758_1000044
830 Ga0209758_1003676
831 Ga0209050_1000012
832 Ga0209050_1000210
833 Ga0209256_1000020
834 Ga0209256_1000969
835 Ga0207426_1000001
836 Ga0207426_1000795
837 Ga0209051_1000074
838 Ga0209051_1000332
839 Ga0209051_1009665
840 Ga0209257_1000024
841 Ga0209257_1000072
842 Ga0209257_1000222
843 Ga0207697_10057714
844 Ga0207655_1006163
845 Ga0207642_10018001
846 Ga0207688_10337169
847 Ga0207699_10000047
848 Ga0207699_10289678
849 Ga0207705_10007249
850 Ga0207705_10098683
851 Ga0207705_10130378
852 Ga0207705_10130735
853 Ga0207684_10049061
854 Ga0207654_10044985
855 Ga0207707_10078188
856 Ga0207707_10193382
857 Ga0207695_10053804
858 Ga0207693_10013090
859 Ga0207663_10011787
860 Ga0207663_10048559
861 Ga0207660_10020100
862 Ga0207662_10011723
863 Ga0207662_10023335
864 Ga0207657_10001562
865 Ga0207657_10108116
866 Ga0207649_10210302
867 Ga0207649_10343494
868 Ga0207652_10051119
869 Ga0207646_10010948
870 Ga0207681_10000044
871 Ga0207681_10003457
872 Ga0207694_10000002
873 Ga0207694_10000003
874 Ga0207650_10000944
875 Ga0207650_10030845
876 Ga0207650_10661085
877 Ga0207659_10307486
878 Ga0207687_10000019
879 Ga0207687_10011671
880 Ga0207700_10340374
881 Ga0207700_10482620
882 Ga0207664_10102360
883 Ga0207644_10145690
884 Ga0207690_10042295
885 Ga0207690_10075612
886 Ga0207706_10002425
887 Ga0207706_10068712
888 Ga0207706_10139772
889 Ga0207686_10002285
890 Ga0207670_10003829
891 Ga0207670_10026579
892 Ga0207669_10021810
893 Ga0207669_10178320
894 Ga0207704_10018968
895 Ga0207704_10157074
896 Ga0207704_10175954
897 Ga0207704_10275562
898 Ga0207665_10122127
899 Ga0207691_10009862
900 Ga0207691_10011184
901 Ga0207691_10158285
902 Ga0207711_10033570
903 Ga0207661_10000002
904 Ga0207661_10234630
905 Ga0207679_10030080
906 Ga0207679_10030990
907 Ga0207679_10049921
908 Ga0207679_10054844
909 Ga0207679_10055518
910 Ga0207679_10095742
911 Ga0207667_10187791
912 Ga0207651_10023151
913 Ga0207712_10027714
914 Ga0207668_10046407
915 Ga0207668_10217522
916 Ga0207640_10002165
917 Ga0207677_10000003
918 Ga0207677_10000118
919 Ga0207677_10164249
920 Ga0207677_10206160
921 Ga0207703_10000019
922 Ga0207639_10000005
923 Ga0207639_10099487
924 Ga0207639_10103701
925 Ga0207708_10045257
926 Ga0207708_10211908
927 Ga0207702_10130048
928 Ga0207648_10026533
929 Ga0207648_10043374
930 Ga0207648_10098903
931 Ga0207676_10000002
932 Ga0207676_10170771
933 Ga0207674_10067547
934 Ga0207675_100140710
935 Ga0207675_100192311
936 Ga0207675_100574421
937 Ga0207675_100625531
938 Ga0207683_10127994
939 Ga0207698_10118108
940 Ga0207698_10332783
941 Ga0207428_10169479
942 Ga0268266_10000161
943 Ga0268266_10086210
944 Ga0268265_10045414
945 Ga0268264_10160681
946 Ga0307511_10000120
947 Ga0307408_100013382
948 Ga0307408_100459734
949 Ga0307514_10000882
950 Ga0307514_10017982
951 Ga0307413_10258623
952 Ga0307410_10038753
953 Ga0307410_10049539
954 Ga0307406_10001674
955 Ga0307407_10044544
956 Ga0307409_100127949
957 Ga0307409_100179172
958 Ga0307409_100807227
959 Ga0307416_100029950
960 Ga0307416_100044388
961 Ga0307414_10164450
962 Ga0307411_10028290
963 Ga0373941_0007738
964 Ga0373954_0051148
965 Ga0373956_0002070
966 Ga0373943_0016065
967 Ga0373946_0098698
968 Ga0373955_0002406
969 Ga0373924_0010339
970 Ga0373935_0085053
971 Ga0373927_0025872
972 Ga0373933_0001445
973 Ga0373947_0296245
974 Ga0373937_0001930
975 Ga0395905_0464216
976 Ga0395901_0375120
977 Ga0436365_0628773
978 Ga0436365_0728396
979 Ga0436365_1347761
980 Ga0436365_1552765
981 Ga0436362_0235247
