F464384
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 278 | 565 | 413 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10034689|Ga0105248_100346894 |
| Length | 492 |
| Sequence | VSRLDDLNIRLVAEGPAVSLYVRDNCMAAVGGTQGSTGFMTDQGLAYLVWREGQPFLAAKGGETQATPEQVAAIRKFSEDLHTALDTSPQQSAQQMTIDEQLTYLRKGMAEIIREEYLRERLVQAAKTGRKLRIKAGFDPTAPDLHLGHTVLLRKMKHFQDLGHTVIFLIGDMTGMIGDPTGRNVTRPPMTTEAIERNAETYKQQVFKILDPAKTEVRFNSHWLAPLQWQDVIKLTSKYTVARLLERDDFAKRMAANAPISLHELMYPLAQGYDSVALEADVEMGGTDQKFNLLVGRELQRDYGQQPQIVAMVPILEGLDGVNKMSKSLGNYIGITETPEVMFRKVMQVSDDLMWRYYELLTDRSLTEIEAMKASMHPMEAKTALGKIIVTDFHSAADADAAASVFNAVVRRKEIPSDIATVPLPEGVSVDGGIRVDKLVARIGLAESVSDAVRKIKAGAVQINGEKVKEVLLTNPPAELLIQVGKNWKRVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 147 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 161 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 172 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 178 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 245 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 275 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 276 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.53 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 3.89 |
| Rhizosphere | 93.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10101096 | 3300005293 | Bacteria | 3237 |
| 2 | Ga0070658_10000109 | 3300005327 | Bacteria | 73665 |
| 3 | Ga0070658_10004049 | 3300005327 | Bacteria | 12014 |
| 4 | Ga0070676_10025598 | 3300005328 | Bacteria | 3336 |
| 5 | Ga0070683_100000032 | 3300005329 | Bacteria | 148421 |
| 6 | Ga0070683_100053867 | 3300005329 | Bacteria | 3729 |
| 7 | Ga0070683_100063454 | 3300005329 | Bacteria | 3436 |
| 8 | Ga0070683_100295083 | 3300005329 | Bacteria | 1542 |
| 9 | Ga0070690_100004886 | 3300005330 | Bacteria | 7494 |
| 10 | Ga0070670_100093759 | 3300005331 | Bacteria | 2582 |
| 11 | Ga0068869_100005138 | 3300005334 | Bacteria | 8207 |
| 12 | Ga0068869_100130893 | 3300005334 | Bacteria | 1928 |
| 13 | Ga0070666_10061799 | 3300005335 | Bacteria | 2536 |
| 14 | Ga0070666_10088166 | 3300005335 | Bacteria | 2128 |
| 15 | Ga0070680_100071092 | 3300005336 | Bacteria | 2859 |
| 16 | Ga0068868_100004502 | 3300005338 | Bacteria | 9781 |
| 17 | Ga0068868_100102670 | 3300005338 | Bacteria | 2316 |
| 18 | Ga0068868_100105114 | 3300005338 | Bacteria | 2289 |
| 19 | Ga0070660_100005413 | 3300005339 | Bacteria | 8839 |
| 20 | Ga0070689_100013667 | 3300005340 | Bacteria | 5879 |
| 21 | Ga0070661_100003838 | 3300005344 | Bacteria | 10344 |
| 22 | Ga0070668_100032700 | 3300005347 | Bacteria | 3957 |
| 23 | Ga0070675_100019034 | 3300005354 | Bacteria | 5470 |
| 24 | Ga0070671_100045141 | 3300005355 | Bacteria | 3663 |
| 25 | Ga0070688_100055667 | 3300005365 | Bacteria | 2481 |
| 26 | Ga0070659_100288665 | 3300005366 | Bacteria | 1366 |
| 27 | Ga0070667_100008767 | 3300005367 | Bacteria | 8381 |
| 28 | Ga0070667_100184226 | 3300005367 | Bacteria | 1847 |
| 29 | Ga0070709_10078406 | 3300005434 | Bacteria | 2149 |
| 30 | Ga0070714_100184792 | 3300005435 | Bacteria | 1899 |
| 31 | Ga0070714_100188103 | 3300005435 | Bacteria | 1882 |
| 32 | Ga0070713_100007212 | 3300005436 | Bacteria | 7781 |
| 33 | Ga0070713_100103920 | 3300005436 | Bacteria | 2466 |
| 34 | Ga0070711_100010931 | 3300005439 | Bacteria | 5627 |
| 35 | Ga0070708_100003186 | 3300005445 | Bacteria | 12789 |
| 36 | Ga0070708_100008541 | 3300005445 | Bacteria | 8230 |
| 37 | Ga0070708_100016509 | 3300005445 | Bacteria | 6129 |
| 38 | Ga0070708_100043542 | 3300005445 | Bacteria | 3944 |
| 39 | Ga0070708_100045807 | 3300005445 | Bacteria | 3856 |
| 40 | Ga0070678_100039473 | 3300005456 | Bacteria | 3331 |
| 41 | Ga0070681_10000247 | 3300005458 | Bacteria | 42975 |
| 42 | Ga0070681_10007965 | 3300005458 | Bacteria | 10370 |
| 43 | Ga0068867_100057047 | 3300005459 | Bacteria | 2891 |
| 44 | Ga0070706_100000430 | 3300005467 | Bacteria | 50312 |
| 45 | Ga0070706_100053272 | 3300005467 | Bacteria | 3734 |
| 46 | Ga0070707_100029389 | 3300005468 | Bacteria | 5233 |
| 47 | Ga0070698_100000012 | 3300005471 | Bacteria | 116260 |
| 48 | Ga0070699_100006190 | 3300005518 | Bacteria | 10454 |
| 49 | Ga0070699_100006417 | 3300005518 | Bacteria | 10244 |
| 50 | Ga0070679_100045831 | 3300005530 | Bacteria | 4357 |
| 51 | Ga0070679_100059043 | 3300005530 | Bacteria | 3823 |
| 52 | Ga0070679_100073657 | 3300005530 | Bacteria | 3406 |
| 53 | Ga0070679_100100328 | 3300005530 | Bacteria | 2882 |
| 54 | Ga0070679_100101849 | 3300005530 | Bacteria | 2858 |
| 55 | Ga0070684_100000046 | 3300005535 | Bacteria | 83793 |
| 56 | Ga0070684_100004173 | 3300005535 | Bacteria | 10946 |
| 57 | Ga0070697_100000415 | 3300005536 | Bacteria | 32903 |
| 58 | Ga0070697_100000873 | 3300005536 | Bacteria | 22668 |
| 59 | Ga0070697_100011527 | 3300005536 | Bacteria | 6908 |
| 60 | Ga0070697_100012935 | 3300005536 | Bacteria | 6539 |
| 61 | Ga0070697_100023806 | 3300005536 | Bacteria | 4874 |
| 62 | Ga0070697_100056940 | 3300005536 | Bacteria | 3181 |
| 63 | Ga0068853_100000018 | 3300005539 | Bacteria | 169680 |
| 64 | Ga0070672_100227333 | 3300005543 | Bacteria | 1566 |
| 65 | Ga0070686_100002933 | 3300005544 | Bacteria | 9360 |
| 66 | Ga0070696_100019055 | 3300005546 | Bacteria | 4645 |
| 67 | Ga0070693_100062441 | 3300005547 | Bacteria | 2168 |
| 68 | Ga0070665_100041486 | 3300005548 | Bacteria | 4626 |
| 69 | Ga0070665_100054529 | 3300005548 | Bacteria | 4010 |
| 70 | Ga0070665_100120631 | 3300005548 | Bacteria | 2624 |
| 71 | Ga0068855_100000561 | 3300005563 | Bacteria | 45527 |
| 72 | Ga0068855_100004123 | 3300005563 | Bacteria | 17718 |
| 73 | Ga0068855_100005867 | 3300005563 | Bacteria | 14988 |
| 74 | Ga0068855_100008084 | 3300005563 | Bacteria | 12710 |
| 75 | Ga0068855_100018901 | 3300005563 | Bacteria | 8282 |
| 76 | Ga0068855_100031913 | 3300005563 | Bacteria | 6288 |
| 77 | Ga0068855_100089323 | 3300005563 | Bacteria | 3558 |
| 78 | Ga0068855_100108024 | 3300005563 | Bacteria | 3196 |
| 79 | Ga0068855_100143577 | 3300005563 | Unclassified | 2718 |
| 80 | Ga0068855_100338553 | 3300005563 | Bacteria | 1659 |
| 81 | Ga0068857_100002120 | 3300005577 | Bacteria | 16140 |
| 82 | Ga0068857_100008858 | 3300005577 | Bacteria | 8717 |
| 83 | Ga0068857_100035983 | 3300005577 | Bacteria | 4386 |
| 84 | Ga0068857_100065600 | 3300005577 | Bacteria | 3229 |
| 85 | Ga0068854_100000003 | 3300005578 | Bacteria | 330045 |
| 86 | Ga0068854_100109776 | 3300005578 | Bacteria | 2079 |
| 87 | Ga0068856_100000798 | 3300005614 | Bacteria | 33950 |
| 88 | Ga0068856_100002997 | 3300005614 | Bacteria | 17285 |
| 89 | Ga0068856_100024485 | 3300005614 | Bacteria | 5878 |
| 90 | Ga0068856_100025696 | 3300005614 | Bacteria | 5742 |
| 91 | Ga0068856_100055209 | 3300005614 | Bacteria | 3920 |
| 92 | Ga0068856_100422380 | 3300005614 | Bacteria | 1353 |
| 93 | Ga0070702_100003077 | 3300005615 | Bacteria | 7384 |
| 94 | Ga0068852_100017292 | 3300005616 | Bacteria | 5654 |
| 95 | Ga0068852_100046504 | 3300005616 | Bacteria | 3699 |
| 96 | Ga0068852_100104645 | 3300005616 | Bacteria | 2562 |
| 97 | Ga0068864_100004173 | 3300005618 | Bacteria | 11872 |
| 98 | Ga0068864_100029576 | 3300005618 | Bacteria | 4641 |
| 99 | Ga0068866_10016713 | 3300005718 | Bacteria | 3286 |
| 100 | Ga0068870_10000328 | 3300005840 | Bacteria | 17644 |
| 101 | Ga0068863_100041270 | 3300005841 | Bacteria | 4387 |
| 102 | Ga0068863_100070810 | 3300005841 | Bacteria | 3298 |
| 103 | Ga0068863_100073612 | 3300005841 | Bacteria | 3232 |
| 104 | Ga0068863_100096975 | 3300005841 | Bacteria | 2799 |
| 105 | Ga0068858_100005083 | 3300005842 | Bacteria | 12890 |
| 106 | Ga0068858_100020939 | 3300005842 | Bacteria | 6111 |
| 107 | Ga0068860_100001762 | 3300005843 | Bacteria | 23105 |
| 108 | Ga0068860_100028876 | 3300005843 | Bacteria | 5336 |
| 109 | Ga0068862_100099629 | 3300005844 | Bacteria | 2540 |
| 110 | Ga0070715_10000381 | 3300006163 | Bacteria | 11109 |
| 111 | Ga0070716_100001342 | 3300006173 | Bacteria | 10893 |
| 112 | Ga0070712_100006237 | 3300006175 | Bacteria | 7383 |
| 113 | Ga0097621_100001063 | 3300006237 | Bacteria | 19228 |
| 114 | Ga0097621_100007623 | 3300006237 | Bacteria | 7757 |
| 115 | Ga0097621_100024064 | 3300006237 | Bacteria | 4751 |
| 116 | Ga0097621_100032652 | 3300006237 | Bacteria | 4140 |
| 117 | Ga0068871_100002040 | 3300006358 | Bacteria | 13691 |
| 118 | Ga0068871_100058016 | 3300006358 | Bacteria | 3151 |
| 119 | Ga0075434_100010936 | 3300006871 | Bacteria | 8534 |
| 120 | Ga0075434_100026500 | 3300006871 | Bacteria | 5680 |
| 121 | Ga0075434_100326944 | 3300006871 | Bacteria | 1554 |
| 122 | Ga0068865_100020197 | 3300006881 | Bacteria | 4319 |
| 123 | Ga0075436_100000954 | 3300006914 | Bacteria | 19380 |
| 124 | Ga0075436_100013864 | 3300006914 | Bacteria | 5520 |
