F464447

General Info

Members Datasets Scaffolds Average Seq Length
566 284 1132 100

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0377270|Ga0501039_0377270_20_385
Length 121
Sequence MSHGVRTRDGGVAVRAHEARSAMKLKSEFETVCPCCQTTLVIDVNLKRVVRHQEPVRGDRPELSDAQRILAEEAARREAIFQKSVVAERTRGDALSKRFEEALRQANQEPISKPTRDFDLD

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
178 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
202 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
203 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0
Rhizoplane 3.18
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 34.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0377270 3300049575 Unclassified 1114
2 MRS1b_contig_2768644 2162886011 Bacteria 1103
3 JGI25406J46586_10081752 3300003203 Bacteria 990
4 Ga0058863_11295950 3300004799 Bacteria 932
5 Ga0058861_10648149 3300004800 Bacteria 743
6 Ga0065712_10000522 3300005290 Bacteria 10342
7 Ga0065715_10000462 3300005293 Bacteria 19935
8 Ga0065715_10027879 3300005293 Unclassified 1256
9 Ga0065715_10557957 3300005293 Unclassified 736
10 Ga0065715_11127457 3300005293 Unclassified 514
11 Ga0065707_10215867 3300005295 Bacteria 1245
12 Ga0065707_10244172 3300005295 Unclassified 1146
13 Ga0070676_10085347 3300005328 Bacteria 1924
14 Ga0070683_100122653 3300005329 Unclassified 2455
15 Ga0070690_100010413 3300005330 Bacteria 5412
16 Ga0070690_100952805 3300005330 Bacteria 674
17 Ga0070670_100011153 3300005331 Bacteria 7679
18 Ga0070670_100735753 3300005331 Unclassified 888
19 Ga0070677_10018322 3300005333 Bacteria 2520
20 Ga0070677_10169931 3300005333 Bacteria 1030
21 Ga0068869_102010313 3300005334 Bacteria 519
22 Ga0070666_10395015 3300005335 Unclassified 994
23 Ga0070680_100735900 3300005336 Unclassified 849
24 Ga0070682_101936936 3300005337 Unclassified 517
25 Ga0068868_100051926 3300005338 Bacteria 3227
26 Ga0068868_100206916 3300005338 Bacteria 1638
27 Ga0068868_101068771 3300005338 Unclassified 741
28 Ga0068868_101780866 3300005338 Bacteria 581
29 Ga0070660_100004982 3300005339 Bacteria 9180
30 Ga0070689_100030207 3300005340 Bacteria 4111
31 Ga0070689_100065053 3300005340 Bacteria 2839
32 Ga0070691_10982964 3300005341 Unclassified 526
33 Ga0070687_100394614 3300005343 Unclassified 905
34 Ga0070668_100053250 3300005347 Bacteria 3121
35 Ga0070668_101038670 3300005347 Bacteria 738
36 Ga0070669_100201625 3300005353 Bacteria 1566
37 Ga0070669_100270487 3300005353 Unclassified 1358
38 Ga0070669_100281048 3300005353 Unclassified 1334
39 Ga0070675_100077668 3300005354 Bacteria 2764
40 Ga0070675_100292475 3300005354 Bacteria 1434
41 Ga0070675_100744095 3300005354 Unclassified 894
42 Ga0070675_102105984 3300005354 Bacteria 520
43 Ga0070671_100112105 3300005355 Bacteria 2291
44 Ga0070671_100212220 3300005355 Bacteria 1642
45 Ga0070674_100185227 3300005356 Unclassified 1597
46 Ga0070674_100286113 3300005356 Bacteria 1309
47 Ga0070673_100029423 3300005364 Bacteria 4096
48 Ga0070673_100056234 3300005364 Bacteria 3104
49 Ga0070673_100138082 3300005364 Bacteria 2054
50 Ga0070673_101408499 3300005364 Unclassified 656
51 Ga0070688_100032948 3300005365 Bacteria 3129
52 Ga0070688_100039401 3300005365 Unclassified 2891
53 Ga0070688_100340554 3300005365 Bacteria 1095
54 Ga0070659_100134390 3300005366 Bacteria 2011
55 Ga0070659_100871938 3300005366 Bacteria 785
56 Ga0070667_101384621 3300005367 Unclassified 660
57 Ga0070667_101413642 3300005367 Unclassified 653
58 Ga0070667_101768928 3300005367 Bacteria 581
59 Ga0070710_10316540 3300005437 Bacteria 1023
60 Ga0070701_10081234 3300005438 Bacteria 1755
61 Ga0070701_10215868 3300005438 Unclassified 1141
62 Ga0070711_100132880 3300005439 Unclassified 1856
63 Ga0070705_100784368 3300005440 Bacteria 757
64 Ga0070700_100008603 3300005441 Bacteria 5561
65 Ga0070700_100014388 3300005441 Bacteria 4468
66 Ga0070694_100684221 3300005444 Bacteria 833
67 Ga0070708_100618468 3300005445 Bacteria 1021
68 Ga0070708_102188056 3300005445 Unclassified 511
69 Ga0070663_100285729 3300005455 Bacteria 1316
70 Ga0070663_100797344 3300005455 Bacteria 810
71 Ga0070678_100022079 3300005456 Bacteria 4207
72 Ga0070678_100082364 3300005456 Unclassified 2442
73 Ga0070678_100116661 3300005456 Unclassified 2098
74 Ga0070662_100597801 3300005457 Bacteria 928
75 Ga0070662_101367978 3300005457 Unclassified 610
76 Ga0070681_10054777 3300005458 Bacteria 3974
77 Ga0068867_100018871 3300005459 Bacteria 4907
78 Ga0068867_100869642 3300005459 Bacteria 809
79 Ga0068867_101953911 3300005459 Bacteria 554
80 Ga0070685_10017793 3300005466 Bacteria 3811
81 Ga0070685_10259954 3300005466 Bacteria 1154
82 Ga0070685_10877914 3300005466 Unclassified 666
83 Ga0070706_100111736 3300005467 Bacteria 2543
84 Ga0070707_100423849 3300005468 Bacteria 1291
85 Ga0070698_100223348 3300005471 Bacteria 1817
86 Ga0070699_100022517 3300005518 Bacteria 5431
87 Ga0070699_100614028 3300005518 Bacteria 992
88 Ga0070699_100829844 3300005518 Unclassified 846
89 Ga0070679_100193248 3300005530 Bacteria 2003
90 Ga0070679_100405058 3300005530 Bacteria 1310
91 Ga0070684_101370325 3300005535 Bacteria 666
92 Ga0070697_100251502 3300005536 Bacteria 1511
93 Ga0070697_100790809 3300005536 Bacteria 839
94 Ga0068853_102156418 3300005539 Unclassified 540