982 Ga0439439_0007367
983 Ga0439433_0002532
984 Ga0451577_0521405
985 Ga0466965_0064929
986 Ga0466966_0102829
987 Ga0466964_0225982
988 Ga0466957_0129248
989 Ga0466960_0013392
990 Ga0451576_0069960
991 Ga0451576_0371385
992 Ga0451576_0644167
993 Ga0466967_0058979
994 Ga0495627_008085
995 Ga0495627_013164
996 Ga0495603_0003653
997 Ga0495629_0021831
998 Ga0495651_0004656
999 Ga0495653_0001393
1000 Ga0495580_0051402
1001 Ga0495639_0003404
1002 Ga0495584_0060647
1003 Ga0495608_0006422
1004 Ga0495618_0034416
1005 Ga0495620_0013561
1006 Ga0495628_0005975
1007 Ga0495630_0024620
1008 Ga0495630_0035866
1009 Ga0495630_0388714
1010 Ga0495663_0014767
1011 Ga0495663_0083953
1012 Ga0495642_0004401
1013 Ga0495665_0006491
1014 Ga0495587_0014305
1015 Ga0495667_0002273
1016 Ga0495668_0057049
1017 Ga0495635_0024175
1018 Ga0495635_0070717
1019 Ga0495659_0002603
1020 Ga0495588_0002393
1021 Ga0495657_0001659
1022 Ga0495599_0001120
1023 Ga0495623_0001915
1024 Ga0495646_0004080
1025 Ga0495658_0000823
1026 Ga0495669_0281379
1027 Ga0495613_0002037
1028 Ga0495613_0036991
1029 Ga0495613_0053562
1030 Ga0495600_0001151
1031 Ga0495660_0171571
1032 Ga0495581_0010289
1033 Ga0495581_0071142
1034 Ga0495581_0150721
1035 Ga0495604_0034284
1036 Ga0495674_0025478
1037 Ga0495675_0001344
1038 Ga0495675_0150864
1039 Ga0495679_010056
1040 Ga0495684_0001451
1041 Ga0495593_0002104
1042 Ga0495593_0020265
1043 Ga0495602_0002419
1044 Ga0495614_0064571
1045 Ga0496101_0064461
1046 Ga0496104_0024593
1047 Ga0496104_0418421
1048 Ga0496106_0026309
1049 Ga0496106_0158057
1050 Ga0496108_0139780
1051 Ga0496109_0114334
1052 Ga0496111_0125881
1053 Ga0496112_0007161
1054 Ga0496113_0009884
1055 Ga0496117_0014282
1056 Ga0496118_0006217
1057 Ga0496122_0086022
1058 Ga0496123_0005675
1059 Ga0496125_0009533
1060 Ga0501292_008178
1061 Ga0501303_000752
1062 Ga0501032_0084973
1063 Ga0501034_0028071
1064 Ga0501043_0033566
1065 Ga0501046_0440365
1066 Ga0501047_0013044
1067 Ga0501070_0005028
1068 Ga0501071_0029020
1069 Ga0501073_0010964
1070 Ga0501075_0021642
1071 Ga0501076_0007927
1072 Ga0501206_004416
1073 Ga0501222_000017
1074 Ga0501249_020619
1075 Ga0501259_031118
1076 Ga0501081_0015559
1077 Ga0501083_0001830
1078 Ga0501273_002680
1079 Ga0501045_0072045
1080 nmdc:mga07m45_3535_c1
1081 nmdc:mga07m45_51236_c1
1082 nmdc:mga05p37_119152_c1
1083 nmdc:mga05p37_248346_c1
1084 nmdc:mga05p37_664817_c1
1085 nmdc:mga09592_45446_c1
1086 nmdc:mga06r32_313143_c1
1087 nmdc:mga0n895_112310_c1
1088 nmdc:mga0n895_24858_c1
1089 nmdc:mga0n895_29291_c1
1090 nmdc:mga0n895_95575_c1
1091 nmdc:mga0rr50_152210_c1
1092 nmdc:mga0rr50_1564_c1
1093 nmdc:mga0rr50_96_c1
1094 nmdc:mga08x19_1295_c1
1095 nmdc:mga08x19_236967_c1
1096 nmdc:mga0sz30_145835_c1
1097 Ga0495601_0010716
1098 Ga0500610_0000923
1099 Ga0495655_0016137
1100 Ga0495619_0017326
1101 Ga0495619_0064611
1102 Ga0500643_001142
1103 Ga0500651_0000112
1104 Ga0500566_0086524
1105 Ga0500641_0070988
1106 Ga0500571_000133
1107 Ga0500593_000508
1108 Ga0500655_013960
1109 Ga0500658_0000530
1110 Ga0500564_016146
1111 Ga0500574_001228
1112 Ga0500616_0048376
1113 Ga0500627_0000142
1114 Ga0500634_0066761
1115 Ga0500638_000080
1116 Ga0500625_093304
1117 Ga0501084_0367680
1118 Ga0590075_012752
1119 Ga0501082_0043920
1120 Ga0501082_0257828
1121 2513229015
1122 2599628070
1123 2599677984
1124 2599685690
1125 2599697590
1126 2644329077
1127 2644401831
1128 2738881226
1129 2831272067
1130 2838059881
1131 2904546360
1132 2928077032
1133 2929164170
1134 2945972736