| 125 | Ga0075436_100059352 | 3300006914 | Bacteria | 2643 |
| 126 | Ga0097620_100402587 | 3300006931 | Bacteria | 1465 |
| 127 | Ga0075435_100009445 | 3300007076 | Bacteria | 7062 |
| 128 | Ga0075435_100032744 | 3300007076 | Bacteria | 4106 |
| 129 | Ga0075435_100098137 | 3300007076 | Bacteria | 2425 |
| 130 | Ga0105240_10001506 | 3300009093 | Bacteria | 39687 |
| 131 | Ga0105240_10009558 | 3300009093 | Bacteria | 13727 |
| 132 | Ga0105240_10018293 | 3300009093 | Bacteria | 9418 |
| 133 | Ga0105240_10046086 | 3300009093 | Bacteria | 5526 |
| 134 | Ga0105240_10078216 | 3300009093 | Bacteria | 4073 |
| 135 | Ga0105240_10092688 | 3300009093 | Bacteria | 3688 |
| 136 | Ga0105240_10115600 | 3300009093 | Bacteria | 3239 |
| 137 | Ga0105240_10193802 | 3300009093 | Bacteria | 2388 |
| 138 | Ga0105240_10196978 | 3300009093 | Bacteria | 2364 |
| 139 | Ga0105240_10218435 | 3300009093 | Bacteria | 2222 |
| 140 | Ga0105245_10272377 | 3300009098 | Bacteria | 1652 |
| 141 | Ga0105247_10004769 | 3300009101 | Bacteria | 8635 |
| 142 | Ga0105241_10004936 | 3300009174 | Bacteria | 9837 |
| 143 | Ga0105241_10137885 | 3300009174 | Bacteria | 1983 |
| 144 | Ga0105242_10034283 | 3300009176 | Bacteria | 4069 |
| 145 | Ga0105242_10050365 | 3300009176 | Bacteria | 3391 |
| 146 | Ga0105242_10051061 | 3300009176 | Bacteria | 3369 |
| 147 | Ga0105248_10026496 | 3300009177 | Bacteria | 6450 |
| 148 | Ga0105248_10034689 | 3300009177 | Bacteria | 5645 |
| 149 | Ga0105248_10075454 | 3300009177 | Bacteria | 3790 |
| 150 | Ga0105248_10248722 | 3300009177 | Bacteria | 2001 |
| 151 | Ga0105248_10298362 | 3300009177 | Bacteria | 1815 |
| 152 | Ga0105237_10010385 | 3300009545 | Bacteria | 9911 |
| 153 | Ga0105237_10012891 | 3300009545 | Bacteria | 8783 |
| 154 | Ga0105237_10017150 | 3300009545 | Bacteria | 7511 |
| 155 | Ga0105237_10187014 | 3300009545 | Bacteria | 2071 |
| 156 | Ga0105238_10000417 | 3300009551 | Bacteria | 44911 |
| 157 | Ga0105238_10030478 | 3300009551 | Bacteria | 5491 |
| 158 | Ga0105238_10170527 | 3300009551 | Bacteria | 2152 |
| 159 | Ga0105238_10178567 | 3300009551 | Bacteria | 2100 |
| 160 | Ga0105238_10420098 | 3300009551 | Bacteria | 1332 |
| 161 | Ga0105249_10144473 | 3300009553 | Bacteria | 2284 |
| 162 | Ga0105249_10323770 | 3300009553 | Bacteria | 1553 |
| 163 | Ga0105239_10009275 | 3300010375 | Bacteria | 11123 |
| 164 | Ga0105239_10012476 | 3300010375 | Bacteria | 9464 |
| 165 | Ga0105239_10045922 | 3300010375 | Bacteria | 4787 |
| 166 | Ga0105239_10082417 | 3300010375 | Bacteria | 3542 |
| 167 | Ga0105239_10100912 | 3300010375 | Bacteria | 3193 |
| 168 | Ga0105246_10000514 | 3300011119 | Bacteria | 21093 |
| 169 | Ga0105246_10006656 | 3300011119 | Bacteria | 7065 |
| 170 | Ga0157373_10047333 | 3300013100 | Bacteria | 3067 |
| 171 | Ga0157371_10093027 | 3300013102 | Bacteria | 2136 |
| 172 | Ga0157370_10015956 | 3300013104 | Bacteria | 7622 |
| 173 | Ga0157370_10020199 | 3300013104 | Bacteria | 6657 |
| 174 | Ga0157370_10063627 | 3300013104 | Bacteria | 3494 |
| 175 | Ga0157370_10069028 | 3300013104 | Bacteria | 3339 |
| 176 | Ga0157370_10083065 | 3300013104 | Bacteria | 3012 |
| 177 | Ga0157370_10179031 | 3300013104 | Bacteria | 1970 |
| 178 | Ga0157369_10000258 | 3300013105 | Bacteria | 72711 |
| 179 | Ga0157369_10001044 | 3300013105 | Bacteria | 35014 |
| 180 | Ga0157369_10017143 | 3300013105 | Bacteria | 8137 |
| 181 | Ga0157369_10018701 | 3300013105 | Bacteria | 7769 |
| 182 | Ga0157369_10020633 | 3300013105 | Bacteria | 7368 |
| 183 | Ga0157369_10025176 | 3300013105 | Bacteria | 6607 |
| 184 | Ga0157369_10092093 | 3300013105 | Bacteria | 3235 |
| 185 | Ga0157374_10000407 | 3300013296 | Bacteria | 39138 |
| 186 | Ga0157374_10007075 | 3300013296 | Bacteria | 9552 |
| 187 | Ga0157374_10009662 | 3300013296 | Bacteria | 8282 |
| 188 | Ga0157374_10015250 | 3300013296 | Bacteria | 6739 |
| 189 | Ga0157374_10024622 | 3300013296 | Bacteria | 5397 |
| 190 | Ga0157374_10032440 | 3300013296 | Bacteria | 4755 |
| 191 | Ga0157374_10113808 | 3300013296 | Unclassified | 2604 |
| 192 | Ga0157378_10001370 | 3300013297 | Bacteria | 21881 |
| 193 | Ga0157378_10028193 | 3300013297 | Bacteria | 4952 |
| 194 | Ga0157378_10052563 | 3300013297 | Bacteria | 3625 |
| 195 | Ga0163162_10002318 | 3300013306 | Bacteria | 17854 |
| 196 | Ga0163162_10017716 | 3300013306 | Bacteria | 6970 |
| 197 | Ga0163162_10018581 | 3300013306 | Bacteria | 6811 |
| 198 | Ga0163162_10042351 | 3300013306 | Bacteria | 4557 |
| 199 | Ga0163162_10046852 | 3300013306 | Bacteria | 4334 |
| 200 | Ga0163162_10048531 | 3300013306 | Bacteria | 4254 |
| 201 | Ga0163162_10064122 | 3300013306 | Bacteria | 3719 |
| 202 | Ga0163162_10384565 | 3300013306 | Bacteria | 1537 |
| 203 | Ga0157372_10000335 | 3300013307 | Bacteria | 51775 |
| 204 | Ga0157372_10001157 | 3300013307 | Bacteria | 28525 |
| 205 | Ga0157372_10001450 | 3300013307 | Bacteria | 25669 |
| 206 | Ga0157372_10011585 | 3300013307 | Bacteria | 9383 |
| 207 | Ga0157372_10014010 | 3300013307 | Bacteria | 8566 |
| 208 | Ga0157372_10039762 | 3300013307 | Bacteria | 5192 |
| 209 | Ga0157372_10047240 | 3300013307 | Bacteria | 4783 |
| 210 | Ga0157372_10108472 | 3300013307 | Bacteria | 3177 |
| 211 | Ga0157375_10071884 | 3300013308 | Bacteria | 3474 |
| 212 | Ga0163163_10001182 | 3300014325 | Bacteria | 22122 |
| 213 | Ga0163163_10013929 | 3300014325 | Bacteria | 7377 |
| 214 | Ga0163163_10065407 | 3300014325 | Bacteria | 3609 |
| 215 | Ga0163163_10099496 | 3300014325 | Bacteria | 2930 |
| 216 | Ga0163163_10146696 | 3300014325 | Bacteria | 2404 |
| 217 | Ga0157377_10001169 | 3300014745 | Bacteria | 11142 |
| 218 | Ga0157379_10052468 | 3300014968 | Bacteria | 3643 |
| 219 | Ga0157376_10033462 | 3300014969 | Bacteria | 4139 |
| 220 | Ga0157376_10046292 | 3300014969 | Bacteria | 3587 |
| 221 | Ga0157376_10105250 | 3300014969 | Bacteria | 2474 |
| 222 | Ga0157376_10133843 | 3300014969 | Bacteria | 2216 |
| 223 | Ga0157376_10214401 | 3300014969 | Bacteria | 1779 |
| 224 | Ga0213872_10010433 | 3300021361 | Bacteria | 4423 |
| 225 | Ga0213872_10036584 | 3300021361 | Bacteria | 2243 |
| 226 | Ga0213875_10000002 | 3300021388 | Bacteria | 921066 |
| 227 | Ga0224572_1000226 | 3300024225 | Bacteria | 5572 |
| 228 | Ga0207697_10002002 | 3300025315 | Bacteria | 10794 |
| 229 | Ga0207682_10030414 | 3300025893 | Bacteria | 2163 |
| 230 | Ga0207642_10057337 | 3300025899 | Bacteria | 1791 |
| 231 | Ga0207688_10002641 | 3300025901 | Bacteria | 9698 |
| 232 | Ga0207680_10003203 | 3300025903 | Bacteria | 7695 |
| 233 | Ga0207680_10003740 | 3300025903 | Bacteria | 7159 |
| 234 | Ga0207647_10042767 | 3300025904 | Bacteria | 2840 |
| 235 | Ga0207685_10003391 | 3300025905 | Bacteria | 3866 |
| 236 | Ga0207699_10030546 | 3300025906 | Bacteria | 3016 |
| 237 | Ga0207643_10004729 | 3300025908 | Bacteria | 7305 |
| 238 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 239 | Ga0207705_10000562 | 3300025909 | Bacteria | 31130 |
| 240 | Ga0207705_10002448 | 3300025909 | Bacteria | 14315 |
| 241 | Ga0207684_10002258 | 3300025910 | Bacteria | 19627 |
| 242 | Ga0207654_10016907 | 3300025911 | Bacteria | 3807 |
| 243 | Ga0207707_10001477 | 3300025912 | Bacteria | 21753 |
| 244 | Ga0207707_10028735 | 3300025912 | Bacteria | 4859 |
| 245 | Ga0207707_10049803 | 3300025912 | Bacteria | 3649 |
| 246 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 247 | Ga0207695_10004326 | 3300025913 | Bacteria | 19451 |
| 248 | Ga0207695_10008973 | 3300025913 | Bacteria | 12444 |
| 249 | Ga0207695_10009536 | 3300025913 | Bacteria | 12003 |
| 250 | Ga0207695_10020724 | 3300025913 | Bacteria | 7522 |
| 251 | Ga0207695_10031164 | 3300025913 | Bacteria | 5855 |
| 252 | Ga0207695_10046541 | 3300025913 | Bacteria | 4598 |
| 253 | Ga0207695_10049699 | 3300025913 | Bacteria | 4417 |
| 254 | Ga0207695_10070796 | 3300025913 | Bacteria | 3563 |
| 255 | Ga0207695_10171442 | 3300025913 | Bacteria | 2095 |
| 256 | Ga0207671_10015429 | 3300025914 | Bacteria | 5979 |
| 257 | Ga0207671_10043338 | 3300025914 | Bacteria | 3328 |
| 258 | Ga0207693_10005596 | 3300025915 | Bacteria | 10444 |
| 259 | Ga0207693_10020971 | 3300025915 | Bacteria | 5195 |
| 260 | Ga0207660_10026216 | 3300025917 | Bacteria | 3967 |
| 261 | Ga0207660_10157289 | 3300025917 | Bacteria | 1750 |
| 262 | Ga0207662_10015656 | 3300025918 | Bacteria | 4269 |
| 263 | Ga0207657_10008967 | 3300025919 | Bacteria | 10105 |
| 264 | Ga0207657_10009055 | 3300025919 | Bacteria | 10052 |
| 265 | Ga0207657_10018958 | 3300025919 | Bacteria | 6549 |
| 266 | Ga0207649_10000250 | 3300025920 | Bacteria | 43495 |
| 267 | Ga0207652_10011267 | 3300025921 | Bacteria | 7203 |
| 268 | Ga0207652_10020896 | 3300025921 | Bacteria | 5397 |
| 269 | Ga0207652_10054527 | 3300025921 | Bacteria | 3437 |
| 270 | Ga0207646_10000287 | 3300025922 | Bacteria | 69461 |