95 Ga0070672_100128393 3300005543 Bacteria 2081
96 Ga0070672_100730779 3300005543 Bacteria 868
97 Ga0070672_100767912 3300005543 Unclassified 847
98 Ga0070686_100151996 3300005544 Bacteria 1622
99 Ga0070686_100581692 3300005544 Bacteria 880
100 Ga0070696_100068429 3300005546 Bacteria 2493
101 Ga0070693_100462689 3300005547 Bacteria 892
102 Ga0070665_100127715 3300005548 Bacteria 2545
103 Ga0070665_100181311 3300005548 Unclassified 2107
104 Ga0070704_100061011 3300005549 Unclassified 2697
105 Ga0070704_102029628 3300005549 Unclassified 534
106 Ga0068855_100007379 3300005563 Bacteria 13314
107 Ga0068855_100533007 3300005563 Bacteria 1273
108 Ga0070664_100712831 3300005564 Unclassified 935
109 Ga0068857_101225060 3300005577 Unclassified 727
110 Ga0068854_100087091 3300005578 Bacteria 2316
111 Ga0068854_100302841 3300005578 Unclassified 1294
112 Ga0068854_100984125 3300005578 Unclassified 746
113 Ga0070702_100509270 3300005615 Bacteria 885
114 Ga0068852_100152900 3300005616 Unclassified 2148
115 Ga0068852_100319590 3300005616 Bacteria 1507
116 Ga0068852_100949302 3300005616 Bacteria 878
117 Ga0068852_101618375 3300005616 Unclassified 670
118 Ga0068859_100421973 3300005617 Bacteria 1430
119 Ga0068859_101077453 3300005617 Bacteria 884
120 Ga0068866_10780643 3300005718 Bacteria 662
121 Ga0068861_100143778 3300005719 Unclassified 1950
122 Ga0068861_100296927 3300005719 Unclassified 1398
123 Ga0068851_10291750 3300005834 Bacteria 935
124 Ga0068870_10670857 3300005840 Bacteria 712
125 Ga0068863_100022254 3300005841 Bacteria 6052
126 Ga0068863_102454926 3300005841 Unclassified 531
127 Ga0068858_100708386 3300005842 Unclassified 980
128 Ga0068858_100792338 3300005842 Bacteria 924
129 Ga0068858_101870618 3300005842 Unclassified 593
130 Ga0068860_100892821 3300005843 Unclassified 905
131 Ga0068862_100064696 3300005844 Bacteria 3149
132 Ga0068862_100685394 3300005844 Bacteria 991
133 Ga0068862_101238635 3300005844 Bacteria 746
134 Ga0068862_101743877 3300005844 Unclassified 631
135 Ga0081539_10004021 3300005985 Bacteria 16902
136 Ga0075365_10462022 3300006038 Bacteria 897
137 Ga0075363_100189342 3300006048 Bacteria 1173
138 Ga0075364_10139606 3300006051 Bacteria 1629
139 Ga0070715_10572473 3300006163 Bacteria 658
140 Ga0075367_10074861 3300006178 Unclassified 2041
141 Ga0075367_10858569 3300006178 Bacteria 578
142 Ga0075366_10076388 3300006195 Unclassified 1999
143 Ga0097621_100037372 3300006237 Bacteria 3890
144 Ga0097621_100675648 3300006237 Unclassified 949
145 Ga0075370_10032642 3300006353 Bacteria 2911
146 Ga0075370_10785880 3300006353 Unclassified 580
147 Ga0068871_100195551 3300006358 Bacteria 1744
148 Ga0068871_100542954 3300006358 Unclassified 1052
149 Ga0075428_100009916 3300006844 Bacteria 10582
150 Ga0075428_100468069 3300006844 Bacteria 1349
151 Ga0075428_101081928 3300006844 Bacteria 847
152 Ga0075428_102434138 3300006844 Unclassified 537
153 Ga0075430_100073666 3300006846 Bacteria 2863
154 Ga0075430_100248432 3300006846 Unclassified 1474
155 Ga0075431_100017442 3300006847 Bacteria 7296
156 Ga0075431_100031325 3300006847 Bacteria 5478
157 Ga0075431_100282341 3300006847 Unclassified 1681
158 Ga0075431_100347151 3300006847 Bacteria 1493
159 Ga0075431_101526804 3300006847 Unclassified 626
160 Ga0075433_10056514 3300006852 Bacteria 3428
161 Ga0075433_10928515 3300006852 Bacteria 759
162 Ga0075434_100388249 3300006871 Bacteria 1417
163 Ga0075434_100450166 3300006871 Bacteria 1309
164 Ga0075434_101057552 3300006871 Bacteria 825
165 Ga0075434_101509864 3300006871 Unclassified 681
166 Ga0075429_100223665 3300006880 Unclassified 1649
167 Ga0075429_100463003 3300006880 Unclassified 1111
168 Ga0075429_100578409 3300006880 Bacteria 984
169 Ga0075429_100735487 3300006880 Bacteria 864
170 Ga0075429_101394450 3300006880 Unclassified 610
171 Ga0075429_101560619 3300006880 Unclassified 574
172 Ga0075429_101667145 3300006880 Bacteria 554
173 Ga0068865_100386384 3300006881 Bacteria 1143
174 Ga0068865_102165201 3300006881 Bacteria 506
175 Ga0075436_100451408 3300006914 Bacteria 936
176 Ga0097620_100421944 3300006931 Bacteria 1430
177 Ga0097620_101077459 3300006931 Bacteria 884
178 Ga0075435_100001904 3300007076 Bacteria 13584
179 Ga0075435_100002097 3300007076 Bacteria 13103
180 Ga0075435_100507834 3300007076 Unclassified 1042
181 Ga0075435_100888792 3300007076 Bacteria 777
182 Ga0075435_101069206 3300007076 Bacteria 705
183 Ga0075435_101462162 3300007076 Bacteria 599
184 Ga0105240_10122521 3300009093 Bacteria 3129
185 Ga0105240_10284554 3300009093 Unclassified 1898
186 Ga0105240_10735671 3300009093 Unclassified 1074
187 Ga0111539_10135228 3300009094 Unclassified 2887
188 Ga0111539_10361684 3300009094 Unclassified 1689
189 Ga0111539_10576470 3300009094 Unclassified 1310
190 Ga0105245_11018281 3300009098 Bacteria 873
191 Ga0105245_11748339 3300009098 Unclassified 674
192 Ga0114129_10001074 3300009147 Bacteria 35913
193 Ga0114129_10019536 3300009147 Bacteria 9647
194 Ga0114129_10037634 3300009147 Bacteria 6831
195 Ga0114129_10134108 3300009147 Bacteria 3399
196 Ga0114129_10232723 3300009147 Bacteria 2481
197 Ga0114129_11107050 3300009147 Bacteria 991
198 Ga0105243_10158821 3300009148 Unclassified 1947
199 Ga0105243_10702795 3300009148 Bacteria 986