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

33

249

0.7

PF00149

Metallophos

Calcineurin-like phosphoesterase

33

234

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yv1-assembly1.cif.gz_A crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661 0.7539 37 101
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.7076 2 226
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.6961 2 226
6unc-assembly2.cif.gz_B the crystal structure of phosphopantetheinyl hydrolase (ppth) from mycobacterium tuberculosis 0.6882 6 243
3rl3-assembly1.cif.gz_A rat metallophosphodiesterase mpped2 0.6761 2 248
ID Description Score Start End Superfamily
af_Q58562_1_216_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7783 9 244 3.60.21.10
af_P37049_48_231_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7576 10 208 3.60.21.10
2yv1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.7364 29 101 3.40.50.261
af_Q22704_214_405_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7308 10 208 3.60.21.10
af_Q58562_1_216_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7256 9 244 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A538NL83-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9893 10 115 GO:0016787
AF-A0A2V9S0Q5-F1-model_v4 Metallophosphoesterase 0.9866 156 235
AF-A0A7X6DHA0-F1-model_v4 Metallophosphoesterase 0.9739 3 253 GO:0008758
GO:0009245
GO:0016020
AF-A0A7U3C3C8-F1-model_v4 deleted 0.9733 1 258
AF-A0A1U1NET1-F1-model_v4 deleted 0.9715 145 231

Map