F464426

General Info

Members Datasets Scaffolds Average Seq Length
566 219 1132 208

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0753510|Ga0436361_0753510_18695_19396
Length 233
Sequence MKAQGMALASGYSANGGFMGSSPSLIRILTVDDHPLLREGIAALVRGERDMELVAEACDGEEAIKQFRLHRPDVTLMDLQMPHLNGTEAISLIKKEFPNAKIIVLSTYSGDVQVLGAIKAGARGYILKGHVGRELLQAIRAVHAGQKRIPPELAVELADHAGEEELSSREVDVLRLIAAGNANKQIADKLSIGETTVKSHISNILAKLGANDRAHAVTIALQRGIIDLDKRLK

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 1.59
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 16.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0753510 3300039447 Bacteria 26185
2 MRS1b_contig_5417130 2162886011 Bacteria 1785
3 rootL2_10235129 3300003322 Bacteria 5177
4 rootH1_10098489 3300003323 Bacteria 11680
5 rootH1_10252906 3300003323 Bacteria 1965
6 Ga0065715_10148124 3300005293 Bacteria 1758
7 Ga0065715_10349619 3300005293 Bacteria 953
8 Ga0070683_100221332 3300005329 Bacteria 1799
9 Ga0070683_100271907 3300005329 Bacteria 1612
10 Ga0070666_10006819 3300005335 Bacteria 7038
11 Ga0070666_10011797 3300005335 Bacteria 5493
12 Ga0070666_10131768 3300005335 Bacteria 1737
13 Ga0070666_10208901 3300005335 Bacteria 1374
14 Ga0070682_100008126 3300005337 Bacteria 5917
15 Ga0068868_100028432 3300005338 Unclassified 4274
16 Ga0068868_100065803 3300005338 Bacteria 2880
17 Ga0068868_100259752 3300005338 Bacteria 1464
18 Ga0070689_100115405 3300005340 Bacteria 2140
19 Ga0070687_100151263 3300005343 Bacteria 1362
20 Ga0070661_100081436 3300005344 Bacteria 2390
21 Ga0070661_100552623 3300005344 Unclassified 926
22 Ga0070668_100042106 3300005347 Unclassified 3500
23 Ga0070669_100036295 3300005353 Bacteria 3571
24 Ga0070675_100061303 3300005354 Bacteria 3105
25 Ga0070671_100003993 3300005355 Bacteria 11624
26 Ga0070671_100127985 3300005355 Bacteria 2138
27 Ga0070673_100044373 3300005364 Bacteria 3442
28 Ga0070688_100093297 3300005365 Bacteria 1971
29 Ga0070659_100061340 3300005366 Bacteria 2972
30 Ga0070659_100120564 3300005366 Bacteria 2124
31 Ga0070659_100419737 3300005366 Bacteria 1131
32 Ga0070667_100025626 3300005367 Bacteria 4904
33 Ga0070667_100031313 3300005367 Unclassified 4436
34 Ga0070667_100207876 3300005367 Bacteria 1739
35 Ga0070667_100558749 3300005367 Bacteria 1052
36 Ga0070709_10017025 3300005434 Bacteria 4163
37 Ga0070709_10027018 3300005434 Bacteria 3408
38 Ga0070709_10050851 3300005434 Bacteria 2598
39 Ga0070709_10284417 3300005434 Bacteria 1203
40 Ga0070709_10387345 3300005434 Unclassified 1041
41 Ga0070714_100037763 3300005435 Bacteria 4060
42 Ga0070713_100029705 3300005436 Bacteria 4331
43 Ga0070713_100293882 3300005436 Bacteria 1494
44 Ga0070713_100302041 3300005436 Bacteria 1474
45 Ga0070713_100604375 3300005436 Bacteria 1042
46 Ga0070710_10021276 3300005437 Bacteria 3377
47 Ga0070710_10052101 3300005437 Unclassified 2301
48 Ga0070701_10184936 3300005438 Bacteria 1222
49 Ga0070711_100005556 3300005439 Bacteria 7551
50 Ga0070711_100016424 3300005439 Bacteria 4702
51 Ga0070711_100090221 3300005439 Bacteria 2207
52 Ga0070711_100303787 3300005439 Bacteria 1270
53 Ga0070705_100281348 3300005440 Bacteria 1183
54 Ga0070705_100300494 3300005440 Bacteria 1150
55 Ga0070705_100748587 3300005440 Bacteria 772
56 Ga0070700_100040612 3300005441 Bacteria 2849
57 Ga0070694_100130155 3300005444 Bacteria 1817
58 Ga0070694_100262677 3300005444 Unclassified 1310
59 Ga0070694_100316081 3300005444 Bacteria 1201
60 Ga0070708_100007687 3300005445 Bacteria 8638
61 Ga0070708_100051671 3300005445 Bacteria 3642
62 Ga0070708_100262194 3300005445 Bacteria 1625
63 Ga0070708_100470220 3300005445 Unclassified 1186
64 Ga0070708_100658280 3300005445 Bacteria 987
65 Ga0070708_100725706 3300005445 Bacteria 935
66 Ga0070663_100039087 3300005455 Bacteria 3314
67 Ga0070663_100062841 3300005455 Unclassified 2678
68 Ga0070662_100002321 3300005457 Bacteria 11687
69 Ga0070662_100076192 3300005457 Bacteria 2486
70 Ga0070681_10164239 3300005458 Bacteria 2144
71 Ga0068867_100006848 3300005459 Bacteria 8058
72 Ga0070685_10232419 3300005466 Unclassified 1213
73 Ga0070706_100007999 3300005467 Bacteria 9864
74 Ga0070706_100043536 3300005467 Unclassified 4149
75 Ga0070706_100081240 3300005467 Bacteria 3002
76 Ga0070706_100111436 3300005467 Bacteria 2546
77 Ga0070706_100208985 3300005467 Bacteria 1823
78 Ga0070706_100281326 3300005467 Bacteria 1552
79 Ga0070706_100544839 3300005467 Unclassified 1079
80 Ga0070707_100003350 3300005468 Bacteria 15132
81 Ga0070707_100028683 3300005468 Bacteria 5297
82 Ga0070707_100246615 3300005468 Unclassified 1738
83 Ga0070698_100009879 3300005471 Bacteria 10202
84 Ga0070698_100021386 3300005471 Bacteria 6777
85 Ga0070698_100021906 3300005471 Bacteria 6690
86 Ga0070698_100071873 3300005471 Bacteria 3469
87 Ga0070699_100001418 3300005518 Bacteria 22010
88 Ga0070699_100027124 3300005518 Bacteria 4940
89 Ga0070699_100130200 3300005518 Unclassified 2218
90 Ga0070699_100274124 3300005518 Bacteria 1511
91 Ga0070699_100618176 3300005518 Bacteria 988
92 Ga0070699_100856927 3300005518 Unclassified 832
93 Ga0070684_100638348 3300005535 Unclassified 991
94 Ga0070697_100043218 3300005536 Bacteria 3648
95 Ga0070697_100304152 3300005536 Unclassified 1371
96 Ga0068853_100000923 3300005539 Bacteria 20561
97 Ga0068853_100051246 3300005539 Bacteria 3553
98 Ga0068853_100073988 3300005539 Bacteria 2972
99 Ga0070672_100002265 3300005543 Bacteria 12142