| 271 | Ga0207694_10000284 | 3300025924 | Bacteria | 47825 |
| 272 | Ga0207694_10016123 | 3300025924 | Bacteria | 5638 |
| 273 | Ga0207694_10057692 | 3300025924 | Bacteria | 3019 |
| 274 | Ga0207694_10097788 | 3300025924 | Bacteria | 2323 |
| 275 | Ga0207650_10000124 | 3300025925 | Bacteria | 97031 |
| 276 | Ga0207659_10136062 | 3300025926 | Bacteria | 1902 |
| 277 | Ga0207700_10013399 | 3300025928 | Bacteria | 5334 |
| 278 | Ga0207700_10024137 | 3300025928 | Bacteria | 4204 |
| 279 | Ga0207700_10076619 | 3300025928 | Bacteria | 2595 |
| 280 | Ga0207664_10109282 | 3300025929 | Bacteria | 2297 |
| 281 | Ga0207664_10170680 | 3300025929 | Bacteria | 1861 |
| 282 | Ga0207664_10187580 | 3300025929 | Bacteria | 1779 |
| 283 | Ga0207644_10075538 | 3300025931 | Bacteria | 2476 |
| 284 | Ga0207690_10001038 | 3300025932 | Bacteria | 17786 |
| 285 | Ga0207690_10021654 | 3300025932 | Bacteria | 3989 |
| 286 | Ga0207706_10007858 | 3300025933 | Bacteria | 9845 |
| 287 | Ga0207706_10209914 | 3300025933 | Bacteria | 1707 |
| 288 | Ga0207709_10066984 | 3300025935 | Bacteria | 2264 |
| 289 | Ga0207665_10000091 | 3300025939 | Bacteria | 58755 |
| 290 | Ga0207711_10008963 | 3300025941 | Bacteria | 8365 |
| 291 | Ga0207711_10016094 | 3300025941 | Bacteria | 6207 |
| 292 | Ga0207711_10033588 | 3300025941 | Bacteria | 4343 |
| 293 | Ga0207689_10002848 | 3300025942 | Bacteria | 15961 |
| 294 | Ga0207689_10004365 | 3300025942 | Bacteria | 12868 |
| 295 | Ga0207661_10000020 | 3300025944 | Bacteria | 216011 |
| 296 | Ga0207661_10001369 | 3300025944 | Bacteria | 16357 |
| 297 | Ga0207661_10031707 | 3300025944 | Bacteria | 4087 |
| 298 | Ga0207661_10042684 | 3300025944 | Bacteria | 3577 |
| 299 | Ga0207679_10000651 | 3300025945 | Bacteria | 23234 |
| 300 | Ga0207667_10000487 | 3300025949 | Bacteria | 52501 |
| 301 | Ga0207667_10002750 | 3300025949 | Bacteria | 21739 |
| 302 | Ga0207667_10007344 | 3300025949 | Bacteria | 13265 |
| 303 | Ga0207667_10019688 | 3300025949 | Bacteria | 7524 |
| 304 | Ga0207667_10025509 | 3300025949 | Bacteria | 6468 |
| 305 | Ga0207667_10027823 | 3300025949 | Bacteria | 6148 |
| 306 | Ga0207667_10032646 | 3300025949 | Bacteria | 5606 |
| 307 | Ga0207667_10043870 | 3300025949 | Bacteria | 4743 |
| 308 | Ga0207667_10052529 | 3300025949 | Bacteria | 4291 |
| 309 | Ga0207667_10208813 | 3300025949 | Bacteria | 2002 |
| 310 | Ga0207667_10284268 | 3300025949 | Bacteria | 1690 |
| 311 | Ga0207651_10002544 | 3300025960 | Bacteria | 8712 |
| 312 | Ga0207640_10000002 | 3300025981 | Bacteria | 524211 |
| 313 | Ga0207640_10019050 | 3300025981 | Bacteria | 4047 |
| 314 | Ga0207640_10047927 | 3300025981 | Bacteria | 2759 |
| 315 | Ga0207640_10073615 | 3300025981 | Bacteria | 2309 |
| 316 | Ga0207658_10005941 | 3300025986 | Bacteria | 8334 |
| 317 | Ga0207658_10023412 | 3300025986 | Bacteria | 4310 |
| 318 | Ga0207677_10010307 | 3300026023 | Bacteria | 5285 |
| 319 | Ga0207703_10002117 | 3300026035 | Bacteria | 17482 |
| 320 | Ga0207703_10002963 | 3300026035 | Bacteria | 14394 |
| 321 | Ga0207703_10049036 | 3300026035 | Bacteria | 3412 |
| 322 | Ga0207639_10000011 | 3300026041 | Bacteria | 381897 |
| 323 | Ga0207639_10033244 | 3300026041 | Bacteria | 3803 |
| 324 | Ga0207678_10000876 | 3300026067 | Bacteria | 27649 |
| 325 | Ga0207678_10002295 | 3300026067 | Bacteria | 17319 |
| 326 | Ga0207678_10072488 | 3300026067 | Bacteria | 2951 |
| 327 | Ga0207702_10000482 | 3300026078 | Bacteria | 44849 |
| 328 | Ga0207702_10001896 | 3300026078 | Bacteria | 20434 |
| 329 | Ga0207702_10111443 | 3300026078 | Bacteria | 2433 |
| 330 | Ga0207702_10153852 | 3300026078 | Bacteria | 2094 |
| 331 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 332 | Ga0207641_10005200 | 3300026088 | Bacteria | 11128 |
| 333 | Ga0207641_10043335 | 3300026088 | Bacteria | 3779 |
| 334 | Ga0207648_10006340 | 3300026089 | Bacteria | 11763 |
| 335 | Ga0207648_10038004 | 3300026089 | Bacteria | 4237 |
| 336 | Ga0207648_10152290 | 3300026089 | Bacteria | 2041 |
| 337 | Ga0207676_10000272 | 3300026095 | Bacteria | 44817 |
| 338 | Ga0207676_10007635 | 3300026095 | Bacteria | 7677 |
| 339 | Ga0207676_10131282 | 3300026095 | Bacteria | 2130 |
| 340 | Ga0207676_10219290 | 3300026095 | Bacteria | 1693 |
| 341 | Ga0207674_10001665 | 3300026116 | Bacteria | 28586 |
| 342 | Ga0207674_10005786 | 3300026116 | Bacteria | 14664 |
| 343 | Ga0207674_10031585 | 3300026116 | Bacteria | 5561 |
| 344 | Ga0207674_10055709 | 3300026116 | Bacteria | 4018 |
| 345 | Ga0207674_10081430 | 3300026116 | Bacteria | 3240 |
| 346 | Ga0207674_10381125 | 3300026116 | Bacteria | 1363 |
| 347 | Ga0207698_10019440 | 3300026142 | Bacteria | 4651 |
| 348 | Ga0207698_10034266 | 3300026142 | Bacteria | 3699 |
| 349 | Ga0268266_10001414 | 3300028379 | Bacteria | 28640 |
| 350 | Ga0268266_10056533 | 3300028379 | Bacteria | 3375 |
| 351 | Ga0268265_10070671 | 3300028380 | Bacteria | 2715 |
| 352 | Ga0268264_10002593 | 3300028381 | Bacteria | 15807 |
| 353 | Ga0268264_10016431 | 3300028381 | Bacteria | 6059 |
| 354 | Ga0268264_10115995 | 3300028381 | Bacteria | 2353 |
| 355 | Ga0265760_10006244 | 3300031090 | Bacteria | 3410 |
| 356 | Ga0265325_10000527 | 3300031241 | Bacteria | 27632 |
| 357 | Ga0265325_10002176 | 3300031241 | Bacteria | 13353 |
| 358 | Ga0265329_10038615 | 3300031242 | Bacteria | 1536 |
| 359 | Ga0265340_10059230 | 3300031247 | Bacteria | 1837 |
| 360 | Ga0265339_10067213 | 3300031249 | Bacteria | 1918 |
| 361 | Ga0265327_10028851 | 3300031251 | Bacteria | 3165 |
| 362 | Ga0265316_10015273 | 3300031344 | Bacteria | 6719 |
| 363 | Ga0316576_10093414 | 3300031727 | Bacteria | 2242 |
| 364 | Ga0316576_10114467 | 3300031727 | Bacteria | 2023 |
| 365 | Ga0316578_10002792 | 3300031728 | Bacteria | 7788 |
| 366 | Ga0307413_10053270 | 3300031824 | Bacteria | 2448 |
| 367 | Ga0307410_10095453 | 3300031852 | Bacteria | 2120 |
| 368 | Ga0307407_10028476 | 3300031903 | Bacteria | 2987 |
| 369 | Ga0307409_100043862 | 3300031995 | Bacteria | 3363 |
| 370 | Ga0307411_10009820 | 3300032005 | Bacteria | 5060 |
| 371 | Ga0307415_100132889 | 3300032126 | Bacteria | 1887 |
| 372 | Ga0316583_10023913 | 3300032133 | Bacteria | 2182 |
| 373 | Ga0316593_10001595 | 3300032168 | Bacteria | 5058 |
| 374 | Ga0307510_10017778 | 3300033180 | Bacteria | 8377 |
| 375 | Ga0307510_10036206 | 3300033180 | Bacteria | 5496 |
| 376 | Ga0316596_1001071 | 3300033541 | Bacteria | 5302 |
| 377 | Ga0373945_0049748 | 3300035116 | Bacteria | 1539 |
| 378 | Ga0373931_0054119 | 3300035691 | Bacteria | 2144 |
| 379 | Ga0373935_0021663 | 3300035692 | Bacteria | 3937 |
| 380 | Ga0373927_0062625 | 3300035695 | Bacteria | 2406 |
| 381 | Ga0373933_0023429 | 3300035724 | Bacteria | 3527 |
| 382 | Ga0373947_0029709 | 3300035725 | Bacteria | 3208 |
| 383 | Ga0373937_0035458 | 3300036401 | Bacteria | 4541 |
| 384 | Ga0373937_0038468 | 3300036401 | Bacteria | 4359 |
| 385 | Ga0373937_0129731 | 3300036401 | Bacteria | 2354 |
| 386 | Ga0316582_0068931 | 3300036647 | Bacteria | 2285 |
| 387 | Ga0316584_0112775 | 3300036712 | Bacteria | 2034 |
| 388 | Ga0373925_0043194 | 3300037068 | Bacteria | 3345 |
| 389 | Ga0395899_0193748 | 3300037312 | Bacteria | 1421 |
| 390 | Ga0395900_0133885 | 3300037418 | Bacteria | 2539 |
| 391 | Ga0395905_0077664 | 3300037471 | Bacteria | 3111 |
| 392 | Ga0395905_0202384 | 3300037471 | Bacteria | 1861 |
| 393 | Ga0436364_0815945 | 3300037853 | Bacteria | 3261 |
| 394 | Ga0436364_0940248 | 3300037853 | Bacteria | 592364 |
| 395 | Ga0436360_0493045 | 3300039438 | Bacteria | 2025 |
| 396 | Ga0436360_1028171 | 3300039438 | Bacteria | 8260 |
| 397 | Ga0436363_0138860 | 3300039450 | Unclassified | 2107 |
| 398 | Ga0436363_1474552 | 3300039450 | Bacteria | 3797 |
| 399 | Ga0453683_0009579 | 3300044673 | Bacteria | 6463 |
| 400 | Ga0451576_0054399 | 3300045051 | Bacteria | 4191 |
| 401 | Ga0451576_0138573 | 3300045051 | Bacteria | 2538 |
| 402 | Ga0451576_0190149 | 3300045051 | Bacteria | 2144 |
| 403 | Ga0451576_0380643 | 3300045051 | Bacteria | 1479 |
| 404 | Ga0466958_0139262 | 3300045836 | Bacteria | 1527 |
| 405 | Ga0466967_0002370 | 3300045976 | Bacteria | 11666 |
| 406 | Ga0466967_0022319 | 3300045976 | Bacteria | 5162 |
| 407 | Ga0466967_0079929 | 3300045976 | Bacteria | 2949 |
| 408 | Ga0466967_0224665 | 3300045976 | Bacteria | 1786 |
| 409 | Ga0466967_0306159 | 3300045976 | Bacteria | 1530 |
| 410 | Ga0495592_0006436 | 3300046454 | Bacteria | 8744 |
| 411 | Ga0495592_0068694 | 3300046454 | Bacteria | 2586 |
| 412 | Ga0495603_0059566 | 3300046455 | Bacteria | 2257 |
| 413 | Ga0495629_0101363 | 3300046459 | Bacteria | 2009 |
| 414 | Ga0495651_0040560 | 3300046462 | Bacteria | 3620 |
| 415 | Ga0495651_0048333 | 3300046462 | Bacteria | 3286 |
| 416 | Ga0495650_0017972 | 3300046471 | Bacteria | 3529 |