200 Ga0105241_11220200 3300009174 Bacteria 713
201 Ga0105242_10045312 3300009176 Bacteria 3564
202 Ga0105242_10058819 3300009176 Unclassified 3152
203 Ga0105242_10256057 3300009176 Unclassified 1579
204 Ga0105242_10624895 3300009176 Bacteria 1044
205 Ga0105248_10009739 3300009177 Bacteria 10586
206 Ga0105248_10028108 3300009177 Bacteria 6264
207 Ga0105248_10082261 3300009177 Bacteria 3620
208 Ga0105248_10098470 3300009177 Bacteria 3295
209 Ga0105248_10168002 3300009177 Bacteria 2473
210 Ga0105248_11229113 3300009177 Bacteria 847
211 Ga0105248_11434612 3300009177 Bacteria 781
212 Ga0105248_12285390 3300009177 Unclassified 616
213 Ga0105238_10037278 3300009551 Bacteria 4943
214 Ga0105238_10306876 3300009551 Bacteria 1571
215 Ga0105249_10080782 3300009553 Bacteria 3021
216 Ga0105249_10287030 3300009553 Bacteria 1646
217 Ga0105249_12329052 3300009553 Bacteria 608
218 Ga0105239_10083712 3300010375 Bacteria 3513
219 Ga0105239_12306537 3300010375 Bacteria 626
220 Ga0105246_10043695 3300011119 Bacteria 3041
221 Ga0105246_11495141 3300011119 Bacteria 634
222 Ga0157374_10944943 3300013296 Unclassified 880
223 Ga0157378_10809099 3300013297 Bacteria 963
224 Ga0157378_11039528 3300013297 Unclassified 854
225 Ga0157378_11228571 3300013297 Bacteria 789
226 Ga0157378_12218649 3300013297 Unclassified 600
227 Ga0157378_12509624 3300013297 Unclassified 567
228 Ga0163162_11025689 3300013306 Bacteria 933
229 Ga0157375_10054670 3300013308 Bacteria 3933
230 Ga0157375_10664382 3300013308 Unclassified 1198
231 Ga0157375_10826826 3300013308 Unclassified 1074
232 Ga0163163_10090927 3300014325 Bacteria 3066
233 Ga0163163_10379768 3300014325 Bacteria 1470
234 Ga0157380_10236173 3300014326 Bacteria 1645
235 Ga0157380_10403387 3300014326 Bacteria 1298
236 Ga0157380_12540699 3300014326 Unclassified 578
237 Ga0157380_12575841 3300014326 Bacteria 575
238 Ga0157379_11991799 3300014968 Unclassified 574
239 Ga0157376_10100081 3300014969 Bacteria 2531
240 Ga0157376_12314555 3300014969 Bacteria 576
241 Ga0163161_11288572 3300017792 Unclassified 635
242 Ga0197907_10293049 3300020069 Bacteria 591
243 Ga0206353_10749499 3300020082 Unclassified 566
244 Ga0224712_10483994 3300022467 Unclassified 597
245 Ga0207682_10553618 3300025893 Bacteria 544
246 Ga0207642_10410994 3300025899 Bacteria 812
247 Ga0207642_10650218 3300025899 Unclassified 660
248 Ga0207680_10356697 3300025903 Unclassified 1028
249 Ga0207680_10420696 3300025903 Unclassified 946
250 Ga0207645_10026445 3300025907 Bacteria 3751
251 Ga0207645_10376770 3300025907 Bacteria 952
252 Ga0207645_10473873 3300025907 Bacteria 846
253 Ga0207643_10586237 3300025908 Bacteria 717
254 Ga0207643_10952861 3300025908 Unclassified 556
255 Ga0207684_10067160 3300025910 Bacteria 3047
256 Ga0207707_10202698 3300025912 Bacteria 1729
257 Ga0207707_11350606 3300025912 Unclassified 571
258 Ga0207695_10156148 3300025913 Bacteria 2216
259 Ga0207663_10357012 3300025916 Bacteria 1108
260 Ga0207660_10777827 3300025917 Bacteria 781
261 Ga0207662_10017826 3300025918 Bacteria 4020
262 Ga0207662_10136012 3300025918 Bacteria 1553
263 Ga0207657_10005038 3300025919 Bacteria 13860
264 Ga0207652_10675682 3300025921 Bacteria 922
265 Ga0207646_10101694 3300025922 Bacteria 2577
266 Ga0207681_10162491 3300025923 Bacteria 1685
267 Ga0207681_10607199 3300025923 Unclassified 904
268 Ga0207694_10265672 3300025924 Bacteria 1406
269 Ga0207694_10439778 3300025924 Bacteria 1088
270 Ga0207650_10477111 3300025925 Bacteria 1040
271 Ga0207650_11143063 3300025925 Bacteria 663
272 Ga0207650_11246988 3300025925 Unclassified 633
273 Ga0207659_10035823 3300025926 Bacteria 3433
274 Ga0207659_10149600 3300025926 Bacteria 1822
275 Ga0207659_10171781 3300025926 Unclassified 1710
276 Ga0207659_10178960 3300025926 Unclassified 1678
277 Ga0207659_11932909 3300025926 Bacteria 500
278 Ga0207644_10537176 3300025931 Bacteria 967
279 Ga0207644_11472922 3300025931 Bacteria 571
280 Ga0207690_10785698 3300025932 Bacteria 786
281 Ga0207706_10067898 3300025933 Bacteria 3138
282 Ga0207706_10123591 3300025933 Bacteria 2276
283 Ga0207686_10516332 3300025934 Bacteria 929
284 Ga0207686_10713096 3300025934 Bacteria 798
285 Ga0207670_10039935 3300025936 Bacteria 3077
286 Ga0207670_11185034 3300025936 Bacteria 646
287 Ga0207669_10237550 3300025937 Bacteria 1349
288 Ga0207669_10266398 3300025937 Bacteria 1284
289 Ga0207669_10705377 3300025937 Unclassified 830
290 Ga0207704_11259160 3300025938 Unclassified 632
291 Ga0207704_11387607 3300025938 Bacteria 602
292 Ga0207691_10159289 3300025940 Bacteria 1981
293 Ga0207691_10372357 3300025940 Bacteria 1220
294 Ga0207711_10075481 3300025941 Unclassified 2934
295 Ga0207711_10083598 3300025941 Bacteria 2793
296 Ga0207711_10132014 3300025941 Bacteria 2240
297 Ga0207711_10413985 3300025941 Bacteria 1253
298 Ga0207711_10481015 3300025941 Bacteria 1157
299 Ga0207689_10042610 3300025942 Bacteria 3753
300 Ga0207661_10421864 3300025944 Bacteria 1212
301 Ga0207661_12145028 3300025944 Bacteria 505
302 Ga0207679_10341724 3300025945 Bacteria 1302
303 Ga0207667_10052951 3300025949 Bacteria 4272
304 Ga0207667_10279804 3300025949 Unclassified 1705
305 Ga0207651_10012940 3300025960 Bacteria 4749
306 Ga0207651_10240536 3300025960 Unclassified 1475
307 Ga0207651_10453579 3300025960 Unclassified 1100