100 Ga0070672_100007015 3300005543 Bacteria 7619
101 Ga0070695_100309834 3300005545 Bacteria 1170
102 Ga0070695_100412105 3300005545 Bacteria 1027
103 Ga0070696_100010731 3300005546 Bacteria 6137
104 Ga0070696_100216591 3300005546 Bacteria 1435
105 Ga0070693_100055823 3300005547 Bacteria 2277
106 Ga0070665_100002668 3300005548 Bacteria 19402
107 Ga0070665_100004243 3300005548 Bacteria 15082
108 Ga0070665_100089706 3300005548 Plasmid 3080
109 Ga0070665_100138073 3300005548 Unclassified 2441
110 Ga0070665_100439926 3300005548 Bacteria 1313
111 Ga0070704_100048095 3300005549 Bacteria 2983
112 Ga0068855_100006186 3300005563 Bacteria 14593
113 Ga0068855_101273136 3300005563 Unclassified 762
114 Ga0070664_100004599 3300005564 Bacteria 11074
115 Ga0068857_100162126 3300005577 Bacteria 2029
116 Ga0068856_100035295 3300005614 Unclassified 4900
117 Ga0068856_100978555 3300005614 Bacteria 864
118 Ga0070702_100362086 3300005615 Bacteria 1025
119 Ga0068852_100257269 3300005616 Bacteria 1675
120 Ga0068859_100029602 3300005617 Bacteria 5495
121 Ga0068859_100030502 3300005617 Bacteria 5411
122 Ga0068859_100046962 3300005617 Unclassified 4336
123 Ga0068859_100133340 3300005617 Bacteria 2556
124 Ga0068864_100040618 3300005618 Bacteria 3979
125 Ga0068864_100713808 3300005618 Bacteria 980
126 Ga0068861_100100753 3300005719 Bacteria 2296
127 Ga0068863_100007942 3300005841 Bacteria 10370
128 Ga0068863_100019505 3300005841 Bacteria 6486
129 Ga0068863_100108031 3300005841 Bacteria 2648
130 Ga0068863_100169457 3300005841 Bacteria 2094
131 Ga0068863_100352811 3300005841 Bacteria 1433
132 Ga0068863_100372116 3300005841 Unclassified 1394
133 Ga0068863_100800240 3300005841 Bacteria 940
134 Ga0068858_100068205 3300005842 Bacteria 3295
135 Ga0068858_100096843 3300005842 Bacteria 2750
136 Ga0068858_100161477 3300005842 Bacteria 2110
137 Ga0068858_100287620 3300005842 Bacteria 1566
138 Ga0068860_100000552 3300005843 Bacteria 45577
139 Ga0068860_100011969 3300005843 Bacteria 8549
140 Ga0068860_100092119 3300005843 Bacteria 2888
141 Ga0068860_100182803 3300005843 Bacteria 2027
142 Ga0068862_100046832 3300005844 Unclassified 3689
143 Ga0068862_100288096 3300005844 Bacteria 1507
144 Ga0070717_10111061 3300006028 Bacteria 2338
145 Ga0070717_10151254 3300006028 Bacteria 2008
146 Ga0075368_10153124 3300006042 Bacteria 964
147 Ga0075432_10103504 3300006058 Unclassified 1054
148 Ga0070715_10010193 3300006163 Bacteria 3341
149 Ga0070715_10046381 3300006163 Bacteria 1847
150 Ga0070715_10149153 3300006163 Bacteria 1144
151 Ga0070715_10249062 3300006163 Unclassified 928
152 Ga0070715_10270718 3300006163 Bacteria 896
153 Ga0070715_10271695 3300006163 Unclassified 895
154 Ga0070716_100001400 3300006173 Bacteria 10691
155 Ga0070716_100090308 3300006173 Unclassified 1852
156 Ga0070716_100362504 3300006173 Bacteria 1030
157 Ga0070716_100412274 3300006173 Unclassified 974
158 Ga0070716_100540648 3300006173 Unclassified 867
159 Ga0070716_100844330 3300006173 Bacteria 713
160 Ga0070712_100001394 3300006175 Bacteria 14683
161 Ga0070712_100003087 3300006175 Bacteria 10283
162 Ga0070712_100028258 3300006175 Bacteria 3750
163 Ga0070712_100030917 3300006175 Bacteria 3603
164 Ga0070712_100293665 3300006175 Unclassified 1313
165 Ga0075367_10075458 3300006178 Bacteria 2033
166 Ga0097621_100007082 3300006237 Bacteria 7994
167 Ga0097621_100059100 3300006237 Bacteria 3138
168 Ga0068871_100012394 3300006358 Bacteria 6284
169 Ga0068871_100106147 3300006358 Bacteria 2357
170 Ga0068871_100409728 3300006358 Bacteria 1209
171 Ga0075428_100723336 3300006844 Bacteria 1060
172 Ga0075428_101054181 3300006844 Bacteria 860
173 Ga0075433_10068673 3300006852 Bacteria 3112
174 Ga0075433_10234395 3300006852 Unclassified 1629
175 Ga0075434_100013075 3300006871 Bacteria 7882
176 Ga0075434_100018157 3300006871 Bacteria 6789
177 Ga0075434_100045438 3300006871 Bacteria 4357
178 Ga0075434_100060540 3300006871 Bacteria 3766
179 Ga0075434_100240336 3300006871 Bacteria 1831
180 Ga0075434_100257749 3300006871 Bacteria 1763
181 Ga0075434_100451668 3300006871 Bacteria 1306
182 Ga0075434_100487461 3300006871 Bacteria 1254
183 Ga0075434_100809412 3300006871 Unclassified 953
184 Ga0075436_100016706 3300006914 Bacteria 5023
185 Ga0075436_100026692 3300006914 Bacteria 3976
186 Ga0075436_100091951 3300006914 Bacteria 2109
187 Ga0075436_100131591 3300006914 Unclassified 1754
188 Ga0075436_100159695 3300006914 Bacteria 1589
189 Ga0097620_100029603 3300006931 Bacteria 5495
190 Ga0097620_100030505 3300006931 Bacteria 5411
191 Ga0097620_100046962 3300006931 Unclassified 4336
192 Ga0097620_100133339 3300006931 Bacteria 2556
193 Ga0075435_100000867 3300007076 Bacteria 18956
194 Ga0075435_100041775 3300007076 Bacteria 3666
195 Ga0075435_100048947 3300007076 Bacteria 3397
196 Ga0075435_100059263 3300007076 Bacteria 3103
197 Ga0075435_100137292 3300007076 Bacteria 2049
198 Ga0075435_100341472 3300007076 Bacteria 1283
199 Ga0099794_10011748 3300007265 Bacteria 3759
200 Ga0099795_10079739 3300007788 Bacteria 1250
201 Ga0099795_10241351 3300007788 Unclassified 776
202 Ga0105240_10003184 3300009093 Bacteria 25778
203 Ga0105240_10007141 3300009093 Bacteria 16267
204 Ga0105240_10016162 3300009093 Bacteria 10115
205 Ga0105240_10124749 3300009093 Bacteria 3096
206 Ga0105240_10227681 3300009093 Unclassified 2168
207 Ga0105240_10657386 3300009093 Bacteria 1148
208 Ga0105245_10009400 3300009098 Bacteria 8529