| 417 | Ga0495580_0001919 | 3300046472 | Bacteria | 18293 |
| 418 | Ga0495580_0005046 | 3300046472 | Bacteria | 10999 |
| 419 | Ga0495580_0008275 | 3300046472 | Bacteria | 8277 |
| 420 | Ga0495580_0014067 | 3300046472 | Bacteria | 6084 |
| 421 | Ga0495580_0018534 | 3300046472 | Bacteria | 5181 |
| 422 | Ga0495580_0027406 | 3300046472 | Bacteria | 4146 |
| 423 | Ga0495580_0061059 | 3300046472 | Bacteria | 2647 |
| 424 | Ga0495580_0142469 | 3300046472 | Bacteria | 1661 |
| 425 | Ga0495582_0011050 | 3300046473 | Bacteria | 4970 |
| 426 | Ga0495639_0027112 | 3300046475 | Bacteria | 2535 |
| 427 | Ga0495664_0002715 | 3300046477 | Bacteria | 9508 |
| 428 | Ga0495585_0007731 | 3300046492 | Bacteria | 6551 |
| 429 | Ga0495594_0000099 | 3300046499 | Bacteria | 40889 |
| 430 | Ga0495594_0004517 | 3300046499 | Bacteria | 7158 |
| 431 | Ga0495594_0035651 | 3300046499 | Bacteria | 2711 |
| 432 | Ga0495596_0008429 | 3300046500 | Bacteria | 4587 |
| 433 | Ga0495583_0035647 | 3300046506 | Bacteria | 2373 |
| 434 | Ga0495606_0107694 | 3300046507 | Bacteria | 1686 |
| 435 | Ga0495606_0140115 | 3300046507 | Bacteria | 1429 |
| 436 | Ga0495608_0063091 | 3300046511 | Bacteria | 2433 |
| 437 | Ga0495608_0182540 | 3300046511 | Bacteria | 1327 |
| 438 | Ga0495628_0077809 | 3300046516 | Bacteria | 2580 |
| 439 | Ga0495644_0000416 | 3300046523 | Bacteria | 18991 |
| 440 | Ga0495642_0001218 | 3300046528 | Bacteria | 11833 |
| 441 | Ga0495652_0011685 | 3300046529 | Bacteria | 7935 |
| 442 | Ga0495652_0064298 | 3300046529 | Bacteria | 3086 |
| 443 | Ga0495665_0084335 | 3300046531 | Bacteria | 1670 |
| 444 | Ga0495640_0013434 | 3300046533 | Bacteria | 6221 |
| 445 | Ga0495609_0005301 | 3300046538 | Bacteria | 6827 |
| 446 | Ga0495609_0017183 | 3300046538 | Bacteria | 3362 |
| 447 | Ga0495645_0001383 | 3300046543 | Bacteria | 16386 |
| 448 | Ga0495645_0020216 | 3300046543 | Bacteria | 4801 |
| 449 | Ga0495645_0022207 | 3300046543 | Bacteria | 4590 |
| 450 | Ga0495645_0064156 | 3300046543 | Bacteria | 2658 |
| 451 | Ga0495633_0008466 | 3300046558 | Bacteria | 5785 |
| 452 | Ga0495667_0123675 | 3300046559 | Bacteria | 1670 |
| 453 | Ga0495668_0006171 | 3300046616 | Bacteria | 7930 |
| 454 | Ga0495625_0000046 | 3300046660 | Bacteria | 202299 |
| 455 | Ga0495635_0191874 | 3300046663 | Bacteria | 1387 |
| 456 | Ga0495659_0007473 | 3300046664 | Bacteria | 3469 |
| 457 | Ga0495659_0022474 | 3300046664 | Bacteria | 2135 |
| 458 | Ga0495599_0121683 | 3300046678 | Bacteria | 1622 |
| 459 | Ga0495623_0018679 | 3300046679 | Bacteria | 4477 |
| 460 | Ga0495646_0003839 | 3300046680 | Bacteria | 9389 |
| 461 | Ga0495658_0063133 | 3300046683 | Bacteria | 2131 |
| 462 | Ga0495669_0012415 | 3300046684 | Bacteria | 3626 |
| 463 | Ga0495613_0011519 | 3300046689 | Bacteria | 6577 |
| 464 | Ga0495613_0032039 | 3300046689 | Bacteria | 3905 |
| 465 | Ga0495613_0057063 | 3300046689 | Bacteria | 2867 |
| 466 | Ga0495600_0003241 | 3300046809 | Bacteria | 9523 |
| 467 | Ga0495600_0010958 | 3300046809 | Bacteria | 5641 |
| 468 | Ga0495581_0006774 | 3300047315 | Bacteria | 6642 |
| 469 | Ga0495604_0013626 | 3300047317 | Bacteria | 6483 |
| 470 | Ga0495674_0011091 | 3300047319 | Bacteria | 8508 |
| 471 | Ga0495674_0024128 | 3300047319 | Bacteria | 5596 |
| 472 | Ga0495674_0059092 | 3300047319 | Bacteria | 3350 |
| 473 | Ga0495674_0113918 | 3300047319 | Bacteria | 2290 |
| 474 | Ga0495672_0000255 | 3300047320 | Bacteria | 74469 |
| 475 | Ga0495676_0006631 | 3300047321 | Bacteria | 10673 |
| 476 | Ga0495680_0035035 | 3300047322 | Bacteria | 4047 |
| 477 | Ga0495675_0128735 | 3300047444 | Bacteria | 1574 |
| 478 | Ga0495684_0022022 | 3300047471 | Bacteria | 4907 |
| 479 | Ga0495684_0049031 | 3300047471 | Bacteria | 3228 |
| 480 | Ga0495684_0050854 | 3300047471 | Bacteria | 3163 |
| 481 | Ga0495686_0000009 | 3300047472 | Bacteria | 661643 |
| 482 | Ga0495686_0001445 | 3300047472 | Bacteria | 25895 |
| 483 | Ga0495602_0028489 | 3300048088 | Bacteria | 5343 |
| 484 | Ga0495602_0042114 | 3300048088 | Bacteria | 4163 |
| 485 | Ga0495602_0083079 | 3300048088 | Bacteria | 2685 |
| 486 | Ga0495614_0006639 | 3300048089 | Bacteria | 5181 |
| 487 | Ga0496100_0009636 | 3300048903 | Bacteria | 5430 |
| 488 | Ga0496101_0017171 | 3300048904 | Bacteria | 4905 |
| 489 | Ga0496103_0015564 | 3300048906 | Bacteria | 4530 |
| 490 | Ga0496104_0000266 | 3300048907 | Bacteria | 46193 |
| 491 | Ga0496104_0055137 | 3300048907 | Bacteria | 3758 |
| 492 | Ga0496104_0177702 | 3300048907 | Bacteria | 2039 |
| 493 | Ga0496104_0191438 | 3300048907 | Bacteria | 1957 |
| 494 | Ga0496105_0075874 | 3300048908 | Bacteria | 2776 |
| 495 | Ga0496108_0000200 | 3300048911 | Bacteria | 55323 |
| 496 | Ga0496109_0002994 | 3300048912 | Bacteria | 14118 |
| 497 | Ga0496110_0001074 | 3300048913 | Bacteria | 19279 |
| 498 | Ga0496111_0009147 | 3300048914 | Bacteria | 6593 |
| 499 | Ga0496112_0000070 | 3300048915 | Bacteria | 67934 |
| 500 | Ga0496112_0014295 | 3300048915 | Bacteria | 7355 |
| 501 | Ga0496112_0015754 | 3300048915 | Bacteria | 7061 |
| 502 | Ga0496112_0032726 | 3300048915 | Bacteria | 5049 |
| 503 | Ga0496112_0033744 | 3300048915 | Bacteria | 4976 |
| 504 | Ga0496113_0000064 | 3300048916 | Bacteria | 45691 |
| 505 | Ga0496114_0048998 | 3300048917 | Bacteria | 3514 |
| 506 | Ga0496114_0225906 | 3300048917 | Bacteria | 1644 |
| 507 | Ga0496115_0009016 | 3300048918 | Bacteria | 7400 |
| 508 | Ga0496115_0047855 | 3300048918 | Bacteria | 3420 |
| 509 | Ga0496126_0000014 | 3300048929 | Bacteria | 686881 |
| 510 | Ga0496126_0001561 | 3300048929 | Bacteria | 35185 |
| 511 | Ga0495682_0016710 | 3300049460 | Bacteria | 2777 |
| 512 | Ga0501032_0001102 | 3300049569 | Bacteria | 21589 |
| 513 | Ga0501032_0010351 | 3300049569 | Bacteria | 6723 |
| 514 | Ga0501033_0007098 | 3300049570 | Bacteria | 8744 |
| 515 | Ga0501034_0000711 | 3300049571 | Bacteria | 50557 |
| 516 | Ga0501034_0002168 | 3300049571 | Bacteria | 24343 |
| 517 | Ga0501034_0101615 | 3300049571 | Bacteria | 2869 |
| 518 | Ga0501036_0000496 | 3300049572 | Bacteria | 28143 |
| 519 | Ga0501036_0006025 | 3300049572 | Bacteria | 9830 |
| 520 | Ga0501037_0002012 | 3300049573 | Bacteria | 14724 |
| 521 | Ga0501037_0016261 | 3300049573 | Bacteria | 5475 |
| 522 | Ga0501038_0000200 | 3300049574 | Bacteria | 51512 |
| 523 | Ga0501038_0000751 | 3300049574 | Bacteria | 28935 |
| 524 | Ga0501039_0004060 | 3300049575 | Bacteria | 11004 |
| 525 | Ga0501043_0009252 | 3300049579 | Bacteria | 7741 |
| 526 | Ga0501043_0041731 | 3300049579 | Bacteria | 3604 |
| 527 | Ga0501046_0000062 | 3300049580 | Bacteria | 118786 |
| 528 | Ga0501046_0002677 | 3300049580 | Bacteria | 16613 |
| 529 | Ga0501047_0020569 | 3300049581 | Bacteria | 6337 |
| 530 | Ga0501047_0027395 | 3300049581 | Bacteria | 5489 |
| 531 | Ga0501048_0086925 | 3300049582 | Bacteria | 2205 |
| 532 | Ga0501067_0008306 | 3300049583 | Bacteria | 5763 |
| 533 | Ga0501068_0004234 | 3300049584 | Bacteria | 7782 |
| 534 | Ga0501069_0000110 | 3300049585 | Bacteria | 36780 |
| 535 | Ga0501070_0003712 | 3300049586 | Bacteria | 13192 |
| 536 | Ga0501072_0000964 | 3300049588 | Bacteria | 21230 |
| 537 | Ga0501073_0008465 | 3300049589 | Bacteria | 7628 |
| 538 | Ga0501073_0035377 | 3300049589 | Bacteria | 3551 |
| 539 | Ga0501074_0020479 | 3300049590 | Bacteria | 4807 |
| 540 | Ga0501074_0048136 | 3300049590 | Bacteria | 3079 |
| 541 | Ga0501079_0003644 | 3300049741 | Bacteria | 11343 |
| 542 | Ga0501080_0000050 | 3300049742 | Bacteria | 76157 |
| 543 | Ga0501080_0043399 | 3300049742 | Bacteria | 4187 |
| 544 | Ga0501083_0008074 | 3300049744 | Bacteria | 7444 |
| 545 | Ga0501083_0177789 | 3300049744 | Bacteria | 1390 |
| 546 | Ga0501035_0007121 | 3300049822 | Bacteria | 10456 |
| 547 | Ga0501035_0019355 | 3300049822 | Bacteria | 6262 |
| 548 | Ga0501044_0010199 | 3300049823 | Bacteria | 10206 |
| 549 | Ga0501044_0016734 | 3300049823 | Bacteria | 7872 |
| 550 | nmdc:mga0n895_12898_c1 | 3300050512 | Bacteria | 7512 |
| 551 | nmdc:mga0n895_13940_c1 | 3300050512 | Bacteria | 7279 |
| 552 | nmdc:mga0rr50_186935_c1 | 3300050513 | Bacteria | 1696 |
| 553 | nmdc:mga0rr50_54700_c1 | 3300050513 | Bacteria | 2975 |
| 554 | nmdc:mga0rr50_85136_c1 | 3300050513 | Bacteria | 2449 |
| 555 | nmdc:mga08x19_12740_c1 | 3300050514 | Bacteria | 5071 |
| 556 | nmdc:mga08x19_16187_c1 | 3300050514 | Bacteria | 4545 |
| 557 | nmdc:mga08x19_8802_c1 | 3300050514 | Bacteria | 6023 |
| 558 | nmdc:mga0a205_50963_c1 | 3300050515 | Bacteria | 3996 |
| 559 | Ga0495601_0147761 | 3300053077 | Bacteria | 1534 |
| 560 | Ga0500651_0000012 | 3300053093 | Bacteria | 243306 |
| 561 | Ga0500595_000027 | 3300053119 | Bacteria | 130868 |
| 562 | Ga0501084_0000631 | 3300054114 | Bacteria | 26885 |
| 563 | Ga0500661_002018 | 3300055283 | Bacteria | 3830 |