308 Ga0207712_10832068 3300025961 Bacteria 813
309 Ga0207668_10049142 3300025972 Bacteria 2898
310 Ga0207668_10768982 3300025972 Unclassified 851
311 Ga0207640_10303857 3300025981 Bacteria 1263
312 Ga0207640_10547845 3300025981 Bacteria 971
313 Ga0207658_10710405 3300025986 Bacteria 909
314 Ga0207658_11745766 3300025986 Bacteria 568
315 Ga0207658_11746979 3300025986 Bacteria 568
316 Ga0207677_10061791 3300026023 Bacteria 2596
317 Ga0207677_10117480 3300026023 Bacteria 1994
318 Ga0207677_10769945 3300026023 Unclassified 859
319 Ga0207677_10838688 3300026023 Unclassified 825
320 Ga0207703_10333437 3300026035 Bacteria 1392
321 Ga0207639_11161541 3300026041 Unclassified 724
322 Ga0207639_11619711 3300026041 Bacteria 607
323 Ga0207678_10293271 3300026067 Bacteria 1397
324 Ga0207678_10833730 3300026067 Bacteria 814
325 Ga0207708_10016438 3300026075 Bacteria 5564
326 Ga0207708_10144961 3300026075 Unclassified 1865
327 Ga0207641_10030547 3300026088 Bacteria 4464
328 Ga0207648_10021684 3300026089 Bacteria 5772
329 Ga0207648_10600689 3300026089 Bacteria 1014
330 Ga0207648_11774810 3300026089 Bacteria 579
331 Ga0207676_10034177 3300026095 Bacteria 3848
332 Ga0207674_11592863 3300026116 Unclassified 622
333 Ga0207675_100016375 3300026118 Bacteria 6920
334 Ga0207675_100212124 3300026118 Unclassified 1863
335 Ga0207675_100388027 3300026118 Bacteria 1374
336 Ga0207675_101809350 3300026118 Bacteria 630
337 Ga0207683_10010151 3300026121 Bacteria 8035
338 Ga0207683_10019421 3300026121 Bacteria 5804
339 Ga0207683_10109192 3300026121 Unclassified 2476
340 Ga0209813_10174937 3300027866 Bacteria 782
341 Ga0268266_10072213 3300028379 Bacteria 2992
342 Ga0268266_10217236 3300028379 Bacteria 1756
343 Ga0268265_10337666 3300028380 Bacteria 1371
344 Ga0268265_10678219 3300028380 Bacteria 993
345 Ga0268265_11547917 3300028380 Bacteria 667
346 Ga0268264_10647509 3300028381 Unclassified 1045
347 Ga0307408_100065025 3300031548 Unclassified 2674
348 Ga0307408_100068753 3300031548 Unclassified 2609
349 Ga0307408_100197569 3300031548 Unclassified 1625
350 Ga0307405_11236021 3300031731 Unclassified 647
351 Ga0307407_10086499 3300031903 Bacteria 1910
352 Ga0307412_10607175 3300031911 Unclassified 927
353 Ga0307412_11896643 3300031911 Unclassified 550
354 Ga0307409_100147818 3300031995 Bacteria 2035
355 Ga0307409_100607943 3300031995 Unclassified 1081
356 Ga0307416_100067500 3300032002 Bacteria 2950
357 Ga0307416_100108042 3300032002 Unclassified 2443
358 Ga0307416_100349922 3300032002 Unclassified 1495
359 Ga0307416_100537083 3300032002 Unclassified 1240
360 Ga0307416_103100008 3300032002 Bacteria 556
361 Ga0307415_100052798 3300032126 Bacteria 2766
362 Ga0307415_100353236 3300032126 Bacteria 1238
363 Ga0373948_0002401 3300034817 Bacteria 2762
364 Ga0373950_0000255 3300034818 Bacteria 6751
365 Ga0373958_0043483 3300034819 Bacteria 926
366 Ga0373959_0010304 3300034820 Bacteria 1630
367 Ga0373938_0050871 3300034957 Bacteria 946
368 Ga0373928_0000485 3300035084 Bacteria 7820
369 Ga0373929_0001531 3300035085 Bacteria 4391
370 Ga0373940_0001164 3300035088 Bacteria 4613
371 Ga0373949_0002945 3300035090 Bacteria 4192
372 Ga0373949_0073465 3300035090 Bacteria 900
373 Ga0373951_0000350 3300035091 Bacteria 13996
374 Ga0373952_0001624 3300035092 Bacteria 4090
375 Ga0373932_0000291 3300035112 Bacteria 15116
376 Ga0373939_0001713 3300035114 Bacteria 5288
377 Ga0373941_0001486 3300035115 Bacteria 4960
378 Ga0373953_0148413 3300035117 Bacteria 1004
379 Ga0373960_0003269 3300035121 Bacteria 3666
380 Ga0373942_0004824 3300035207 Bacteria 3130
381 Ga0373942_0131781 3300035207 Bacteria 789
382 Ga0373961_0008923 3300035241 Bacteria 2445
383 Ga0373962_0012068 3300035242 Bacteria 2173
384 Ga0373931_0106090 3300035691 Bacteria 1587
385 Ga0373931_0380482 3300035691 Unclassified 890
386 Ga0373931_0688805 3300035691 Unclassified 674
387 Ga0395898_0776637 3300037466 Bacteria 899
388 Ga0436365_1635131 3300039437 Unclassified 2694
389 Ga0439439_0098941 3300041406 Bacteria 802
390 Ga0439453_0163931 3300041408 Unclassified 534
391 Ga0439433_0113982 3300041999 Bacteria 678
392 Ga0439462_0052802 3300042015 Bacteria 1094
393 Ga0450913_024882 3300042117 Unclassified 567
394 Ga0450891_007920 3300042129 Bacteria 975
395 Ga0439446_0008628 3300042156 Unclassified 2712
396 Ga0439434_0038334 3300042435 Bacteria 1468
397 Ga0439435_0057183 3300042436 Unclassified 1129
398 Ga0439435_0094928 3300042436 Unclassified 910
399 Ga0439444_0055953 3300042437 Unclassified 812
400 Ga0439460_0044668 3300042461 Bacteria 1312
401 Ga0439460_0130806 3300042461 Unclassified 827
402 Ga0466963_0025523 3300044694 Bacteria 3770
403 Ga0466963_0984151 3300044694 Unclassified 594
404 Ga0451576_0005402 3300045051 Bacteria 16044
405 Ga0451576_0269545 3300045051 Bacteria 1780
406 Ga0466967_0274171 3300045976 Bacteria 1617
407 Ga0466967_0864184 3300045976 Bacteria 899
408 Ga0495629_0519028 3300046459 Bacteria 802
409 Ga0495629_0657596 3300046459 Bacteria 698
410 Ga0495582_0455357 3300046473 Bacteria 739
411 Ga0495639_0224131 3300046475 Unclassified 925
412 Ga0495664_0159429 3300046477 Bacteria 1369
413 Ga0495642_0550404 3300046528 Unclassified 512
414 Ga0495640_0035340 3300046533 Bacteria 3537
415 Ga0495586_0166748 3300046535 Unclassified 1243