209 Ga0105245_10049103 3300009098 Bacteria 3777
210 Ga0105245_10482629 3300009098 Bacteria 1253
211 Ga0105245_10685999 3300009098 Bacteria 1057
212 Ga0105247_10002552 3300009101 Bacteria 12354
213 Ga0105247_10008053 3300009101 Bacteria 6438
214 Ga0105247_10165151 3300009101 Unclassified 1468
215 Ga0105247_10369911 3300009101 Bacteria 1013
216 Ga0114129_10004445 3300009147 Bacteria 19783
217 Ga0114129_10228666 3300009147 Bacteria 2506
218 Ga0114129_10437752 3300009147 Bacteria 1717
219 Ga0114129_10716228 3300009147 Unclassified 1285
220 Ga0105243_11042836 3300009148 Bacteria 823
221 Ga0105241_10000292 3300009174 Bacteria 37299
222 Ga0105241_10006451 3300009174 Bacteria 8645
223 Ga0105242_10004428 3300009176 Bacteria 10920
224 Ga0105242_10016926 3300009176 Bacteria 5673
225 Ga0105242_10031951 3300009176 Bacteria 4208
226 Ga0105242_10128500 3300009176 Bacteria 2184
227 Ga0105242_11052369 3300009176 Unclassified 825
228 Ga0105248_10002011 3300009177 Bacteria 22583
229 Ga0105248_10003113 3300009177 Bacteria 18369
230 Ga0105248_10014901 3300009177 Bacteria 8561
231 Ga0105248_10018131 3300009177 Bacteria 7773
232 Ga0105248_10070790 3300009177 Bacteria 3917
233 Ga0105248_10076120 3300009177 Bacteria 3772
234 Ga0105248_10141530 3300009177 Bacteria 2714
235 Ga0105248_10473470 3300009177 Bacteria 1412
236 Ga0105248_10919676 3300009177 Bacteria 988
237 Ga0105237_10000628 3300009545 Bacteria 49290
238 Ga0105237_10002416 3300009545 Bacteria 23189
239 Ga0105237_10040752 3300009545 Bacteria 4683
240 Ga0105237_10112644 3300009545 Bacteria 2713
241 Ga0105237_10295031 3300009545 Unclassified 1624
242 Ga0105238_10002303 3300009551 Bacteria 19235
243 Ga0105238_10002930 3300009551 Bacteria 17030
244 Ga0105238_10022880 3300009551 Bacteria 6371
245 Ga0105238_10105362 3300009551 Bacteria 2801
246 Ga0105238_10792888 3300009551 Bacteria 963
247 Ga0105249_10002701 3300009553 Bacteria 15333
248 Ga0105249_10037526 3300009553 Bacteria 4397
249 Ga0105249_10095240 3300009553 Bacteria 2791
250 Ga0105249_10095277 3300009553 Bacteria 2791
251 Ga0105249_10528225 3300009553 Bacteria 1228
252 Ga0099796_10007552 3300010159 Bacteria 2848
253 Ga0099796_10019819 3300010159 Bacteria 2045
254 Ga0105239_10000288 3300010375 Bacteria 74273
255 Ga0105239_10011478 3300010375 Bacteria 9881
256 Ga0105239_10030550 3300010375 Bacteria 5923
257 Ga0105239_10125848 3300010375 Bacteria 2848
258 Ga0105239_10335602 3300010375 Bacteria 1706
259 Ga0105246_10003565 3300011119 Bacteria 9421
260 Ga0105246_10016967 3300011119 Unclassified 4622
261 Ga0157373_10012505 3300013100 Bacteria 6239
262 Ga0157373_10136742 3300013100 Bacteria 1723
263 Ga0157369_10011051 3300013105 Bacteria 10273
264 Ga0157369_10062931 3300013105 Unclassified 3998
265 Ga0157369_10289743 3300013105 Unclassified 1705
266 Ga0157374_10001082 3300013296 Bacteria 23582
267 Ga0157374_10096677 3300013296 Bacteria 2825
268 Ga0157374_10192409 3300013296 Bacteria 1995
269 Ga0157374_10270664 3300013296 Bacteria 1675
270 Ga0157374_10632563 3300013296 Unclassified 1081
271 Ga0157374_10992524 3300013296 Bacteria 859
272 Ga0157378_10006400 3300013297 Bacteria 10297
273 Ga0157378_10019148 3300013297 Bacteria 6015
274 Ga0157378_10116520 3300013297 Bacteria 2456
275 Ga0157378_10222266 3300013297 Unclassified 1796
276 Ga0157378_10414114 3300013297 Unclassified 1331
277 Ga0157378_10637042 3300013297 Bacteria 1080
278 Ga0157378_10645956 3300013297 Unclassified 1073
279 Ga0163162_10001655 3300013306 Bacteria 20889
280 Ga0163162_10019991 3300013306 Bacteria 6577
281 Ga0163162_10155032 3300013306 Bacteria 2410
282 Ga0163162_10176173 3300013306 Bacteria 2264
283 Ga0163162_10229503 3300013306 Bacteria 1986
284 Ga0163162_10450158 3300013306 Bacteria 1419
285 Ga0157372_10000966 3300013307 Bacteria 31334
286 Ga0157372_10001876 3300013307 Bacteria 22791
287 Ga0157372_10902698 3300013307 Unclassified 1025
288 Ga0157375_10005217 3300013308 Bacteria 11273
289 Ga0157375_10249380 3300013308 Bacteria 1936
290 Ga0163163_10000571 3300014325 Bacteria 32407
291 Ga0163163_10145806 3300014325 Unclassified 2411
292 Ga0163163_10237591 3300014325 Bacteria 1872
293 Ga0157380_10080780 3300014326 Bacteria 2658
294 Ga0157380_10885572 3300014326 Bacteria 917
295 Ga0157379_10002993 3300014968 Bacteria 14252
296 Ga0157379_10030368 3300014968 Unclassified 4810
297 Ga0157379_10411340 3300014968 Bacteria 1245
298 Ga0157379_10493237 3300014968 Unclassified 1135
299 Ga0157379_10818181 3300014968 Bacteria 880
300 Ga0157376_10062368 3300014969 Plasmid 3136
301 Ga0157376_10109359 3300014969 Bacteria 2430
302 Ga0157376_10409084 3300014969 Bacteria 1314
303 Ga0213873_10047343 3300021358 Bacteria 1128
304 Ga0213872_10002159 3300021361 Bacteria 11795
305 Ga0213872_10002363 3300021361 Bacteria 11179
306 Ga0213872_10007187 3300021361 Bacteria 5504
307 Ga0213876_10028067 3300021384 Bacteria 2968
308 Ga0213871_10000344 3300021441 Bacteria 5972
309 Ga0207692_10064711 3300025898 Bacteria 1905
310 Ga0207692_10302430 3300025898 Unclassified 974
311 Ga0207710_10107730 3300025900 Unclassified 1320
312 Ga0207680_10042581 3300025903 Bacteria 2657
313 Ga0207680_10220653 3300025903 Bacteria 1300
314 Ga0207685_10020288 3300025905 Bacteria 2206
315 Ga0207685_10125497 3300025905 Bacteria 1133
316 Ga0207685_10173827 3300025905 Bacteria 993
317 Ga0207685_10208751 3300025905 Unclassified 922
318 Ga0207685_10262180 3300025905 Unclassified 840