| 564 | Ga0501082_0000292 | 3300060353 | Bacteria | 44134 |
| 565 | Ga0501082_0002799 | 3300060353 | Bacteria | 15221 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046678 | Ga0495599_0121683 | Ga0495599_0121683_11_1000 | 313 |
| 2 | 3300025912 | Ga0207707_10028735 | Ga0207707_100287352 | 371 |
| 3 | 3300032133 | Ga0316583_10023913 | Ga0316583_100239131 | 377 |
| 4 | 3300025913 | Ga0207695_10171442 | Ga0207695_101714422 | 382 |
| 5 | 3300037312 | Ga0395899_0193748 | Ga0395899_0193748_100_1287 | 382 |
| 6 | 3300037418 | Ga0395900_0133885 | Ga0395900_0133885_501_1688 | 382 |
| 7 | 3300037471 | Ga0395905_0202384 | Ga0395905_0202384_336_1523 | 382 |
| 8 | 3300009551 | Ga0105238_10420098 | Ga0105238_104200982 | 383 |
| 9 | 3300024225 | Ga0224572_1000226 | Ga0224572_10002264 | 386 |
| 10 | 3300049571 | Ga0501034_0101615 | Ga0501034_0101615_12_1223 | 386 |
| 11 | 3300005330 | Ga0070690_100004886 | Ga0070690_1000048864 | 387 |
| 12 | 3300005335 | Ga0070666_10061799 | Ga0070666_100617992 | 387 |
| 13 | 3300005338 | Ga0068868_100102670 | Ga0068868_1001026702 | 387 |
| 14 | 3300005367 | Ga0070667_100008767 | Ga0070667_10000876711 | 387 |
| 15 | 3300005459 | Ga0068867_100057047 | Ga0068867_1000570472 | 387 |
| 16 | 3300005530 | Ga0070679_100100328 | Ga0070679_1001003282 | 387 |
| 17 | 3300005548 | Ga0070665_100120631 | Ga0070665_1001206312 | 387 |
| 18 | 3300005563 | Ga0068855_100089323 | Ga0068855_1000893233 | 387 |
| 19 | 3300005563 | Ga0068855_100338553 | Ga0068855_1003385532 | 387 |
| 20 | 3300005577 | Ga0068857_100008858 | Ga0068857_1000088584 | 387 |
| 21 | 3300005614 | Ga0068856_100024485 | Ga0068856_1000244855 | 387 |
| 22 | 3300005841 | Ga0068863_100073612 | Ga0068863_1000736122 | 387 |
| 23 | 3300005842 | Ga0068858_100005083 | Ga0068858_1000050832 | 387 |
| 24 | 3300005843 | Ga0068860_100001762 | Ga0068860_10000176210 | 387 |
| 25 | 3300006237 | Ga0097621_100007623 | Ga0097621_1000076236 | 387 |
| 26 | 3300009093 | Ga0105240_10009558 | Ga0105240_100095589 | 387 |
| 27 | 3300009176 | Ga0105242_10050365 | Ga0105242_100503653 | 387 |
| 28 | 3300009176 | Ga0105242_10051061 | Ga0105242_100510613 | 387 |
| 29 | 3300009177 | Ga0105248_10075454 | Ga0105248_100754543 | 387 |
| 30 | 3300009545 | Ga0105237_10017150 | Ga0105237_100171502 | 387 |
| 31 | 3300010375 | Ga0105239_10045922 | Ga0105239_100459223 | 387 |
| 32 | 3300011119 | Ga0105246_10006656 | Ga0105246_100066564 | 387 |
| 33 | 3300013104 | Ga0157370_10015956 | Ga0157370_100159566 | 387 |
| 34 | 3300013104 | Ga0157370_10083065 | Ga0157370_100830652 | 387 |
| 35 | 3300013297 | Ga0157378_10052563 | Ga0157378_100525633 | 387 |
| 36 | 3300013306 | Ga0163162_10017716 | Ga0163162_100177164 | 387 |
| 37 | 3300013306 | Ga0163162_10048531 | Ga0163162_100485311 | 387 |
| 38 | 3300013306 | Ga0163162_10064122 | Ga0163162_100641223 | 387 |
| 39 | 3300014325 | Ga0163163_10146696 | Ga0163163_101466962 | 387 |
| 40 | 3300014969 | Ga0157376_10133843 | Ga0157376_101338432 | 387 |
| 41 | 3300025903 | Ga0207680_10003740 | Ga0207680_100037406 | 387 |
| 42 | 3300025912 | Ga0207707_10049803 | Ga0207707_100498032 | 387 |
| 43 | 3300025913 | Ga0207695_10004326 | Ga0207695_100043263 | 387 |
| 44 | 3300025913 | Ga0207695_10020724 | Ga0207695_100207242 | 387 |
| 45 | 3300025921 | Ga0207652_10054527 | Ga0207652_100545273 | 387 |
| 46 | 3300025924 | Ga0207694_10016123 | Ga0207694_100161233 | 387 |
| 47 | 3300025935 | Ga0207709_10066984 | Ga0207709_100669842 | 387 |
| 48 | 3300025941 | Ga0207711_10008963 | Ga0207711_100089633 | 387 |
| 49 | 3300025944 | Ga0207661_10042684 | Ga0207661_100426842 | 387 |
| 50 | 3300025949 | Ga0207667_10019688 | Ga0207667_100196889 | 387 |
| 51 | 3300025949 | Ga0207667_10043870 | Ga0207667_100438705 | 387 |
| 52 | 3300025981 | Ga0207640_10073615 | Ga0207640_100736152 | 387 |
| 53 | 3300025986 | Ga0207658_10005941 | Ga0207658_100059413 | 387 |
| 54 | 3300026035 | Ga0207703_10002117 | Ga0207703_1000211711 | 387 |
| 55 | 3300026116 | Ga0207674_10031585 | Ga0207674_100315852 | 387 |
| 56 | 3300028381 | Ga0268264_10002593 | Ga0268264_1000259311 | 387 |
| 57 | 3300031090 | Ga0265760_10006244 | Ga0265760_100062444 | 387 |
| 58 | 3300031241 | Ga0265325_10000527 | Ga0265325_1000052720 | 387 |
| 59 | 3300048918 | Ga0496115_0047855 | Ga0496115_0047855_25_1218 | 387 |
| 60 | 3300005548 | Ga0070665_100054529 | Ga0070665_1000545293 | 388 |
| 61 | 3300005614 | Ga0068856_100422380 | Ga0068856_1004223802 | 388 |
| 62 | 3300009093 | Ga0105240_10001506 | Ga0105240_100015065 | 388 |
| 63 | 3300009545 | Ga0105237_10012891 | Ga0105237_100128917 | 388 |
| 64 | 3300013105 | Ga0157369_10025176 | Ga0157369_100251767 | 388 |
| 65 | 3300025926 | Ga0207659_10136062 | Ga0207659_101360622 | 388 |
| 66 | 3300031727 | Ga0316576_10093414 | Ga0316576_100934142 | 388 |
| 67 | 3300031727 | Ga0316576_10114467 | Ga0316576_101144671 | 388 |
| 68 | 3300031728 | Ga0316578_10002792 | Ga0316578_100027922 | 388 |
| 69 | 3300032168 | Ga0316593_10001595 | Ga0316593_100015956 | 388 |
| 70 | 3300033541 | Ga0316596_1001071 | Ga0316596_10010716 | 388 |
| 71 | 3300036647 | Ga0316582_0068931 | Ga0316582_0068931_622_1821 | 388 |
| 72 | 3300036712 | Ga0316584_0112775 | Ga0316584_0112775_357_1556 | 388 |
| 73 | 3300045051 | Ga0451576_0054399 | Ga0451576_0054399_668_1861 | 388 |
| 74 | 3300045836 | Ga0466958_0139262 | Ga0466958_0139262_303_1502 | 388 |
| 75 | 3300045976 | Ga0466967_0002370 | Ga0466967_0002370_944_2143 | 388 |
| 76 | 3300046499 | Ga0495594_0035651 | Ga0495594_0035651_1426_2640 | 388 |
| 77 | 3300046543 | Ga0495645_0022207 | Ga0495645_0022207_534_1727 | 388 |
| 78 | 3300060353 | Ga0501082_0000292 | Ga0501082_0000292_37511_38704 | 388 |
| 79 | 3300005329 | Ga0070683_100000032 | Ga0070683_10000003247 | 389 |
| 80 | 3300005535 | Ga0070684_100000046 | Ga0070684_10000004647 | 389 |
| 81 | 3300005563 | Ga0068855_100108024 | Ga0068855_1001080243 | 389 |
| 82 | 3300006871 | Ga0075434_100326944 | Ga0075434_1003269441 | 389 |
| 83 | 3300009093 | Ga0105240_10078216 | Ga0105240_100782163 | 389 |
| 84 | 3300009177 | Ga0105248_10298362 | Ga0105248_102983622 | 389 |
| 85 | 3300009545 | Ga0105237_10010385 | Ga0105237_100103859 | 389 |
| 86 | 3300010375 | Ga0105239_10100912 | Ga0105239_101009122 | 389 |
| 87 | 3300014969 | Ga0157376_10214401 | Ga0157376_102144012 | 389 |
| 88 | 3300025914 | Ga0207671_10015429 | Ga0207671_100154299 | 389 |
| 89 | 3300025941 | Ga0207711_10033588 | Ga0207711_100335883 | 389 |
| 90 | 3300025944 | Ga0207661_10000020 | Ga0207661_10000020150 | 389 |
| 91 | 3300025949 | Ga0207667_10052529 | Ga0207667_100525293 | 389 |
| 92 | 3300025949 | Ga0207667_10208813 | Ga0207667_102088132 | 389 |
| 93 | 3300026089 | Ga0207648_10152290 | Ga0207648_101522902 | 389 |
| 94 | 3300031344 | Ga0265316_10015273 | Ga0265316_100152732 | 389 |
| 95 | 3300046454 | Ga0495592_0006436 | Ga0495592_0006436_3500_4696 | 389 |
| 96 | 3300046462 | Ga0495651_0048333 | Ga0495651_0048333_1204_2400 | 389 |
| 97 | 3300046472 | Ga0495580_0001919 | Ga0495580_0001919_7248_8444 | 389 |
| 98 | 3300046511 | Ga0495608_0063091 | Ga0495608_0063091_380_1576 | 389 |
| 99 | 3300046529 | Ga0495652_0064298 | Ga0495652_0064298_1779_2975 | 389 |
| 100 | 3300046543 | Ga0495645_0064156 | Ga0495645_0064156_792_1988 | 389 |
| 101 | 3300046663 | Ga0495635_0191874 | Ga0495635_0191874_142_1338 | 389 |
| 102 | 3300046679 | Ga0495623_0018679 | Ga0495623_0018679_213_1409 | 389 |
| 103 | 3300046689 | Ga0495613_0057063 | Ga0495613_0057063_1220_2416 | 389 |
| 104 | 3300047322 | Ga0495680_0035035 | Ga0495680_0035035_549_1745 | 389 |
| 105 | 3300047471 | Ga0495684_0049031 | Ga0495684_0049031_472_1668 | 389 |
| 106 | 3300048088 | Ga0495602_0042114 | Ga0495602_0042114_823_2019 | 389 |
| 107 | 3300050513 | nmdc:mga0rr50_186935_c1 | nmdc:mga0rr50_186935_c1_118_1332 | 389 |
| 108 | 3300005841 | Ga0068863_100070810 | Ga0068863_1000708103 | 390 |
| 109 | 3300025913 | Ga0207695_10009536 | Ga0207695_100095365 | 390 |
| 110 | 3300025914 | Ga0207671_10043338 | Ga0207671_100433383 | 390 |
| 111 | 3300035695 | Ga0373927_0062625 | Ga0373927_0062625_140_1339 | 390 |
| 112 | 3300046454 | Ga0495592_0068694 | Ga0495592_0068694_53_1279 | 390 |
| 113 | 3300046472 | Ga0495580_0008275 | Ga0495580_0008275_3554_4753 | 390 |
| 114 | 3300046472 | Ga0495580_0014067 | Ga0495580_0014067_3728_4927 | 390 |
| 115 | 3300046511 | Ga0495608_0182540 | Ga0495608_0182540_19_1218 | 390 |
| 116 | 3300047471 | Ga0495684_0022022 | Ga0495684_0022022_3211_4410 | 390 |
| 117 | 3300006914 | Ga0075436_100000954 | Ga0075436_1000009542 | 391 |
| 118 | 3300006931 | Ga0097620_100402587 | Ga0097620_1004025871 | 391 |
| 119 | 3300007076 | Ga0075435_100032744 | Ga0075435_1000327445 | 391 |
| 120 | 3300009093 | Ga0105240_10196978 | Ga0105240_101969783 | 391 |
| 121 | 3300009177 | Ga0105248_10034689 | Ga0105248_100346894 | 391 |