416 Ga0495586_0199981 3300046535 Unclassified 1133
417 Ga0495634_0028588 3300046642 Bacteria 3869
418 Ga0495635_0058934 3300046663 Unclassified 2641
419 Ga0495647_0119977 3300046681 Bacteria 1105
420 Ga0495647_0194359 3300046681 Bacteria 888
421 Ga0495647_0388218 3300046681 Bacteria 640
422 Ga0495669_0343658 3300046684 Bacteria 721
423 Ga0495613_0481437 3300046689 Bacteria 838
424 Ga0495674_0397046 3300047319 Bacteria 1114
425 Ga0495684_0569331 3300047471 Bacteria 769
426 Ga0496100_0283510 3300048903 Bacteria 1236
427 Ga0496100_1357614 3300048903 Unclassified 561
428 Ga0496102_1112905 3300048905 Unclassified 710
429 Ga0496104_0013987 3300048907 Bacteria 7240
430 Ga0496106_0055802 3300048909 Bacteria 2986
431 Ga0496106_0571868 3300048909 Unclassified 906
432 Ga0496106_0745737 3300048909 Bacteria 779
433 Ga0496107_0524791 3300048910 Bacteria 878
434 Ga0496108_0013111 3300048911 Bacteria 6757
435 Ga0496109_0028880 3300048912 Bacteria 4965
436 Ga0496109_0198579 3300048912 Bacteria 1886
437 Ga0496109_1604391 3300048912 Bacteria 585
438 Ga0496110_0271473 3300048913 Bacteria 1544
439 Ga0496112_0037727 3300048915 Bacteria 4717
440 Ga0496112_0122490 3300048915 Unclassified 2571
441 Ga0496112_1609517 3300048915 Unclassified 563
442 Ga0496113_0229439 3300048916 Bacteria 1480
443 Ga0496113_0471572 3300048916 Bacteria 1009
444 Ga0501031_0074793 3300049568 Unclassified 2206
445 Ga0501031_0235373 3300049568 Unclassified 1191
446 Ga0501033_0232847 3300049570 Unclassified 1308
447 Ga0501034_0004981 3300049571 Bacteria 14616
448 Ga0501034_0109613 3300049571 Bacteria 2752
449 Ga0501036_0205457 3300049572 Unclassified 1656
450 Ga0501036_1023037 3300049572 Bacteria 676
451 Ga0501037_0723157 3300049573 Unclassified 661
452 Ga0501038_0479084 3300049574 Unclassified 954
453 Ga0501039_0515527 3300049575 Bacteria 939
454 Ga0501040_0967130 3300049576 Bacteria 617
455 Ga0501041_0127614 3300049577 Unclassified 1584
456 Ga0501041_0221063 3300049577 Unclassified 1188
457 Ga0501041_1113102 3300049577 Bacteria 509
458 Ga0501042_0066655 3300049578 Unclassified 2574
459 Ga0501042_0824157 3300049578 Unclassified 675
460 Ga0501043_0148635 3300049579 Unclassified 1834
461 Ga0501046_0133708 3300049580 Unclassified 1880
462 Ga0501046_1107935 3300049580 Bacteria 547
463 Ga0501047_0045937 3300049581 Bacteria 4222
464 Ga0501047_0222776 3300049581 Bacteria 1742
465 Ga0501047_0663281 3300049581 Bacteria 862
466 Ga0501048_0573215 3300049582 Bacteria 810
467 Ga0501048_0602993 3300049582 Bacteria 788
468 Ga0501067_0148512 3300049583 Unclassified 1306
469 Ga0501070_0420850 3300049586 Bacteria 1079
470 Ga0501070_1309360 3300049586 Unclassified 553
471 Ga0501071_0164332 3300049587 Bacteria 1660
472 Ga0501071_0277646 3300049587 Bacteria 1268
473 Ga0501071_1055570 3300049587 Unclassified 628
474 Ga0501071_1112964 3300049587 Unclassified 610
475 Ga0501072_0024121 3300049588 Unclassified 4729
476 Ga0501072_0069445 3300049588 Unclassified 2782
477 Ga0501072_0157665 3300049588 Bacteria 1810
478 Ga0501072_0551680 3300049588 Unclassified 910
479 Ga0501072_0552041 3300049588 Bacteria 910
480 Ga0501073_0034031 3300049589 Bacteria 3627
481 Ga0501073_0509384 3300049589 Unclassified 832
482 Ga0501073_0881820 3300049589 Bacteria 616
483 Ga0501074_0373053 3300049590 Unclassified 1012
484 Ga0501075_0032955 3300049591 Bacteria 3853
485 Ga0501075_0050843 3300049591 Bacteria 3116
486 Ga0501075_0121382 3300049591 Bacteria 1989
487 Ga0501076_0282504 3300049592 Bacteria 1360
488 Ga0501076_0529205 3300049592 Unclassified 972
489 Ga0501076_0591634 3300049592 Bacteria 915
490 Ga0501076_0648796 3300049592 Unclassified 871
491 Ga0501076_0798360 3300049592 Unclassified 779
492 Ga0501077_0064138 3300049593 Unclassified 2330
493 Ga0501077_0110457 3300049593 Bacteria 1742
494 Ga0501077_0353981 3300049593 Bacteria 937
495 Ga0501077_0924334 3300049593 Unclassified 561
496 Ga0501221_246058 3300049704 Bacteria 512
497 Ga0501079_0054312 3300049741 Bacteria 3090
498 Ga0501079_0377783 3300049741 Unclassified 1111
499 Ga0501079_0952697 3300049741 Unclassified 676
500 Ga0501081_0121752 3300049743 Bacteria 1859
501 Ga0501083_0073725 3300049744 Unclassified 2269
502 Ga0501083_0520335 3300049744 Bacteria 774
503 Ga0501044_0155620 3300049823 Bacteria 2265
504 Ga0501045_0219379 3300049824 Unclassified 1416
505 nmdc:mga00v17_136513_c1 3300050491 Bacteria 1571
506 nmdc:mga0yw44_548850_c1 3300050492 Bacteria 785
507 nmdc:mga0k408_89174_c1 3300050493 Unclassified 1811
508 nmdc:mga06z11_2358_c1 3300050494 Bacteria 7190
509 nmdc:mga04h51_201708_c1 3300050495 Bacteria 782
510 nmdc:mga07m45_137041_c1 3300050496 Bacteria 1417
511 nmdc:mga05p37_110744_c1 3300050507 Bacteria 3377
512 nmdc:mga05p37_1345563_c1 3300050507 Bacteria 724
513 nmdc:mga05p37_1350_c2 3300050507 Bacteria 18574
514 nmdc:mga05p37_19058_c1 3300050507 Bacteria 8298
515 nmdc:mga05p37_196442_c1 3300050507 Bacteria 2446
516 nmdc:mga05p37_95330_c1 3300050507 Bacteria 3666
517 nmdc:mga09592_1007953_c1 3300050508 Bacteria 696
518 nmdc:mga09592_142614_c1 3300050508 Bacteria 2065
519 nmdc:mga09592_149445_c1 3300050508 Bacteria 2015
520 nmdc:mga09592_1562215_c1 3300050508 Unclassified 535
521 nmdc:mga09592_1704403_c1 3300050508 Unclassified 508