319 Ga0207699_10018086 3300025906 Bacteria 3728
320 Ga0207699_10024846 3300025906 Bacteria 3282
321 Ga0207699_10141448 3300025906 Bacteria 1582
322 Ga0207699_10203504 3300025906 Bacteria 1343
323 Ga0207705_10504686 3300025909 Bacteria 940
324 Ga0207684_10006705 3300025910 Bacteria 10454
325 Ga0207684_10014695 3300025910 Bacteria 6743
326 Ga0207684_10016023 3300025910 Bacteria 6436
327 Ga0207684_10141510 3300025910 Bacteria 2068
328 Ga0207684_10159021 3300025910 Bacteria 1945
329 Ga0207684_10236792 3300025910 Bacteria 1575
330 Ga0207684_10822745 3300025910 Bacteria 784
331 Ga0207654_10001606 3300025911 Bacteria 11854
332 Ga0207654_10010043 3300025911 Bacteria 4814
333 Ga0207654_10028658 3300025911 Bacteria 3037
334 Ga0207695_10001999 3300025913 Bacteria 31465
335 Ga0207695_10015250 3300025913 Bacteria 9060
336 Ga0207671_10002806 3300025914 Bacteria 18149
337 Ga0207671_10006941 3300025914 Bacteria 9966
338 Ga0207671_10166913 3300025914 Bacteria 1707
339 Ga0207693_10000377 3300025915 Bacteria 40904
340 Ga0207693_10012897 3300025915 Bacteria 6744
341 Ga0207693_10038582 3300025915 Bacteria 3761
342 Ga0207693_10135530 3300025915 Bacteria 1936
343 Ga0207693_10635807 3300025915 Bacteria 829
344 Ga0207663_10002232 3300025916 Bacteria 9279
345 Ga0207663_10016256 3300025916 Bacteria 4121
346 Ga0207663_10101270 3300025916 Bacteria 1935
347 Ga0207663_10200611 3300025916 Unclassified 1439
348 Ga0207663_10356389 3300025916 Bacteria 1109
349 Ga0207663_10399678 3300025916 Bacteria 1051
350 Ga0207662_10056120 3300025918 Bacteria 2352
351 Ga0207657_10181095 3300025919 Bacteria 1703
352 Ga0207649_10054392 3300025920 Unclassified 2491
353 Ga0207649_10593548 3300025920 Unclassified 851
354 Ga0207646_10002451 3300025922 Bacteria 21903
355 Ga0207646_10009886 3300025922 Bacteria 9385
356 Ga0207646_10207876 3300025922 Unclassified 1768
357 Ga0207646_10488755 3300025922 Bacteria 1110
358 Ga0207646_10624150 3300025922 Bacteria 967
359 Ga0207681_10135303 3300025923 Unclassified 1828
360 Ga0207694_10000011 3300025924 Bacteria 417640
361 Ga0207694_10003800 3300025924 Bacteria 11948
362 Ga0207694_10004533 3300025924 Bacteria 10832
363 Ga0207694_10023755 3300025924 Bacteria 4655
364 Ga0207694_10177773 3300025924 Bacteria 1725
365 Ga0207650_10073278 3300025925 Bacteria 2579
366 Ga0207650_10608954 3300025925 Bacteria 919
367 Ga0207659_10034522 3300025926 Bacteria 3488
368 Ga0207687_10000651 3300025927 Bacteria 23352
369 Ga0207687_10007006 3300025927 Bacteria 7430
370 Ga0207687_10014362 3300025927 Bacteria 5181
371 Ga0207687_10383295 3300025927 Bacteria 1152
372 Ga0207687_10534309 3300025927 Bacteria 982
373 Ga0207700_10106621 3300025928 Bacteria 2247
374 Ga0207700_10385536 3300025928 Bacteria 1226
375 Ga0207664_10214514 3300025929 Bacteria 1667
376 Ga0207644_10233768 3300025931 Bacteria 1461
377 Ga0207644_10660615 3300025931 Unclassified 870
378 Ga0207690_10086121 3300025932 Bacteria 2207
379 Ga0207690_10390637 3300025932 Bacteria 1108
380 Ga0207706_10001601 3300025933 Bacteria 22472
381 Ga0207706_10104345 3300025933 Bacteria 2494
382 Ga0207686_10023248 3300025934 Bacteria 3577
383 Ga0207686_10258545 3300025934 Unclassified 1275
384 Ga0207686_10532894 3300025934 Bacteria 916
385 Ga0207670_10060448 3300025936 Bacteria 2582
386 Ga0207665_10001927 3300025939 Bacteria 13963
387 Ga0207665_10003457 3300025939 Bacteria 10549
388 Ga0207665_10068013 3300025939 Bacteria 2426
389 Ga0207665_10097719 3300025939 Unclassified 2045
390 Ga0207665_10121665 3300025939 Unclassified 1844
391 Ga0207665_10455094 3300025939 Unclassified 983
392 Ga0207691_10004409 3300025940 Bacteria 13642
393 Ga0207691_10016408 3300025940 Bacteria 7032
394 Ga0207711_10000518 3300025941 Bacteria 39621
395 Ga0207711_10000615 3300025941 Bacteria 35879
396 Ga0207711_10001505 3300025941 Bacteria 21689
397 Ga0207711_10283983 3300025941 Bacteria 1524
398 Ga0207711_10441634 3300025941 Bacteria 1211
399 Ga0207711_10538748 3300025941 Bacteria 1089
400 Ga0207711_10746754 3300025941 Bacteria 912
401 Ga0207689_10439043 3300025942 Bacteria 1090
402 Ga0207679_10013721 3300025945 Bacteria 5313
403 Ga0207667_10002728 3300025949 Bacteria 21826
404 Ga0207651_10024227 3300025960 Bacteria 3750
405 Ga0207712_10001906 3300025961 Bacteria 13706
406 Ga0207712_10024966 3300025961 Bacteria 3966
407 Ga0207712_10059134 3300025961 Bacteria 2711
408 Ga0207712_10246138 3300025961 Bacteria 1443
409 Ga0207668_10031621 3300025972 Bacteria 3488
410 Ga0207668_10064709 3300025972 Bacteria 2585
411 Ga0207658_10006067 3300025986 Bacteria 8252
412 Ga0207658_10018040 3300025986 Unclassified 4867
413 Ga0207658_10051656 3300025986 Bacteria 3030
414 Ga0207658_10548386 3300025986 Bacteria 1034
415 Ga0207677_10405990 3300026023 Unclassified 1156
416 Ga0207703_10014161 3300026035 Bacteria 6219
417 Ga0207703_10040390 3300026035 Bacteria 3733
418 Ga0207703_10095929 3300026035 Bacteria 2503
419 Ga0207703_10099531 3300026035 Bacteria 2461
420 Ga0207639_10005294 3300026041 Bacteria 8707
421 Ga0207639_10027183 3300026041 Unclassified 4165
422 Ga0207639_10231375 3300026041 Bacteria 1602
423 Ga0207678_10027979 3300026067 Bacteria 4922
424 Ga0207678_10039058 3300026067 Unclassified 4121
425 Ga0207708_10047226 3300026075 Bacteria 3278
426 Ga0207702_10022847 3300026078 Bacteria 5189
427 Ga0207641_10000704 3300026088 Bacteria 35949
428 Ga0207641_10014463 3300026088 Bacteria 6465
429 Ga0207641_10079582 3300026088 Bacteria 2841