| 122 | 3300009551 | Ga0105238_10170527 | Ga0105238_101705272 | 391 |
| 123 | 3300009553 | Ga0105249_10144473 | Ga0105249_101444732 | 391 |
| 124 | 3300035692 | Ga0373935_0021663 | Ga0373935_0021663_1557_2780 | 391 |
| 125 | 3300035725 | Ga0373947_0029709 | Ga0373947_0029709_1209_2432 | 391 |
| 126 | 3300037068 | Ga0373925_0043194 | Ga0373925_0043194_969_2192 | 391 |
| 127 | 3300046531 | Ga0495665_0084335 | Ga0495665_0084335_336_1559 | 391 |
| 128 | 3300046559 | Ga0495667_0123675 | Ga0495667_0123675_26_1231 | 391 |
| 129 | 3300047319 | Ga0495674_0059092 | Ga0495674_0059092_1462_2685 | 391 |
| 130 | 3300050514 | nmdc:mga08x19_12740_c1 | nmdc:mga08x19_12740_c1_3002_4228 | 391 |
| 131 | 3300005539 | Ga0068853_100000018 | Ga0068853_10000001897 | 392 |
| 132 | 3300005578 | Ga0068854_100000003 | Ga0068854_10000000392 | 392 |
| 133 | 3300025913 | Ga0207695_10008973 | Ga0207695_100089739 | 392 |
| 134 | 3300025919 | Ga0207657_10009055 | Ga0207657_100090557 | 392 |
| 135 | 3300025932 | Ga0207690_10001038 | Ga0207690_100010388 | 392 |
| 136 | 3300025981 | Ga0207640_10000002 | Ga0207640_10000002249 | 392 |
| 137 | 3300026041 | Ga0207639_10000011 | Ga0207639_10000011123 | 392 |
| 138 | 3300005334 | Ga0068869_100005138 | Ga0068869_1000051385 | 393 |
| 139 | 3300005338 | Ga0068868_100105114 | Ga0068868_1001051143 | 393 |
| 140 | 3300005547 | Ga0070693_100062441 | Ga0070693_1000624412 | 393 |
| 141 | 3300005842 | Ga0068858_100020939 | Ga0068858_1000209393 | 393 |
| 142 | 3300005843 | Ga0068860_100028876 | Ga0068860_1000288762 | 393 |
| 143 | 3300006358 | Ga0068871_100058016 | Ga0068871_1000580163 | 393 |
| 144 | 3300009545 | Ga0105237_10187014 | Ga0105237_101870141 | 393 |
| 145 | 3300010375 | Ga0105239_10012476 | Ga0105239_100124765 | 393 |
| 146 | 3300013105 | Ga0157369_10017143 | Ga0157369_100171434 | 393 |
| 147 | 3300013296 | Ga0157374_10015250 | Ga0157374_100152503 | 393 |
| 148 | 3300013306 | Ga0163162_10042351 | Ga0163162_100423515 | 393 |
| 149 | 3300013306 | Ga0163162_10046852 | Ga0163162_100468522 | 393 |
| 150 | 3300013308 | Ga0157375_10071884 | Ga0157375_100718843 | 393 |
| 151 | 3300014969 | Ga0157376_10046292 | Ga0157376_100462923 | 393 |
| 152 | 3300014969 | Ga0157376_10105250 | Ga0157376_101052503 | 393 |
| 153 | 3300025933 | Ga0207706_10209914 | Ga0207706_102099141 | 393 |
| 154 | 3300025942 | Ga0207689_10002848 | Ga0207689_100028487 | 393 |
| 155 | 3300026035 | Ga0207703_10002963 | Ga0207703_1000296311 | 393 |
| 156 | 3300026035 | Ga0207703_10049036 | Ga0207703_100490363 | 393 |
| 157 | 3300026089 | Ga0207648_10038004 | Ga0207648_100380043 | 393 |
| 158 | 3300028381 | Ga0268264_10016431 | Ga0268264_100164312 | 393 |
| 159 | 3300047471 | Ga0495684_0050854 | Ga0495684_0050854_580_2052 | 393 |
| 160 | 3300048915 | Ga0496112_0014295 | Ga0496112_0014295_2755_3954 | 393 |
| 161 | 3300049569 | Ga0501032_0001102 | Ga0501032_0001102_1277_2521 | 393 |
| 162 | 3300049571 | Ga0501034_0002168 | Ga0501034_0002168_5580_6824 | 393 |
| 163 | 3300049572 | Ga0501036_0000496 | Ga0501036_0000496_15418_16662 | 393 |
| 164 | 3300049573 | Ga0501037_0002012 | Ga0501037_0002012_7184_8428 | 393 |
| 165 | 3300049574 | Ga0501038_0000200 | Ga0501038_0000200_34486_35730 | 393 |
| 166 | 3300049575 | Ga0501039_0004060 | Ga0501039_0004060_5999_7243 | 393 |
| 167 | 3300049579 | Ga0501043_0009252 | Ga0501043_0009252_918_2162 | 393 |
| 168 | 3300049580 | Ga0501046_0002677 | Ga0501046_0002677_9535_10779 | 393 |
| 169 | 3300049581 | Ga0501047_0027395 | Ga0501047_0027395_772_2016 | 393 |
| 170 | 3300049582 | Ga0501048_0086925 | Ga0501048_0086925_597_1841 | 393 |
| 171 | 3300049583 | Ga0501067_0008306 | Ga0501067_0008306_1046_2290 | 393 |
| 172 | 3300049584 | Ga0501068_0004234 | Ga0501068_0004234_562_1806 | 393 |
| 173 | 3300049585 | Ga0501069_0000110 | Ga0501069_0000110_17547_18791 | 393 |
| 174 | 3300049586 | Ga0501070_0003712 | Ga0501070_0003712_11177_12421 | 393 |
| 175 | 3300049588 | Ga0501072_0000964 | Ga0501072_0000964_14723_15967 | 393 |
| 176 | 3300049589 | Ga0501073_0008465 | Ga0501073_0008465_2783_4027 | 393 |
| 177 | 3300049590 | Ga0501074_0048136 | Ga0501074_0048136_918_2162 | 393 |
| 178 | 3300049741 | Ga0501079_0003644 | Ga0501079_0003644_9803_11047 | 393 |
| 179 | 3300049742 | Ga0501080_0000050 | Ga0501080_0000050_42849_44093 | 393 |
| 180 | 3300049744 | Ga0501083_0008074 | Ga0501083_0008074_5429_6673 | 393 |
| 181 | 3300049822 | Ga0501035_0007121 | Ga0501035_0007121_5489_6733 | 393 |
| 182 | 3300049823 | Ga0501044_0010199 | Ga0501044_0010199_3474_4718 | 393 |
| 183 | 3300054114 | Ga0501084_0000631 | Ga0501084_0000631_3785_5029 | 393 |
| 184 | 3300060353 | Ga0501082_0002799 | Ga0501082_0002799_1828_3072 | 393 |
| 185 | 3300005329 | Ga0070683_100053867 | Ga0070683_1000538672 | 394 |
| 186 | 3300005336 | Ga0070680_100071092 | Ga0070680_1000710922 | 394 |
| 187 | 3300005355 | Ga0070671_100045141 | Ga0070671_1000451412 | 394 |
| 188 | 3300005366 | Ga0070659_100288665 | Ga0070659_1002886651 | 394 |
| 189 | 3300005458 | Ga0070681_10000247 | Ga0070681_1000024710 | 394 |
| 190 | 3300005530 | Ga0070679_100045831 | Ga0070679_1000458312 | 394 |
| 191 | 3300005563 | Ga0068855_100000561 | Ga0068855_10000056112 | 394 |
| 192 | 3300005563 | Ga0068855_100005867 | Ga0068855_10000586710 | 394 |
| 193 | 3300005577 | Ga0068857_100065600 | Ga0068857_1000656002 | 394 |
| 194 | 3300005578 | Ga0068854_100109776 | Ga0068854_1001097761 | 394 |
| 195 | 3300005614 | Ga0068856_100000798 | Ga0068856_10000079824 | 394 |
| 196 | 3300005614 | Ga0068856_100002997 | Ga0068856_10000299710 | 394 |
| 197 | 3300005614 | Ga0068856_100025696 | Ga0068856_1000256963 | 394 |
| 198 | 3300005616 | Ga0068852_100017292 | Ga0068852_1000172924 | 394 |
| 199 | 3300005618 | Ga0068864_100004173 | Ga0068864_1000041736 | 394 |
| 200 | 3300005841 | Ga0068863_100041270 | Ga0068863_1000412702 | 394 |
| 201 | 3300006237 | Ga0097621_100001063 | Ga0097621_10000106310 | 394 |
| 202 | 3300006237 | Ga0097621_100024064 | Ga0097621_1000240643 | 394 |
| 203 | 3300006358 | Ga0068871_100002040 | Ga0068871_1000020403 | 394 |
| 204 | 3300009093 | Ga0105240_10018293 | Ga0105240_100182934 | 394 |
| 205 | 3300009093 | Ga0105240_10092688 | Ga0105240_100926882 | 394 |
| 206 | 3300009177 | Ga0105248_10026496 | Ga0105248_100264963 | 394 |
| 207 | 3300009551 | Ga0105238_10000417 | Ga0105238_1000041734 | 394 |
| 208 | 3300009551 | Ga0105238_10178567 | Ga0105238_101785672 | 394 |
| 209 | 3300010375 | Ga0105239_10082417 | Ga0105239_100824172 | 394 |
| 210 | 3300013104 | Ga0157370_10179031 | Ga0157370_101790312 | 394 |
| 211 | 3300013105 | Ga0157369_10000258 | Ga0157369_1000025814 | 394 |
| 212 | 3300013105 | Ga0157369_10092093 | Ga0157369_100920933 | 394 |
| 213 | 3300013296 | Ga0157374_10000407 | Ga0157374_1000040724 | 394 |
| 214 | 3300013296 | Ga0157374_10009662 | Ga0157374_100096624 | 394 |
| 215 | 3300013297 | Ga0157378_10001370 | Ga0157378_1000137013 | 394 |
| 216 | 3300013307 | Ga0157372_10000335 | Ga0157372_1000033529 | 394 |
| 217 | 3300013307 | Ga0157372_10001450 | Ga0157372_1000145014 | 394 |
| 218 | 3300013307 | Ga0157372_10108472 | Ga0157372_101084725 | 394 |
| 219 | 3300025912 | Ga0207707_10001477 | Ga0207707_1000147715 | 394 |
| 220 | 3300025913 | Ga0207695_10049699 | Ga0207695_100496992 | 394 |
| 221 | 3300025913 | Ga0207695_10070796 | Ga0207695_100707964 | 394 |
| 222 | 3300025917 | Ga0207660_10157289 | Ga0207660_101572891 | 394 |
| 223 | 3300025924 | Ga0207694_10000284 | Ga0207694_1000028427 | 394 |
| 224 | 3300025924 | Ga0207694_10097788 | Ga0207694_100977882 | 394 |
| 225 | 3300025931 | Ga0207644_10075538 | Ga0207644_100755382 | 394 |
| 226 | 3300025941 | Ga0207711_10016094 | Ga0207711_100160942 | 394 |
| 227 | 3300025944 | Ga0207661_10031707 | Ga0207661_100317072 | 394 |
| 228 | 3300025949 | Ga0207667_10000487 | Ga0207667_1000048729 | 394 |
| 229 | 3300025949 | Ga0207667_10002750 | Ga0207667_1000275010 | 394 |
| 230 | 3300025981 | Ga0207640_10019050 | Ga0207640_100190502 | 394 |
| 231 | 3300025981 | Ga0207640_10047927 | Ga0207640_100479271 | 394 |
| 232 | 3300026023 | Ga0207677_10010307 | Ga0207677_100103073 | 394 |
| 233 | 3300026041 | Ga0207639_10033244 | Ga0207639_100332443 | 394 |
| 234 | 3300026078 | Ga0207702_10000482 | Ga0207702_1000048211 | 394 |
| 235 | 3300026078 | Ga0207702_10001896 | Ga0207702_1000189611 | 394 |
| 236 | 3300026078 | Ga0207702_10111443 | Ga0207702_101114433 | 394 |
| 237 | 3300026088 | Ga0207641_10005200 | Ga0207641_100052009 | 394 |
| 238 | 3300026095 | Ga0207676_10007635 | Ga0207676_100076351 | 394 |
| 239 | 3300026116 | Ga0207674_10081430 | Ga0207674_100814304 | 394 |
| 240 | 3300026142 | Ga0207698_10019440 | Ga0207698_100194403 | 394 |
| 241 | 3300035691 | Ga0373931_0054119 | Ga0373931_0054119_424_1635 | 394 |