522 nmdc:mga09592_449889_c1 3300050508 Unclassified 1111
523 nmdc:mga09592_628521_c1 3300050508 Bacteria 918
524 nmdc:mga0qj67_265309_c1 3300050509 Bacteria 1393
525 nmdc:mga0qj67_506444_c1 3300050509 Bacteria 970
526 nmdc:mga06r32_128439_c1 3300050510 Unclassified 2505
527 nmdc:mga06r32_158291_c1 3300050510 Unclassified 2247
528 nmdc:mga06r32_1824690_c1 3300050510 Bacteria 543
529 nmdc:mga06r32_323191_c1 3300050510 Unclassified 1528
530 nmdc:mga06r32_54812_c1 3300050510 Unclassified 3823
531 nmdc:mga08y16_504221_c1 3300050511 Unclassified 1229
532 nmdc:mga08y16_93269_c1 3300050511 Bacteria 3137
533 nmdc:mga0n895_362133_c1 3300050512 Bacteria 1468
534 nmdc:mga0n895_461034_c1 3300050512 Unclassified 1283
535 nmdc:mga0n895_477056_c1 3300050512 Archaea 1258
536 nmdc:mga0n895_841427_c1 3300050512 Bacteria 906
537 nmdc:mga0rr50_1007444_c1 3300050513 Unclassified 710
538 nmdc:mga0rr50_18164_c1 3300050513 Bacteria 4717
539 nmdc:mga0rr50_913_c1 3300050513 Bacteria 15979
540 nmdc:mga08x19_22182_c1 3300050514 Bacteria 3930
541 nmdc:mga08x19_242145_c1 3300050514 Bacteria 1243
542 nmdc:mga08x19_413404_c1 3300050514 Bacteria 947
543 nmdc:mga0a205_41566_c1 3300050515 Bacteria 4427
544 nmdc:mga0a205_41738_c1 3300050515 Bacteria 4419
545 nmdc:mga0a205_579861_c1 3300050515 Bacteria 975
546 Ga0501084_0057505 3300054114 Unclassified 3254
547 Ga0501084_0196288 3300054114 Bacteria 1703
548 Ga0501084_1161259 3300054114 Unclassified 648
549 Ga0590074_009159 3300059423 Unclassified 1650
550 Ga0590075_000419 3300059424 Bacteria 11513
551 Ga0590075_053086 3300059424 Unclassified 1041
552 Ga0590075_112375 3300059424 Unclassified 711
553 Ga0590075_218207 3300059424 Unclassified 505
554 Ga0590077_000231 3300059426 Bacteria 16046
555 Ga0590077_025105 3300059426 Unclassified 1282
556 Ga0590077_038699 3300059426 Unclassified 1056
557 Ga0590077_052844 3300059426 Bacteria 914
558 Ga0590077_081991 3300059426 Unclassified 743
559 Ga0590077_106715 3300059426 Unclassified 657
560 Ga0501082_0090720 3300060353 Bacteria 2639
561 Ga0501082_0125041 3300060353 Unclassified 2230
562 Ga0501082_0661414 3300060353 Unclassified 914
563 Ga0501082_1244246 3300060353 Bacteria 650
564 Ga0501082_1399742 3300060353 Bacteria 611
565 Ga0501082_1825157 3300060353 Unclassified 530
566 Ga0530510_0503665 3300061734 Unclassified 918
567 Ga0501039_0377270
568 MRS1b_contig_2768644
569 JGI25406J46586_10081752
570 Ga0058863_11295950
571 Ga0058861_10648149
572 Ga0065712_10000522
573 Ga0065715_10000462
574 Ga0065715_10027879
575 Ga0065715_10557957
576 Ga0065715_11127457
577 Ga0065707_10215867
578 Ga0065707_10244172
579 Ga0070676_10085347
580 Ga0070683_100122653
581 Ga0070690_100010413
582 Ga0070690_100952805
583 Ga0070670_100011153
584 Ga0070670_100735753
585 Ga0070677_10018322
586 Ga0070677_10169931
587 Ga0068869_102010313
588 Ga0070666_10395015
589 Ga0070680_100735900
590 Ga0070682_101936936
591 Ga0068868_100051926
592 Ga0068868_100206916
593 Ga0068868_101068771
594 Ga0068868_101780866
595 Ga0070660_100004982
596 Ga0070689_100030207
597 Ga0070689_100065053
598 Ga0070691_10982964
599 Ga0070687_100394614
600 Ga0070668_100053250
601 Ga0070668_101038670
602 Ga0070669_100201625
603 Ga0070669_100270487
604 Ga0070669_100281048
605 Ga0070675_100077668
606 Ga0070675_100292475
607 Ga0070675_100744095
608 Ga0070675_102105984
609 Ga0070671_100112105
610 Ga0070671_100212220
611 Ga0070674_100185227
612 Ga0070674_100286113
613 Ga0070673_100029423
614 Ga0070673_100056234
615 Ga0070673_100138082
616 Ga0070673_101408499
617 Ga0070688_100032948
618 Ga0070688_100039401
619 Ga0070688_100340554
620 Ga0070659_100134390
621 Ga0070659_100871938
622 Ga0070667_101384621
623 Ga0070667_101413642
624 Ga0070667_101768928
625 Ga0070710_10316540
626 Ga0070701_10081234
627 Ga0070701_10215868
628 Ga0070711_100132880
629 Ga0070705_100784368
630 Ga0070700_100008603
631 Ga0070700_100014388
632 Ga0070694_100684221
633 Ga0070708_100618468
634 Ga0070708_102188056
635 Ga0070663_100285729
636 Ga0070663_100797344
637 Ga0070678_100022079
638 Ga0070678_100082364
639 Ga0070678_100116661
640 Ga0070662_100597801
641 Ga0070662_101367978
642 Ga0070681_10054777
643 Ga0068867_100018871
644 Ga0068867_100869642
645 Ga0068867_101953911
646 Ga0070685_10017793
647 Ga0070685_10259954
648 Ga0070685_10877914
649 Ga0070706_100111736
650 Ga0070707_100423849
651 Ga0070698_100223348
652 Ga0070699_100022517
653 Ga0070699_100614028
654 Ga0070699_100829844
655 Ga0070679_100193248
656 Ga0070679_100405058
657 Ga0070684_101370325
658 Ga0070697_100251502
659 Ga0070697_100790809
660 Ga0068853_102156418
661 Ga0070672_100128393
662 Ga0070672_100730779
663 Ga0070672_100767912
664 Ga0070686_100151996
665 Ga0070686_100581692
666 Ga0070696_100068429
667 Ga0070693_100462689
668 Ga0070665_100127715
669 Ga0070665_100181311
670 Ga0070704_100061011
671 Ga0070704_102029628
672 Ga0068855_100007379
673 Ga0068855_100533007
674 Ga0070664_100712831
675 Ga0068857_101225060
676 Ga0068854_100087091
677 Ga0068854_100302841
678 Ga0068854_100984125
679 Ga0070702_100509270
680 Ga0068852_100152900
681 Ga0068852_100319590
682 Ga0068852_100949302
683 Ga0068852_101618375
684 Ga0068859_100421973
685 Ga0068859_101077453
686 Ga0068866_10780643
687 Ga0068861_100143778
688 Ga0068861_100296927
689 Ga0068851_10291750