430 Ga0207641_10091496 3300026088 Bacteria 2662
431 Ga0207641_10391206 3300026088 Unclassified 1333
432 Ga0207676_10020392 3300026095 Bacteria 4850
433 Ga0207676_10124578 3300026095 Bacteria 2180
434 Ga0207676_10817076 3300026095 Unclassified 910
435 Ga0207674_10680093 3300026116 Unclassified 994
436 Ga0207698_10013568 3300026142 Bacteria 5383
437 Ga0207698_10266659 3300026142 Bacteria 1576
438 Ga0207698_10400893 3300026142 Bacteria 1311
439 Ga0209588_1021119 3300027671 Unclassified 2043
440 Ga0209588_1066383 3300027671 Bacteria 1166
441 Ga0209588_1153871 3300027671 Bacteria 728
442 Ga0207428_10068755 3300027907 Bacteria 2785
443 Ga0265356_1002678 3300028017 Bacteria 2325
444 Ga0268266_10002056 3300028379 Bacteria 22316
445 Ga0268266_10012459 3300028379 Bacteria 7349
446 Ga0268266_10030608 3300028379 Bacteria 4572
447 Ga0268266_10033341 3300028379 Bacteria 4377
448 Ga0268266_10237522 3300028379 Bacteria 1681
449 Ga0268265_10048659 3300028380 Bacteria 3184
450 Ga0268265_10105361 3300028380 Bacteria 2288
451 Ga0268264_10000025 3300028381 Bacteria 468619
452 Ga0268264_10004227 3300028381 Bacteria 12258
453 Ga0268264_10043523 3300028381 Bacteria 3721
454 Ga0268264_10048338 3300028381 Bacteria 3539
455 Ga0268264_10875971 3300028381 Unclassified 900
456 Ga0265762_1013884 3300030760 Bacteria 1450
457 Ga0265325_10010946 3300031241 Bacteria 5225
458 Ga0265340_10078650 3300031247 Bacteria 1555
459 Ga0265331_10085899 3300031250 Bacteria 1458
460 Ga0265331_10123434 3300031250 Bacteria 1184
461 Ga0265316_10012364 3300031344 Bacteria 7660
462 Ga0265314_10014284 3300031711 Bacteria 6365
463 Ga0265314_10027184 3300031711 Bacteria 4286
464 Ga0265314_10032560 3300031711 Bacteria 3833
465 Ga0265342_10105370 3300031712 Bacteria 1601
466 Ga0316212_1003150 3300033547 Bacteria 2375
467 Ga0373943_0099893 3300035170 Unclassified 1516
468 Ga0373931_0002480 3300035691 Bacteria 8184
469 Ga0373925_0014733 3300037068 Bacteria 5649
470 Ga0436364_0394147 3300037853 Bacteria 1807
471 Ga0436364_0760869 3300037853 Bacteria 1828
472 Ga0436364_1037817 3300037853 Bacteria 1720
473 Ga0436364_1119724 3300037853 Bacteria 904
474 Ga0436365_0616472 3300039437 Bacteria 2787
475 Ga0436365_0698258 3300039437 Bacteria 2496
476 Ga0436365_0698782 3300039437 Bacteria 7103
477 Ga0436365_1682974 3300039437 Bacteria 1369
478 Ga0436360_0049305 3300039438 Bacteria 2152
479 Ga0436360_0380526 3300039438 Bacteria 1261
480 Ga0436360_0381091 3300039438 Bacteria 1410
481 Ga0436360_1151677 3300039438 Bacteria 1068
482 Ga0436361_0177899 3300039447 Bacteria 5536
483 Ga0436361_0214791 3300039447 Bacteria 12560
484 Ga0436361_0546677 3300039447 Bacteria 1746
485 Ga0436361_0600637 3300039447 Bacteria 1350
486 Ga0436363_1493595 3300039450 Unclassified 2010
487 Ga0436363_1562343 3300039450 Bacteria 1526
488 Ga0436363_1625620 3300039450 Bacteria 1203
489 Ga0436362_0000185 3300039453 Bacteria 1101
490 Ga0436362_0238456 3300039453 Bacteria 668
491 Ga0436362_0339358 3300039453 Unclassified 1310
492 Ga0436362_0354431 3300039453 Unclassified 1147
493 Ga0436362_1036656 3300039453 Bacteria 794
494 Ga0451577_0238933 3300042876 Unclassified 1644
495 Ga0495603_0352221 3300046455 Unclassified 845
496 Ga0495629_0329222 3300046459 Unclassified 1044
497 Ga0495580_0005921 3300046472 Bacteria 10027
498 Ga0495628_0019658 3300046516 Bacteria 5580
499 Ga0495665_0196683 3300046531 Bacteria 1046
500 Ga0495645_0029931 3300046543 Bacteria 3966
501 Ga0495633_0246214 3300046558 Unclassified 816
502 Ga0495599_0164373 3300046678 Bacteria 1371
503 Ga0496100_0103607 3300048903 Bacteria 1965
504 Ga0496102_0021130 3300048905 Bacteria 5755
505 Ga0496103_0054109 3300048906 Bacteria 2488
506 Ga0496104_0262911 3300048907 Bacteria 1638
507 Ga0496104_0326701 3300048907 Unclassified 1447
508 Ga0496112_0003434 3300048915 Bacteria 13083
509 Ga0496112_0322081 3300048915 Bacteria 1490
510 Ga0496114_0536554 3300048917 Bacteria 1034
511 Ga0496115_0568764 3300048918 Bacteria 904
512 Ga0496116_0074226 3300048919 Bacteria 2140
513 Ga0496117_0000110 3300048920 Bacteria 184627
514 Ga0496118_0000170 3300048921 Bacteria 117661
515 Ga0496118_0391861 3300048921 Bacteria 725
516 Ga0496119_0007756 3300048922 Bacteria 9582
517 Ga0496119_0008200 3300048922 Bacteria 9242
518 Ga0496120_0000018 3300048923 Bacteria 263952
519 Ga0496120_0004576 3300048923 Bacteria 11520
520 Ga0496120_0006235 3300048923 Bacteria 9214
521 Ga0496121_0014404 3300048924 Bacteria 8394
522 Ga0496121_0140135 3300048924 Bacteria 1795
523 Ga0496125_0003048 3300048928 Bacteria 20948
524 Ga0496126_0023697 3300048929 Bacteria 5945
525 Ga0496126_0063021 3300048929 Unclassified 3324
526 Ga0496126_0077031 3300048929 Bacteria 2957
527 Ga0501033_0457163 3300049570 Unclassified 886
528 Ga0501034_0060307 3300049571 Bacteria 3811
529 Ga0501036_0083838 3300049572 Bacteria 2695
530 Ga0501037_0046105 3300049573 Bacteria 3198
531 Ga0501038_0171781 3300049574 Bacteria 1754
532 Ga0501046_0282203 3300049580 Unclassified 1216
533 Ga0501047_0020071 3300049581 Bacteria 6417
534 Ga0501048_0287475 3300049582 Unclassified 1169
535 Ga0501070_0008760 3300049586 Bacteria 8555
536 Ga0501073_0056767 3300049589 Bacteria 2739
537 Ga0501035_0316317 3300049822 Unclassified 1312
538 Ga0501044_0066497 3300049823 Bacteria 3675
539 nmdc:mga06z11_255503_c1 3300050494 Unclassified 1033
540 nmdc:mga05p37_1670_c1 3300050507 Bacteria 25796