| 242 | 3300036401 | Ga0373937_0035458 | Ga0373937_0035458_833_2089 | 394 |
| 243 | 3300045051 | Ga0451576_0190149 | Ga0451576_0190149_95_1306 | 394 |
| 244 | 3300045051 | Ga0451576_0380643 | Ga0451576_0380643_246_1457 | 394 |
| 245 | 3300046472 | Ga0495580_0142469 | Ga0495580_0142469_372_1628 | 394 |
| 246 | 3300048907 | Ga0496104_0191438 | Ga0496104_0191438_687_1898 | 394 |
| 247 | 3300048915 | Ga0496112_0015754 | Ga0496112_0015754_4623_5837 | 394 |
| 248 | 3300048915 | Ga0496112_0032726 | Ga0496112_0032726_1884_3095 | 394 |
| 249 | 3300005458 | Ga0070681_10007965 | Ga0070681_1000796510 | 395 |
| 250 | 3300005563 | Ga0068855_100031913 | Ga0068855_1000319132 | 395 |
| 251 | 3300009093 | Ga0105240_10115600 | Ga0105240_101156003 | 395 |
| 252 | 3300013307 | Ga0157372_10014010 | Ga0157372_100140108 | 395 |
| 253 | 3300031242 | Ga0265329_10038615 | Ga0265329_100386151 | 395 |
| 254 | 3300039450 | Ga0436363_0138860 | Ga0436363_0138860_343_1575 | 395 |
| 255 | 3300049744 | Ga0501083_0177789 | Ga0501083_0177789_143_1348 | 395 |
| 256 | 3300053077 | Ga0495601_0147761 | Ga0495601_0147761_140_1387 | 395 |
| 257 | 3300005435 | Ga0070714_100188103 | Ga0070714_1001881032 | 396 |
| 258 | 3300005445 | Ga0070708_100008541 | Ga0070708_1000085416 | 396 |
| 259 | 3300005445 | Ga0070708_100045807 | Ga0070708_1000458074 | 396 |
| 260 | 3300005467 | Ga0070706_100000430 | Ga0070706_10000043033 | 396 |
| 261 | 3300005536 | Ga0070697_100000415 | Ga0070697_1000004156 | 396 |
| 262 | 3300009093 | Ga0105240_10218435 | Ga0105240_102184353 | 396 |
| 263 | 3300025913 | Ga0207695_10031164 | Ga0207695_100311642 | 396 |
| 264 | 3300035116 | Ga0373945_0049748 | Ga0373945_0049748_109_1353 | 396 |
| 265 | 3300047319 | Ga0495674_0113918 | Ga0495674_0113918_1029_2273 | 396 |
| 266 | 3300021388 | Ga0213875_10000002 | Ga0213875_10000002525 | 397 |
| 267 | 3300031852 | Ga0307410_10095453 | Ga0307410_100954531 | 397 |
| 268 | 3300031995 | Ga0307409_100043862 | Ga0307409_1000438623 | 397 |
| 269 | 3300032126 | Ga0307415_100132889 | Ga0307415_1001328891 | 397 |
| 270 | 3300037853 | Ga0436364_0940248 | Ga0436364_0940248_290798_292024 | 397 |
| 271 | 3300005327 | Ga0070658_10004049 | Ga0070658_100040498 | 398 |
| 272 | 3300025909 | Ga0207705_10002448 | Ga0207705_100024486 | 398 |
| 273 | 3300031824 | Ga0307413_10053270 | Ga0307413_100532704 | 398 |
| 274 | 3300006163 | Ga0070715_10000381 | Ga0070715_100003817 | 399 |
| 275 | 3300006173 | Ga0070716_100001342 | Ga0070716_1000013429 | 399 |
| 276 | 3300006175 | Ga0070712_100006237 | Ga0070712_1000062375 | 399 |
| 277 | 3300025905 | Ga0207685_10003391 | Ga0207685_100033914 | 399 |
| 278 | 3300025906 | Ga0207699_10030546 | Ga0207699_100305463 | 399 |
| 279 | 3300025915 | Ga0207693_10020971 | Ga0207693_100209716 | 399 |
| 280 | 3300025939 | Ga0207665_10000091 | Ga0207665_1000009130 | 399 |
| 281 | 3300005536 | Ga0070697_100011527 | Ga0070697_1000115278 | 400 |
| 282 | 3300006871 | Ga0075434_100010936 | Ga0075434_1000109367 | 400 |
| 283 | 3300025929 | Ga0207664_10187580 | Ga0207664_101875802 | 400 |
| 284 | 3300031903 | Ga0307407_10028476 | Ga0307407_100284763 | 400 |
| 285 | 3300032005 | Ga0307411_10009820 | Ga0307411_100098202 | 400 |
| 286 | 3300046472 | Ga0495580_0005046 | Ga0495580_0005046_5214_6446 | 400 |
| 287 | 3300046664 | Ga0495659_0007473 | Ga0495659_0007473_1796_3034 | 400 |
| 288 | 3300050512 | nmdc:mga0n895_12898_c1 | nmdc:mga0n895_12898_c1_1604_2854 | 400 |
| 289 | 3300050515 | nmdc:mga0a205_50963_c1 | nmdc:mga0a205_50963_c1_173_1423 | 400 |
| 290 | 3300005445 | Ga0070708_100003186 | Ga0070708_1000031865 | 401 |
| 291 | 3300005445 | Ga0070708_100043542 | Ga0070708_1000435422 | 401 |
| 292 | 3300005467 | Ga0070706_100053272 | Ga0070706_1000532723 | 401 |
| 293 | 3300005468 | Ga0070707_100029389 | Ga0070707_1000293891 | 401 |
| 294 | 3300005471 | Ga0070698_100000012 | Ga0070698_10000001249 | 401 |
| 295 | 3300005518 | Ga0070699_100006190 | Ga0070699_10000619012 | 401 |
| 296 | 3300005536 | Ga0070697_100000873 | Ga0070697_1000008735 | 401 |
| 297 | 3300005536 | Ga0070697_100012935 | Ga0070697_1000129354 | 401 |
| 298 | 3300005536 | Ga0070697_100056940 | Ga0070697_1000569403 | 401 |
| 299 | 3300006237 | Ga0097621_100032652 | Ga0097621_1000326522 | 401 |
| 300 | 3300007076 | Ga0075435_100098137 | Ga0075435_1000981373 | 401 |
| 301 | 3300009551 | Ga0105238_10030478 | Ga0105238_100304784 | 401 |
| 302 | 3300013296 | Ga0157374_10024622 | Ga0157374_100246223 | 401 |
| 303 | 3300013296 | Ga0157374_10032440 | Ga0157374_100324403 | 401 |
| 304 | 3300013297 | Ga0157378_10028193 | Ga0157378_100281934 | 401 |
| 305 | 3300013306 | Ga0163162_10002318 | Ga0163162_1000231817 | 401 |
| 306 | 3300014325 | Ga0163163_10065407 | Ga0163163_100654074 | 401 |
| 307 | 3300014325 | Ga0163163_10099496 | Ga0163163_100994961 | 401 |
| 308 | 3300014968 | Ga0157379_10052468 | Ga0157379_100524682 | 401 |
| 309 | 3300014969 | Ga0157376_10033462 | Ga0157376_100334624 | 401 |
| 310 | 3300025910 | Ga0207684_10002258 | Ga0207684_1000225812 | 401 |
| 311 | 3300025922 | Ga0207646_10000287 | Ga0207646_1000028710 | 401 |
| 312 | 3300025924 | Ga0207694_10057692 | Ga0207694_100576923 | 401 |
| 313 | 3300026088 | Ga0207641_10043335 | Ga0207641_100433352 | 401 |
| 314 | 3300035724 | Ga0373933_0023429 | Ga0373933_0023429_1559_2791 | 401 |
| 315 | 3300036401 | Ga0373937_0129731 | Ga0373937_0129731_389_1621 | 401 |
| 316 | 3300046664 | Ga0495659_0022474 | Ga0495659_0022474_732_2006 | 401 |
| 317 | 3300048903 | Ga0496100_0009636 | Ga0496100_0009636_1461_2693 | 401 |
| 318 | 3300048904 | Ga0496101_0017171 | Ga0496101_0017171_313_1545 | 401 |
| 319 | 3300048907 | Ga0496104_0055137 | Ga0496104_0055137_308_1540 | 401 |
| 320 | 3300048908 | Ga0496105_0075874 | Ga0496105_0075874_619_1851 | 401 |
| 321 | 3300048917 | Ga0496114_0048998 | Ga0496114_0048998_862_2094 | 401 |
| 322 | 3300048918 | Ga0496115_0009016 | Ga0496115_0009016_2478_3710 | 401 |
| 323 | 3300050513 | nmdc:mga0rr50_85136_c1 | nmdc:mga0rr50_85136_c1_640_1938 | 401 |
| 324 | 3300005530 | Ga0070679_100101849 | Ga0070679_1001018492 | 402 |
| 325 | 3300005546 | Ga0070696_100019055 | Ga0070696_1000190552 | 402 |
| 326 | 3300006871 | Ga0075434_100026500 | Ga0075434_1000265004 | 402 |
| 327 | 3300009174 | Ga0105241_10004936 | Ga0105241_100049368 | 402 |
| 328 | 3300013100 | Ga0157373_10047333 | Ga0157373_100473334 | 402 |
| 329 | 3300025911 | Ga0207654_10016907 | Ga0207654_100169074 | 402 |
| 330 | 3300025917 | Ga0207660_10026216 | Ga0207660_100262165 | 402 |
| 331 | 3300025921 | Ga0207652_10020896 | Ga0207652_100208964 | 402 |
| 332 | 3300025949 | Ga0207667_10284268 | Ga0207667_102842681 | 402 |
| 333 | 3300048906 | Ga0496103_0015564 | Ga0496103_0015564_755_2062 | 402 |
| 334 | 3300007076 | Ga0075435_100009445 | Ga0075435_1000094458 | 403 |
| 335 | 3300009093 | Ga0105240_10193802 | Ga0105240_101938022 | 403 |
| 336 | 3300047472 | Ga0495686_0000009 | Ga0495686_0000009_326043_327311 | 403 |
| 337 | 3300047472 | Ga0495686_0001445 | Ga0495686_0001445_1246_2487 | 403 |
| 338 | 3300048907 | Ga0496104_0000266 | Ga0496104_0000266_34576_35820 | 403 |
| 339 | 3300048907 | Ga0496104_0177702 | Ga0496104_0177702_58_1287 | 403 |
| 340 | 3300050512 | nmdc:mga0n895_13940_c1 | nmdc:mga0n895_13940_c1_5905_7218 | 403 |
| 341 | 3300050513 | nmdc:mga0rr50_54700_c1 | nmdc:mga0rr50_54700_c1_1481_2794 | 403 |
| 342 | 3300005327 | Ga0070658_10000109 | Ga0070658_1000010918 | 404 |
| 343 | 3300005435 | Ga0070714_100184792 | Ga0070714_1001847922 | 404 |
| 344 | 3300005530 | Ga0070679_100059043 | Ga0070679_1000590434 | 404 |
| 345 | 3300005563 | Ga0068855_100004123 | Ga0068855_10000412312 | 404 |
| 346 | 3300005563 | Ga0068855_100008084 | Ga0068855_10000808410 | 404 |
| 347 | 3300005577 | Ga0068857_100035983 | Ga0068857_1000359834 | 404 |
| 348 | 3300005616 | Ga0068852_100046504 | Ga0068852_1000465042 | 404 |
| 349 | 3300009093 | Ga0105240_10046086 | Ga0105240_100460864 | 404 |
| 350 | 3300013104 | Ga0157370_10063627 | Ga0157370_100636273 | 404 |
| 351 | 3300013104 | Ga0157370_10069028 | Ga0157370_100690283 | 404 |
| 352 | 3300013105 | Ga0157369_10001044 | Ga0157369_1000104424 | 404 |
| 353 | 3300013307 | Ga0157372_10011585 | Ga0157372_100115857 | 404 |
| 354 | 3300021361 | Ga0213872_10010433 | Ga0213872_100104333 | 404 |
| 355 | 3300021361 | Ga0213872_10036584 | Ga0213872_100365842 | 404 |
| 356 | 3300025909 | Ga0207705_10000021 | Ga0207705_1000002170 | 404 |
| 357 | 3300025909 | Ga0207705_10000562 | Ga0207705_1000056220 | 404 |
| 358 | 3300025913 | Ga0207695_10046541 | Ga0207695_100465414 | 404 |
| 359 | 3300025919 | Ga0207657_10018958 | Ga0207657_100189584 | 404 |
| 360 | 3300025921 | Ga0207652_10011267 | Ga0207652_100112673 | 404 |
| 361 | 3300025929 | Ga0207664_10170680 | Ga0207664_101706801 | 404 |