690 Ga0068870_10670857
691 Ga0068863_100022254
692 Ga0068863_102454926
693 Ga0068858_100708386
694 Ga0068858_100792338
695 Ga0068858_101870618
696 Ga0068860_100892821
697 Ga0068862_100064696
698 Ga0068862_100685394
699 Ga0068862_101238635
700 Ga0068862_101743877
701 Ga0081539_10004021
702 Ga0075365_10462022
703 Ga0075363_100189342
704 Ga0075364_10139606
705 Ga0070715_10572473
706 Ga0075367_10074861
707 Ga0075367_10858569
708 Ga0075366_10076388
709 Ga0097621_100037372
710 Ga0097621_100675648
711 Ga0075370_10032642
712 Ga0075370_10785880
713 Ga0068871_100195551
714 Ga0068871_100542954
715 Ga0075428_100009916
716 Ga0075428_100468069
717 Ga0075428_101081928
718 Ga0075428_102434138
719 Ga0075430_100073666
720 Ga0075430_100248432
721 Ga0075431_100017442
722 Ga0075431_100031325
723 Ga0075431_100282341
724 Ga0075431_100347151
725 Ga0075431_101526804
726 Ga0075433_10056514
727 Ga0075433_10928515
728 Ga0075434_100388249
729 Ga0075434_100450166
730 Ga0075434_101057552
731 Ga0075434_101509864
732 Ga0075429_100223665
733 Ga0075429_100463003
734 Ga0075429_100578409
735 Ga0075429_100735487
736 Ga0075429_101394450
737 Ga0075429_101560619
738 Ga0075429_101667145
739 Ga0068865_100386384
740 Ga0068865_102165201
741 Ga0075436_100451408
742 Ga0097620_100421944
743 Ga0097620_101077459
744 Ga0075435_100001904
745 Ga0075435_100002097
746 Ga0075435_100507834
747 Ga0075435_100888792
748 Ga0075435_101069206
749 Ga0075435_101462162
750 Ga0105240_10122521
751 Ga0105240_10284554
752 Ga0105240_10735671
753 Ga0111539_10135228
754 Ga0111539_10361684
755 Ga0111539_10576470
756 Ga0105245_11018281
757 Ga0105245_11748339
758 Ga0114129_10001074
759 Ga0114129_10019536
760 Ga0114129_10037634
761 Ga0114129_10134108
762 Ga0114129_10232723
763 Ga0114129_11107050
764 Ga0105243_10158821
765 Ga0105243_10702795
766 Ga0105241_11220200
767 Ga0105242_10045312
768 Ga0105242_10058819
769 Ga0105242_10256057
770 Ga0105242_10624895
771 Ga0105248_10009739
772 Ga0105248_10028108
773 Ga0105248_10082261
774 Ga0105248_10098470
775 Ga0105248_10168002
776 Ga0105248_11229113
777 Ga0105248_11434612
778 Ga0105248_12285390
779 Ga0105238_10037278
780 Ga0105238_10306876
781 Ga0105249_10080782
782 Ga0105249_10287030
783 Ga0105249_12329052
784 Ga0105239_10083712
785 Ga0105239_12306537
786 Ga0105246_10043695
787 Ga0105246_11495141
788 Ga0157374_10944943
789 Ga0157378_10809099
790 Ga0157378_11039528
791 Ga0157378_11228571
792 Ga0157378_12218649
793 Ga0157378_12509624
794 Ga0163162_11025689
795 Ga0157375_10054670
796 Ga0157375_10664382
797 Ga0157375_10826826
798 Ga0163163_10090927
799 Ga0163163_10379768
800 Ga0157380_10236173
801 Ga0157380_10403387
802 Ga0157380_12540699
803 Ga0157380_12575841
804 Ga0157379_11991799
805 Ga0157376_10100081
806 Ga0157376_12314555
807 Ga0163161_11288572
808 Ga0197907_10293049
809 Ga0206353_10749499
810 Ga0224712_10483994
811 Ga0207682_10553618
812 Ga0207642_10410994
813 Ga0207642_10650218
814 Ga0207680_10356697
815 Ga0207680_10420696
816 Ga0207645_10026445
817 Ga0207645_10376770
818 Ga0207645_10473873
819 Ga0207643_10586237
820 Ga0207643_10952861
821 Ga0207684_10067160
822 Ga0207707_10202698
823 Ga0207707_11350606
824 Ga0207695_10156148
825 Ga0207663_10357012
826 Ga0207660_10777827
827 Ga0207662_10017826
828 Ga0207662_10136012
829 Ga0207657_10005038
830 Ga0207652_10675682
831 Ga0207646_10101694
832 Ga0207681_10162491
833 Ga0207681_10607199
834 Ga0207694_10265672
835 Ga0207694_10439778
836 Ga0207650_10477111
837 Ga0207650_11143063
838 Ga0207650_11246988
839 Ga0207659_10035823
840 Ga0207659_10149600
841 Ga0207659_10171781
842 Ga0207659_10178960
843 Ga0207659_11932909
844 Ga0207644_10537176
845 Ga0207644_11472922
846 Ga0207690_10785698
847 Ga0207706_10067898
848 Ga0207706_10123591
849 Ga0207686_10516332
850 Ga0207686_10713096
851 Ga0207670_10039935
852 Ga0207670_11185034
853 Ga0207669_10237550
854 Ga0207669_10266398
855 Ga0207669_10705377
856 Ga0207704_11259160
857 Ga0207704_11387607
858 Ga0207691_10159289
859 Ga0207691_10372357
860 Ga0207711_10075481
861 Ga0207711_10083598
862 Ga0207711_10132014
863 Ga0207711_10413985
864 Ga0207711_10481015
865 Ga0207689_10042610
866 Ga0207661_10421864
867 Ga0207661_12145028
868 Ga0207679_10341724
869 Ga0207667_10052951
870 Ga0207667_10279804
871 Ga0207651_10012940
872 Ga0207651_10240536
873 Ga0207651_10453579
874 Ga0207712_10832068
875 Ga0207668_10049142
876 Ga0207668_10768982
877 Ga0207640_10303857
878 Ga0207640_10547845
879 Ga0207658_10710405
880 Ga0207658_11745766
881 Ga0207658_11746979
882 Ga0207677_10061791
883 Ga0207677_10117480
884 Ga0207677_10769945
885 Ga0207677_10838688
886 Ga0207703_10333437
887 Ga0207639_11161541
888 Ga0207639_11619711
889 Ga0207678_10293271
890 Ga0207678_10833730
891 Ga0207708_10016438
892 Ga0207708_10144961
893 Ga0207641_10030547
894 Ga0207648_10021684
895 Ga0207648_10600689
896 Ga0207648_11774810
897 Ga0207676_10034177
898 Ga0207674_11592863
899 Ga0207675_100016375
900 Ga0207675_100212124
901 Ga0207675_100388027
902 Ga0207675_101809350
903 Ga0207683_10010151
904 Ga0207683_10019421
905 Ga0207683_10109192
906 Ga0209813_10174937
907 Ga0268266_10072213
908 Ga0268266_10217236
909 Ga0268265_10337666
910 Ga0268265_10678219
911 Ga0268265_11547917
912 Ga0268264_10647509
913 Ga0307408_100065025
914 Ga0307408_100068753