541 nmdc:mga05p37_93628_c1 3300050507 Bacteria 3702
542 nmdc:mga0n895_153336_c1 3300050512 Bacteria 2335
543 nmdc:mga0n895_216703_c1 3300050512 Bacteria 1944
544 nmdc:mga0n895_324539_c1 3300050512 Bacteria 1560
545 nmdc:mga0n895_369742_c1 3300050512 Bacteria 1452
546 nmdc:mga0n895_381817_c1 3300050512 Bacteria 1425
547 nmdc:mga0n895_426778_c1 3300050512 Unclassified 1340
548 nmdc:mga0n895_48380_c1 3300050512 Bacteria 4162
549 nmdc:mga0n895_5837_c1 3300050512 Bacteria 10348
550 nmdc:mga0n895_645722_c1 3300050512 Bacteria 1057
551 nmdc:mga0n895_74561_c1 3300050512 Bacteria 3371
552 nmdc:mga0n895_983349_c1 3300050512 Bacteria 826
553 nmdc:mga0rr50_315638_c1 3300050513 Bacteria 1309
554 nmdc:mga0rr50_529521_c1 3300050513 Unclassified 1003
555 nmdc:mga0rr50_53225_c1 3300050513 Bacteria 3011
556 nmdc:mga0rr50_677899_c1 3300050513 Bacteria 880
557 nmdc:mga0rr50_7140_c1 3300050513 Bacteria 6861
558 nmdc:mga08x19_12328_c1 3300050514 Bacteria 5149
559 nmdc:mga08x19_303907_c1 3300050514 Unclassified 1108
560 nmdc:mga08x19_544991_c1 3300050514 Bacteria 821
561 nmdc:mga08x19_62013_c1 3300050514 Bacteria 2423
562 nmdc:mga08x19_736_c1 3300050514 Bacteria 20916
563 nmdc:mga08x19_81149_c1 3300050514 Bacteria 2129
564 nmdc:mga0a205_149167_c1 3300050515 Bacteria 2239
565 nmdc:mga0a205_22415_c1 3300050515 Bacteria 5982
566 nmdc:mga0a205_354380_c1 3300050515 Bacteria 1334
567 Ga0436361_0753510
568 MRS1b_contig_5417130
569 rootL2_10235129
570 rootH1_10098489
571 rootH1_10252906
572 Ga0065715_10148124
573 Ga0065715_10349619
574 Ga0070683_100221332
575 Ga0070683_100271907
576 Ga0070666_10006819
577 Ga0070666_10011797
578 Ga0070666_10131768
579 Ga0070666_10208901
580 Ga0070682_100008126
581 Ga0068868_100028432
582 Ga0068868_100065803
583 Ga0068868_100259752
584 Ga0070689_100115405
585 Ga0070687_100151263
586 Ga0070661_100081436
587 Ga0070661_100552623
588 Ga0070668_100042106
589 Ga0070669_100036295
590 Ga0070675_100061303
591 Ga0070671_100003993
592 Ga0070671_100127985
593 Ga0070673_100044373
594 Ga0070688_100093297
595 Ga0070659_100061340
596 Ga0070659_100120564
597 Ga0070659_100419737
598 Ga0070667_100025626
599 Ga0070667_100031313
600 Ga0070667_100207876
601 Ga0070667_100558749
602 Ga0070709_10017025
603 Ga0070709_10027018
604 Ga0070709_10050851
605 Ga0070709_10284417
606 Ga0070709_10387345
607 Ga0070714_100037763
608 Ga0070713_100029705
609 Ga0070713_100293882
610 Ga0070713_100302041
611 Ga0070713_100604375
612 Ga0070710_10021276
613 Ga0070710_10052101
614 Ga0070701_10184936
615 Ga0070711_100005556
616 Ga0070711_100016424
617 Ga0070711_100090221
618 Ga0070711_100303787
619 Ga0070705_100281348
620 Ga0070705_100300494
621 Ga0070705_100748587
622 Ga0070700_100040612
623 Ga0070694_100130155
624 Ga0070694_100262677
625 Ga0070694_100316081
626 Ga0070708_100007687
627 Ga0070708_100051671
628 Ga0070708_100262194
629 Ga0070708_100470220
630 Ga0070708_100658280
631 Ga0070708_100725706
632 Ga0070663_100039087
633 Ga0070663_100062841
634 Ga0070662_100002321
635 Ga0070662_100076192
636 Ga0070681_10164239
637 Ga0068867_100006848
638 Ga0070685_10232419
639 Ga0070706_100007999
640 Ga0070706_100043536
641 Ga0070706_100081240
642 Ga0070706_100111436
643 Ga0070706_100208985
644 Ga0070706_100281326
645 Ga0070706_100544839
646 Ga0070707_100003350
647 Ga0070707_100028683
648 Ga0070707_100246615
649 Ga0070698_100009879
650 Ga0070698_100021386
651 Ga0070698_100021906
652 Ga0070698_100071873
653 Ga0070699_100001418
654 Ga0070699_100027124
655 Ga0070699_100130200
656 Ga0070699_100274124
657 Ga0070699_100618176
658 Ga0070699_100856927
659 Ga0070684_100638348
660 Ga0070697_100043218
661 Ga0070697_100304152
662 Ga0068853_100000923
663 Ga0068853_100051246
664 Ga0068853_100073988
665 Ga0070672_100002265
666 Ga0070672_100007015
667 Ga0070695_100309834
668 Ga0070695_100412105
669 Ga0070696_100010731
670 Ga0070696_100216591
671 Ga0070693_100055823
672 Ga0070665_100002668
673 Ga0070665_100004243
674 Ga0070665_100089706
675 Ga0070665_100138073
676 Ga0070665_100439926
677 Ga0070704_100048095
678 Ga0068855_100006186
679 Ga0068855_101273136
680 Ga0070664_100004599
681 Ga0068857_100162126
682 Ga0068856_100035295
683 Ga0068856_100978555
684 Ga0070702_100362086
685 Ga0068852_100257269
686 Ga0068859_100029602
687 Ga0068859_100030502
688 Ga0068859_100046962
689 Ga0068859_100133340
690 Ga0068864_100040618
691 Ga0068864_100713808
692 Ga0068861_100100753
693 Ga0068863_100007942
694 Ga0068863_100019505
695 Ga0068863_100108031
696 Ga0068863_100169457
697 Ga0068863_100352811
698 Ga0068863_100372116
699 Ga0068863_100800240
700 Ga0068858_100068205
701 Ga0068858_100096843
702 Ga0068858_100161477
703 Ga0068858_100287620
704 Ga0068860_100000552
705 Ga0068860_100011969
706 Ga0068860_100092119
707 Ga0068860_100182803
708 Ga0068862_100046832
709 Ga0068862_100288096
710 Ga0070717_10111061
711 Ga0070717_10151254
712 Ga0075368_10153124
713 Ga0075432_10103504
714 Ga0070715_10010193
715 Ga0070715_10046381
716 Ga0070715_10149153
717 Ga0070715_10249062
718 Ga0070715_10270718
719 Ga0070715_10271695
720 Ga0070716_100001400
721 Ga0070716_100090308
722 Ga0070716_100362504
723 Ga0070716_100412274
724 Ga0070716_100540648
725 Ga0070716_100844330
726 Ga0070712_100001394
727 Ga0070712_100003087
728 Ga0070712_100028258
729 Ga0070712_100030917
730 Ga0070712_100293665
731 Ga0075367_10075458
732 Ga0097621_100007082
733 Ga0097621_100059100
734 Ga0068871_100012394
735 Ga0068871_100106147
736 Ga0068871_100409728
737 Ga0075428_100723336
738 Ga0075428_101054181
739 Ga0075433_10068673
740 Ga0075433_10234395
741 Ga0075434_100013075
742 Ga0075434_100018157
743 Ga0075434_100045438
744 Ga0075434_100060540
745 Ga0075434_100240336
746 Ga0075434_100257749
747 Ga0075434_100451668
748 Ga0075434_100487461
749 Ga0075434_100809412
750 Ga0075436_100016706
751 Ga0075436_100026692
752 Ga0075436_100091951
753 Ga0075436_100131591
754 Ga0075436_100159695
755 Ga0097620_100029603
756 Ga0097620_100030505
757 Ga0097620_100046962
758 Ga0097620_100133339
759 Ga0075435_100000867
760 Ga0075435_100041775
761 Ga0075435_100048947
762 Ga0075435_100059263
763 Ga0075435_100137292
764 Ga0075435_100341472
765 Ga0099794_10011748
766 Ga0099795_10079739
767 Ga0099795_10241351
768 Ga0105240_10003184
769 Ga0105240_10007141
770 Ga0105240_10016162
771 Ga0105240_10124749
772 Ga0105240_10227681
773 Ga0105240_10657386
774 Ga0105245_10009400
775 Ga0105245_10049103
776 Ga0105245_10482629
777 Ga0105245_10685999
778 Ga0105247_10002552
779 Ga0105247_10008053
780 Ga0105247_10165151
781 Ga0105247_10369911
782 Ga0114129_10004445
783 Ga0114129_10228666
784 Ga0114129_10437752
785 Ga0114129_10716228
786 Ga0105243_11042836
787 Ga0105241_10000292
788 Ga0105241_10006451
789 Ga0105242_10004428
790 Ga0105242_10016926
791 Ga0105242_10031951
792 Ga0105242_10128500
793 Ga0105242_11052369
794 Ga0105248_10002011
795 Ga0105248_10003113
796 Ga0105248_10014901
797 Ga0105248_10018131
798 Ga0105248_10070790
799 Ga0105248_10076120
800 Ga0105248_10141530
801 Ga0105248_10473470
802 Ga0105248_10919676
803 Ga0105237_10000628
804 Ga0105237_10002416
805 Ga0105237_10040752
806 Ga0105237_10112644
807 Ga0105237_10295031
808 Ga0105238_10002303
809 Ga0105238_10002930
810 Ga0105238_10022880
811 Ga0105238_10105362
812 Ga0105238_10792888
813 Ga0105249_10002701
814 Ga0105249_10037526
815 Ga0105249_10095240
816 Ga0105249_10095277
817 Ga0105249_10528225
818 Ga0099796_10007552
819 Ga0099796_10019819
820 Ga0105239_10000288
821 Ga0105239_10011478
822 Ga0105239_10030550
823 Ga0105239_10125848
824 Ga0105239_10335602
825 Ga0105246_10003565
826 Ga0105246_10016967
827 Ga0157373_10012505
828 Ga0157373_10136742
829 Ga0157369_10011051
830 Ga0157369_10062931
831 Ga0157369_10289743
832 Ga0157374_10001082
833 Ga0157374_10096677
834 Ga0157374_10192409
835 Ga0157374_10270664
836 Ga0157374_10632563
837 Ga0157374_10992524
838 Ga0157378_10006400
839 Ga0157378_10019148
840 Ga0157378_10116520
841 Ga0157378_10222266
842 Ga0157378_10414114
843 Ga0157378_10637042
844 Ga0157378_10645956
845 Ga0163162_10001655
846 Ga0163162_10019991
847 Ga0163162_10155032
848 Ga0163162_10176173
849 Ga0163162_10229503
850 Ga0163162_10450158
851 Ga0157372_10000966
852 Ga0157372_10001876
853 Ga0157372_10902698
854 Ga0157375_10005217
855 Ga0157375_10249380
856 Ga0163163_10000571
857 Ga0163163_10145806
858 Ga0163163_10237591
859 Ga0157380_10080780
860 Ga0157380_10885572
861 Ga0157379_10002993
862 Ga0157379_10030368
863 Ga0157379_10411340
864 Ga0157379_10493237
865 Ga0157379_10818181
866 Ga0157376_10062368
867 Ga0157376_10109359
868 Ga0157376_10409084
869 Ga0213873_10047343
870 Ga0213872_10002159
871 Ga0213872_10002363
872 Ga0213872_10007187
873 Ga0213876_10028067
874 Ga0213871_10000344
875 Ga0207692_10064711
876 Ga0207692_10302430
877 Ga0207710_10107730
878 Ga0207680_10042581
879 Ga0207680_10220653
880 Ga0207685_10020288
881 Ga0207685_10125497
882 Ga0207685_10173827
883 Ga0207685_10208751
884 Ga0207685_10262180
885 Ga0207699_10018086
886 Ga0207699_10024846
887 Ga0207699_10141448
888 Ga0207699_10203504
889 Ga0207705_10504686
890 Ga0207684_10006705
891 Ga0207684_10014695
892 Ga0207684_10016023
893 Ga0207684_10141510
894 Ga0207684_10159021
895 Ga0207684_10236792
896 Ga0207684_10822745
897 Ga0207654_10001606
898 Ga0207654_10010043
899 Ga0207654_10028658
900 Ga0207695_10001999
901 Ga0207695_10015250
902 Ga0207671_10002806
903 Ga0207671_10006941
904 Ga0207671_10166913
905 Ga0207693_10000377
906 Ga0207693_10012897
907 Ga0207693_10038582
908 Ga0207693_10135530
909 Ga0207693_10635807
910 Ga0207663_10002232
911 Ga0207663_10016256
912 Ga0207663_10101270
913 Ga0207663_10200611
914 Ga0207663_10356389
915 Ga0207663_10399678
916 Ga0207662_10056120
917 Ga0207657_10181095
918 Ga0207649_10054392
919 Ga0207649_10593548
920 Ga0207646_10002451
921 Ga0207646_10009886
922 Ga0207646_10207876
923 Ga0207646_10488755
924 Ga0207646_10624150
925 Ga0207681_10135303
926 Ga0207694_10000011
927 Ga0207694_10003800
928 Ga0207694_10004533
929 Ga0207694_10023755
930 Ga0207694_10177773
931 Ga0207650_10073278
932 Ga0207650_10608954
933 Ga0207659_10034522
934 Ga0207687_10000651
935 Ga0207687_10007006
936 Ga0207687_10014362
937 Ga0207687_10383295
938 Ga0207687_10534309
939 Ga0207700_10106621
940 Ga0207700_10385536
941 Ga0207664_10214514
942 Ga0207644_10233768
943 Ga0207644_10660615
944 Ga0207690_10086121
945 Ga0207690_10390637
946 Ga0207706_10001601
947 Ga0207706_10104345
948 Ga0207686_10023248
949 Ga0207686_10258545
950 Ga0207686_10532894
951 Ga0207670_10060448
952 Ga0207665_10001927
953 Ga0207665_10003457
954 Ga0207665_10068013
955 Ga0207665_10097719
956 Ga0207665_10121665
957 Ga0207665_10455094
958 Ga0207691_10004409
959 Ga0207691_10016408
960 Ga0207711_10000518
961 Ga0207711_10000615
962 Ga0207711_10001505
963 Ga0207711_10283983
964 Ga0207711_10441634
965 Ga0207711_10538748
966 Ga0207711_10746754
967 Ga0207689_10439043
968 Ga0207679_10013721