915 Ga0307408_100197569
916 Ga0307405_11236021
917 Ga0307407_10086499
918 Ga0307412_10607175
919 Ga0307412_11896643
920 Ga0307409_100147818
921 Ga0307409_100607943
922 Ga0307416_100067500
923 Ga0307416_100108042
924 Ga0307416_100349922
925 Ga0307416_100537083
926 Ga0307416_103100008
927 Ga0307415_100052798
928 Ga0307415_100353236
929 Ga0373948_0002401
930 Ga0373950_0000255
931 Ga0373958_0043483
932 Ga0373959_0010304
933 Ga0373938_0050871
934 Ga0373928_0000485
935 Ga0373929_0001531
936 Ga0373940_0001164
937 Ga0373949_0002945
938 Ga0373949_0073465
939 Ga0373951_0000350
940 Ga0373952_0001624
941 Ga0373932_0000291
942 Ga0373939_0001713
943 Ga0373941_0001486
944 Ga0373953_0148413
945 Ga0373960_0003269
946 Ga0373942_0004824
947 Ga0373942_0131781
948 Ga0373961_0008923
949 Ga0373962_0012068
950 Ga0373931_0106090
951 Ga0373931_0380482
952 Ga0373931_0688805
953 Ga0395898_0776637
954 Ga0436365_1635131
955 Ga0439439_0098941
956 Ga0439453_0163931
957 Ga0439433_0113982
958 Ga0439462_0052802
959 Ga0450913_024882
960 Ga0450891_007920
961 Ga0439446_0008628
962 Ga0439434_0038334
963 Ga0439435_0057183
964 Ga0439435_0094928
965 Ga0439444_0055953
966 Ga0439460_0044668
967 Ga0439460_0130806
968 Ga0466963_0025523
969 Ga0466963_0984151
970 Ga0451576_0005402
971 Ga0451576_0269545
972 Ga0466967_0274171
973 Ga0466967_0864184
974 Ga0495629_0519028
975 Ga0495629_0657596
976 Ga0495582_0455357
977 Ga0495639_0224131
978 Ga0495664_0159429
979 Ga0495642_0550404
980 Ga0495640_0035340
981 Ga0495586_0166748
982 Ga0495586_0199981
983 Ga0495634_0028588
984 Ga0495635_0058934
985 Ga0495647_0119977
986 Ga0495647_0194359
987 Ga0495647_0388218
988 Ga0495669_0343658
989 Ga0495613_0481437
990 Ga0495674_0397046
991 Ga0495684_0569331
992 Ga0496100_0283510
993 Ga0496100_1357614
994 Ga0496102_1112905
995 Ga0496104_0013987
996 Ga0496106_0055802
997 Ga0496106_0571868
998 Ga0496106_0745737
999 Ga0496107_0524791
1000 Ga0496108_0013111
1001 Ga0496109_0028880
1002 Ga0496109_0198579
1003 Ga0496109_1604391
1004 Ga0496110_0271473
1005 Ga0496112_0037727
1006 Ga0496112_0122490
1007 Ga0496112_1609517
1008 Ga0496113_0229439
1009 Ga0496113_0471572
1010 Ga0501031_0074793
1011 Ga0501031_0235373
1012 Ga0501033_0232847
1013 Ga0501034_0004981
1014 Ga0501034_0109613
1015 Ga0501036_0205457
1016 Ga0501036_1023037
1017 Ga0501037_0723157
1018 Ga0501038_0479084
1019 Ga0501039_0515527
1020 Ga0501040_0967130
1021 Ga0501041_0127614
1022 Ga0501041_0221063
1023 Ga0501041_1113102
1024 Ga0501042_0066655
1025 Ga0501042_0824157
1026 Ga0501043_0148635
1027 Ga0501046_0133708
1028 Ga0501046_1107935
1029 Ga0501047_0045937
1030 Ga0501047_0222776
1031 Ga0501047_0663281
1032 Ga0501048_0573215
1033 Ga0501048_0602993
1034 Ga0501067_0148512
1035 Ga0501070_0420850
1036 Ga0501070_1309360
1037 Ga0501071_0164332
1038 Ga0501071_0277646
1039 Ga0501071_1055570
1040 Ga0501071_1112964
1041 Ga0501072_0024121
1042 Ga0501072_0069445
1043 Ga0501072_0157665
1044 Ga0501072_0551680
1045 Ga0501072_0552041
1046 Ga0501073_0034031
1047 Ga0501073_0509384
1048 Ga0501073_0881820
1049 Ga0501074_0373053
1050 Ga0501075_0032955
1051 Ga0501075_0050843
1052 Ga0501075_0121382
1053 Ga0501076_0282504
1054 Ga0501076_0529205
1055 Ga0501076_0591634
1056 Ga0501076_0648796
1057 Ga0501076_0798360
1058 Ga0501077_0064138
1059 Ga0501077_0110457
1060 Ga0501077_0353981
1061 Ga0501077_0924334
1062 Ga0501221_246058
1063 Ga0501079_0054312
1064 Ga0501079_0377783
1065 Ga0501079_0952697
1066 Ga0501081_0121752
1067 Ga0501083_0073725
1068 Ga0501083_0520335
1069 Ga0501044_0155620
1070 Ga0501045_0219379
1071 nmdc:mga00v17_136513_c1
1072 nmdc:mga0yw44_548850_c1
1073 nmdc:mga0k408_89174_c1
1074 nmdc:mga06z11_2358_c1
1075 nmdc:mga04h51_201708_c1
1076 nmdc:mga07m45_137041_c1
1077 nmdc:mga05p37_110744_c1
1078 nmdc:mga05p37_1345563_c1
1079 nmdc:mga05p37_1350_c2
1080 nmdc:mga05p37_19058_c1
1081 nmdc:mga05p37_196442_c1
1082 nmdc:mga05p37_95330_c1
1083 nmdc:mga09592_1007953_c1
1084 nmdc:mga09592_142614_c1
1085 nmdc:mga09592_149445_c1
1086 nmdc:mga09592_1562215_c1
1087 nmdc:mga09592_1704403_c1
1088 nmdc:mga09592_449889_c1
1089 nmdc:mga09592_628521_c1
1090 nmdc:mga0qj67_265309_c1
1091 nmdc:mga0qj67_506444_c1
1092 nmdc:mga06r32_128439_c1
1093 nmdc:mga06r32_158291_c1
1094 nmdc:mga06r32_1824690_c1
1095 nmdc:mga06r32_323191_c1
1096 nmdc:mga06r32_54812_c1
1097 nmdc:mga08y16_504221_c1
1098 nmdc:mga08y16_93269_c1
1099 nmdc:mga0n895_362133_c1
1100 nmdc:mga0n895_461034_c1
1101 nmdc:mga0n895_477056_c1
1102 nmdc:mga0n895_841427_c1
1103 nmdc:mga0rr50_1007444_c1
1104 nmdc:mga0rr50_18164_c1
1105 nmdc:mga0rr50_913_c1
1106 nmdc:mga08x19_22182_c1
1107 nmdc:mga08x19_242145_c1
1108 nmdc:mga08x19_413404_c1
1109 nmdc:mga0a205_41566_c1
1110 nmdc:mga0a205_41738_c1
1111 nmdc:mga0a205_579861_c1
1112 Ga0501084_0057505
1113 Ga0501084_0196288
1114 Ga0501084_1161259
1115 Ga0590074_009159
1116 Ga0590075_000419
1117 Ga0590075_053086
1118 Ga0590075_112375
1119 Ga0590075_218207
1120 Ga0590077_000231
1121 Ga0590077_025105
1122 Ga0590077_038699
1123 Ga0590077_052844
1124 Ga0590077_081991
1125 Ga0590077_106715
1126 Ga0501082_0090720
1127 Ga0501082_0125041
1128 Ga0501082_0661414
1129 Ga0501082_1244246
1130 Ga0501082_1399742
1131 Ga0501082_1825157
1132 Ga0530510_0503665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map