969 Ga0207667_10002728
970 Ga0207651_10024227
971 Ga0207712_10001906
972 Ga0207712_10024966
973 Ga0207712_10059134
974 Ga0207712_10246138
975 Ga0207668_10031621
976 Ga0207668_10064709
977 Ga0207658_10006067
978 Ga0207658_10018040
979 Ga0207658_10051656
980 Ga0207658_10548386
981 Ga0207677_10405990
982 Ga0207703_10014161
983 Ga0207703_10040390
984 Ga0207703_10095929
985 Ga0207703_10099531
986 Ga0207639_10005294
987 Ga0207639_10027183
988 Ga0207639_10231375
989 Ga0207678_10027979
990 Ga0207678_10039058
991 Ga0207708_10047226
992 Ga0207702_10022847
993 Ga0207641_10000704
994 Ga0207641_10014463
995 Ga0207641_10079582
996 Ga0207641_10091496
997 Ga0207641_10391206
998 Ga0207676_10020392
999 Ga0207676_10124578
1000 Ga0207676_10817076
1001 Ga0207674_10680093
1002 Ga0207698_10013568
1003 Ga0207698_10266659
1004 Ga0207698_10400893
1005 Ga0209588_1021119
1006 Ga0209588_1066383
1007 Ga0209588_1153871
1008 Ga0207428_10068755
1009 Ga0265356_1002678
1010 Ga0268266_10002056
1011 Ga0268266_10012459
1012 Ga0268266_10030608
1013 Ga0268266_10033341
1014 Ga0268266_10237522
1015 Ga0268265_10048659
1016 Ga0268265_10105361
1017 Ga0268264_10000025
1018 Ga0268264_10004227
1019 Ga0268264_10043523
1020 Ga0268264_10048338
1021 Ga0268264_10875971
1022 Ga0265762_1013884
1023 Ga0265325_10010946
1024 Ga0265340_10078650
1025 Ga0265331_10085899
1026 Ga0265331_10123434
1027 Ga0265316_10012364
1028 Ga0265314_10014284
1029 Ga0265314_10027184
1030 Ga0265314_10032560
1031 Ga0265342_10105370
1032 Ga0316212_1003150
1033 Ga0373943_0099893
1034 Ga0373931_0002480
1035 Ga0373925_0014733
1036 Ga0436364_0394147
1037 Ga0436364_0760869
1038 Ga0436364_1037817
1039 Ga0436364_1119724
1040 Ga0436365_0616472
1041 Ga0436365_0698258
1042 Ga0436365_0698782
1043 Ga0436365_1682974
1044 Ga0436360_0049305
1045 Ga0436360_0380526
1046 Ga0436360_0381091
1047 Ga0436360_1151677
1048 Ga0436361_0177899
1049 Ga0436361_0214791
1050 Ga0436361_0546677
1051 Ga0436361_0600637
1052 Ga0436363_1493595
1053 Ga0436363_1562343
1054 Ga0436363_1625620
1055 Ga0436362_0000185
1056 Ga0436362_0238456
1057 Ga0436362_0339358
1058 Ga0436362_0354431
1059 Ga0436362_1036656
1060 Ga0451577_0238933
1061 Ga0495603_0352221
1062 Ga0495629_0329222
1063 Ga0495580_0005921
1064 Ga0495628_0019658
1065 Ga0495665_0196683
1066 Ga0495645_0029931
1067 Ga0495633_0246214
1068 Ga0495599_0164373
1069 Ga0496100_0103607
1070 Ga0496102_0021130
1071 Ga0496103_0054109
1072 Ga0496104_0262911
1073 Ga0496104_0326701
1074 Ga0496112_0003434
1075 Ga0496112_0322081
1076 Ga0496114_0536554
1077 Ga0496115_0568764
1078 Ga0496116_0074226
1079 Ga0496117_0000110
1080 Ga0496118_0000170
1081 Ga0496118_0391861
1082 Ga0496119_0007756
1083 Ga0496119_0008200
1084 Ga0496120_0000018
1085 Ga0496120_0004576
1086 Ga0496120_0006235
1087 Ga0496121_0014404
1088 Ga0496121_0140135
1089 Ga0496125_0003048
1090 Ga0496126_0023697
1091 Ga0496126_0063021
1092 Ga0496126_0077031
1093 Ga0501033_0457163
1094 Ga0501034_0060307
1095 Ga0501036_0083838
1096 Ga0501037_0046105
1097 Ga0501038_0171781
1098 Ga0501046_0282203
1099 Ga0501047_0020071
1100 Ga0501048_0287475
1101 Ga0501070_0008760
1102 Ga0501073_0056767
1103 Ga0501035_0316317
1104 Ga0501044_0066497
1105 nmdc:mga06z11_255503_c1
1106 nmdc:mga05p37_1670_c1
1107 nmdc:mga05p37_93628_c1
1108 nmdc:mga0n895_153336_c1
1109 nmdc:mga0n895_216703_c1
1110 nmdc:mga0n895_324539_c1
1111 nmdc:mga0n895_369742_c1
1112 nmdc:mga0n895_381817_c1
1113 nmdc:mga0n895_426778_c1
1114 nmdc:mga0n895_48380_c1
1115 nmdc:mga0n895_5837_c1
1116 nmdc:mga0n895_645722_c1
1117 nmdc:mga0n895_74561_c1
1118 nmdc:mga0n895_983349_c1
1119 nmdc:mga0rr50_315638_c1
1120 nmdc:mga0rr50_529521_c1
1121 nmdc:mga0rr50_53225_c1
1122 nmdc:mga0rr50_677899_c1
1123 nmdc:mga0rr50_7140_c1
1124 nmdc:mga08x19_12328_c1
1125 nmdc:mga08x19_303907_c1
1126 nmdc:mga08x19_544991_c1
1127 nmdc:mga08x19_62013_c1
1128 nmdc:mga08x19_736_c1
1129 nmdc:mga08x19_81149_c1
1130 nmdc:mga0a205_149167_c1
1131 nmdc:mga0a205_22415_c1
1132 nmdc:mga0a205_354380_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

28

140

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

164

220

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9866 146 200
3clo-assembly1.cif.gz_B crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9829 147 207
3clo-assembly2.cif.gz_C-2 crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9821 147 207
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9764 147 209
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9629 147 210
ID Description Score Start End Superfamily
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9936 147 201 1.10.10.10
4hyeA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9914 147 207 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9869 147 204 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9866 146 200 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9818 145 207 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4V1TC14-F1-model_v4 deleted 0.9622 5 132
AF-A0A3S0B2N0-F1-model_v4 Response regulator transcription factor 0.9591 1 132 GO:0000160
GO:0003677
AF-A0A2V9VZM8-F1-model_v4 Response regulatory domain-containing protein 0.959 2 131 GO:0000160
GO:0003677
AF-A0A7Z0LHK6-F1-model_v4 Response regulator transcription factor 0.9576 5 141 GO:0000160
GO:0003677
GO:0010468
AF-A0A7S8EAC9-F1-model_v4 Response regulator transcription factor 0.9564 1 141 GO:0000160
GO:0003677

Map