| 362 | 3300025949 | Ga0207667_10007344 | Ga0207667_1000734412 | 404 |
| 363 | 3300025949 | Ga0207667_10025509 | Ga0207667_100255092 | 404 |
| 364 | 3300025949 | Ga0207667_10027823 | Ga0207667_100278233 | 404 |
| 365 | 3300026067 | Ga0207678_10000876 | Ga0207678_100008768 | 404 |
| 366 | 3300026116 | Ga0207674_10005786 | Ga0207674_1000578612 | 404 |
| 367 | 3300026142 | Ga0207698_10034266 | Ga0207698_100342662 | 404 |
| 368 | 3300036401 | Ga0373937_0038468 | Ga0373937_0038468_2471_3760 | 404 |
| 369 | 3300039438 | Ga0436360_1028171 | Ga0436360_1028171_3529_4788 | 404 |
| 370 | 3300046516 | Ga0495628_0077809 | Ga0495628_0077809_1229_2518 | 404 |
| 371 | 3300046529 | Ga0495652_0011685 | Ga0495652_0011685_2379_3668 | 404 |
| 372 | 3300046543 | Ga0495645_0001383 | Ga0495645_0001383_3426_4715 | 404 |
| 373 | 3300046809 | Ga0495600_0010958 | Ga0495600_0010958_2032_3321 | 404 |
| 374 | 3300047317 | Ga0495604_0013626 | Ga0495604_0013626_2273_3535 | 404 |
| 375 | 3300048088 | Ga0495602_0083079 | Ga0495602_0083079_286_1548 | 404 |
| 376 | iso_pu_bacteria | 2884215851 | 2884218234 | 404 |
| 377 | 3300005329 | Ga0070683_100295083 | Ga0070683_1002950831 | 405 |
| 378 | 3300005445 | Ga0070708_100016509 | Ga0070708_1000165093 | 405 |
| 379 | 3300005518 | Ga0070699_100006417 | Ga0070699_1000064178 | 405 |
| 380 | 3300005548 | Ga0070665_100041486 | Ga0070665_1000414864 | 405 |
| 381 | 3300005563 | Ga0068855_100018901 | Ga0068855_1000189013 | 405 |
| 382 | 3300005563 | Ga0068855_100143577 | Ga0068855_1001435772 | 405 |
| 383 | 3300005614 | Ga0068856_100055209 | Ga0068856_1000552092 | 405 |
| 384 | 3300009177 | Ga0105248_10248722 | Ga0105248_102487222 | 405 |
| 385 | 3300013104 | Ga0157370_10020199 | Ga0157370_100201993 | 405 |
| 386 | 3300013105 | Ga0157369_10018701 | Ga0157369_100187013 | 405 |
| 387 | 3300013296 | Ga0157374_10113808 | Ga0157374_101138082 | 405 |
| 388 | 3300013307 | Ga0157372_10001157 | Ga0157372_100011573 | 405 |
| 389 | 3300013307 | Ga0157372_10047240 | Ga0157372_100472403 | 405 |
| 390 | 3300014325 | Ga0163163_10001182 | Ga0163163_1000118210 | 405 |
| 391 | 3300025928 | Ga0207700_10024137 | Ga0207700_100241373 | 405 |
| 392 | 3300025949 | Ga0207667_10032646 | Ga0207667_100326463 | 405 |
| 393 | 3300026078 | Ga0207702_10153852 | Ga0207702_101538522 | 405 |
| 394 | 3300028379 | Ga0268266_10001414 | Ga0268266_1000141414 | 405 |
| 395 | 3300028379 | Ga0268266_10056533 | Ga0268266_100565332 | 405 |
| 396 | 3300045976 | Ga0466967_0306159 | Ga0466967_0306159_41_1303 | 405 |
| 397 | 3300046462 | Ga0495651_0040560 | Ga0495651_0040560_272_1519 | 405 |
| 398 | 3300046471 | Ga0495650_0017972 | Ga0495650_0017972_1480_2727 | 405 |
| 399 | 3300046472 | Ga0495580_0027406 | Ga0495580_0027406_2559_3812 | 405 |
| 400 | 3300046473 | Ga0495582_0011050 | Ga0495582_0011050_1940_3187 | 405 |
| 401 | 3300046475 | Ga0495639_0027112 | Ga0495639_0027112_312_1559 | 405 |
| 402 | 3300046477 | Ga0495664_0002715 | Ga0495664_0002715_4677_5924 | 405 |
| 403 | 3300046499 | Ga0495594_0000099 | Ga0495594_0000099_31162_32409 | 405 |
| 404 | 3300046533 | Ga0495640_0013434 | Ga0495640_0013434_2025_3272 | 405 |
| 405 | 3300046660 | Ga0495625_0000046 | Ga0495625_0000046_88472_89719 | 405 |
| 406 | 3300046680 | Ga0495646_0003839 | Ga0495646_0003839_3001_4248 | 405 |
| 407 | 3300046689 | Ga0495613_0011519 | Ga0495613_0011519_2426_3673 | 405 |
| 408 | 3300046809 | Ga0495600_0003241 | Ga0495600_0003241_4693_5940 | 405 |
| 409 | 3300047315 | Ga0495581_0006774 | Ga0495581_0006774_3050_4297 | 405 |
| 410 | 3300047319 | Ga0495674_0011091 | Ga0495674_0011091_3654_4901 | 405 |
| 411 | 3300047320 | Ga0495672_0000255 | Ga0495672_0000255_8484_9731 | 405 |
| 412 | 3300047321 | Ga0495676_0006631 | Ga0495676_0006631_3020_4267 | 405 |
| 413 | 3300047444 | Ga0495675_0128735 | Ga0495675_0128735_253_1500 | 405 |
| 414 | 3300048088 | Ga0495602_0028489 | Ga0495602_0028489_54_1301 | 405 |
| 415 | 3300048089 | Ga0495614_0006639 | Ga0495614_0006639_2025_3272 | 405 |
| 416 | 3300048915 | Ga0496112_0033744 | Ga0496112_0033744_122_1360 | 405 |
| 417 | 3300005530 | Ga0070679_100073657 | Ga0070679_1000736571 | 406 |
| 418 | 3300014325 | Ga0163163_10013929 | Ga0163163_100139298 | 406 |
| 419 | 3300025929 | Ga0207664_10109282 | Ga0207664_101092821 | 406 |
| 420 | 3300026095 | Ga0207676_10131282 | Ga0207676_101312822 | 406 |
| 421 | 3300026116 | Ga0207674_10055709 | Ga0207674_100557092 | 406 |
| 422 | 3300026116 | Ga0207674_10381125 | Ga0207674_103811251 | 406 |
| 423 | 3300037471 | Ga0395905_0077664 | Ga0395905_0077664_806_2044 | 406 |
| 424 | 3300045051 | Ga0451576_0138573 | Ga0451576_0138573_76_1317 | 406 |
| 425 | 3300045976 | Ga0466967_0224665 | Ga0466967_0224665_393_1703 | 406 |
| 426 | 3300046472 | Ga0495580_0018534 | Ga0495580_0018534_972_2276 | 406 |
| 427 | 3300006914 | Ga0075436_100013864 | Ga0075436_1000138644 | 407 |
| 428 | 3300039450 | Ga0436363_1474552 | Ga0436363_1474552_211_1449 | 407 |
| 429 | 3300045976 | Ga0466967_0022319 | Ga0466967_0022319_3718_5031 | 407 |
| 430 | 3300049569 | Ga0501032_0010351 | Ga0501032_0010351_1896_3143 | 407 |
| 431 | 3300049570 | Ga0501033_0007098 | Ga0501033_0007098_2472_3719 | 407 |
| 432 | 3300049571 | Ga0501034_0000711 | Ga0501034_0000711_39244_40491 | 407 |
| 433 | 3300049572 | Ga0501036_0006025 | Ga0501036_0006025_2841_4088 | 407 |
| 434 | 3300049573 | Ga0501037_0016261 | Ga0501037_0016261_3738_4985 | 407 |
| 435 | 3300049574 | Ga0501038_0000751 | Ga0501038_0000751_10868_12115 | 407 |
| 436 | 3300049579 | Ga0501043_0041731 | Ga0501043_0041731_1060_2307 | 407 |
| 437 | 3300049580 | Ga0501046_0000062 | Ga0501046_0000062_39984_41231 | 407 |
| 438 | 3300049581 | Ga0501047_0020569 | Ga0501047_0020569_251_1498 | 407 |
| 439 | 3300049589 | Ga0501073_0035377 | Ga0501073_0035377_1881_3128 | 407 |
| 440 | 3300049590 | Ga0501074_0020479 | Ga0501074_0020479_1252_2499 | 407 |
| 441 | 3300049742 | Ga0501080_0043399 | Ga0501080_0043399_2029_3276 | 407 |
| 442 | 3300049822 | Ga0501035_0019355 | Ga0501035_0019355_2472_3719 | 407 |
| 443 | 3300049823 | Ga0501044_0016734 | Ga0501044_0016734_2472_3719 | 407 |
| 444 | 3300050514 | nmdc:mga08x19_16187_c1 | nmdc:mga08x19_16187_c1_1827_3221 | 407 |
| 445 | 3300005436 | Ga0070713_100007212 | Ga0070713_1000072123 | 408 |
| 446 | 3300009098 | Ga0105245_10272377 | Ga0105245_102723771 | 408 |
| 447 | 3300013306 | Ga0163162_10384565 | Ga0163162_103845651 | 408 |
| 448 | 3300013307 | Ga0157372_10039762 | Ga0157372_100397623 | 408 |
| 449 | 3300025928 | Ga0207700_10013399 | Ga0207700_100133993 | 408 |
| 450 | 3300033180 | Ga0307510_10017778 | Ga0307510_100177785 | 408 |
| 451 | 3300044673 | Ga0453683_0009579 | Ga0453683_0009579_1388_2698 | 408 |
| 452 | 3300046507 | Ga0495606_0140115 | Ga0495606_0140115_75_1334 | 408 |
| 453 | 3300046543 | Ga0495645_0020216 | Ga0495645_0020216_2571_3833 | 408 |
| 454 | 3300048917 | Ga0496114_0225906 | Ga0496114_0225906_181_1458 | 408 |
| 455 | 3300048929 | Ga0496126_0000014 | Ga0496126_0000014_276068_277318 | 408 |
| 456 | 3300005434 | Ga0070709_10078406 | Ga0070709_100784062 | 409 |
| 457 | 3300005536 | Ga0070697_100023806 | Ga0070697_1000238064 | 409 |
| 458 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000011275 | 409 |
| 459 | 3300026067 | Ga0207678_10072488 | Ga0207678_100724882 | 409 |
| 460 | 3300026095 | Ga0207676_10219290 | Ga0207676_102192902 | 409 |
| 461 | 3300033180 | Ga0307510_10036206 | Ga0307510_100362065 | 409 |
| 462 | 3300045976 | Ga0466967_0079929 | Ga0466967_0079929_55_1365 | 409 |
| 463 | 3300046455 | Ga0495603_0059566 | Ga0495603_0059566_49_1320 | 409 |
| 464 | 3300046459 | Ga0495629_0101363 | Ga0495629_0101363_283_1554 | 409 |
| 465 | 3300046472 | Ga0495580_0061059 | Ga0495580_0061059_975_2246 | 409 |
| 466 | 3300046492 | Ga0495585_0007731 | Ga0495585_0007731_492_1763 | 409 |
| 467 | 3300046499 | Ga0495594_0004517 | Ga0495594_0004517_5831_7102 | 409 |
| 468 | 3300046500 | Ga0495596_0008429 | Ga0495596_0008429_3177_4448 | 409 |
| 469 | 3300046507 | Ga0495606_0107694 | Ga0495606_0107694_387_1649 | 409 |
| 470 | 3300046523 | Ga0495644_0000416 | Ga0495644_0000416_4786_6057 | 409 |
| 471 | 3300046528 | Ga0495642_0001218 | Ga0495642_0001218_5640_6911 | 409 |
| 472 | 3300046538 | Ga0495609_0005301 | Ga0495609_0005301_3173_4444 | 409 |
| 473 | 3300046538 | Ga0495609_0017183 | Ga0495609_0017183_602_1873 | 409 |
| 474 | 3300046558 | Ga0495633_0008466 | Ga0495633_0008466_1211_2482 | 409 |
| 475 | 3300046616 | Ga0495668_0006171 | Ga0495668_0006171_928_2199 | 409 |
| 476 | 3300046683 | Ga0495658_0063133 | Ga0495658_0063133_264_1535 | 409 |
| 477 | 3300046684 | Ga0495669_0012415 | Ga0495669_0012415_808_2079 | 409 |
| 478 | 3300046689 | Ga0495613_0032039 | Ga0495613_0032039_1619_2890 | 409 |
| 479 | 3300047319 | Ga0495674_0024128 | Ga0495674_0024128_1155_2426 | 409 |
| 480 | 3300048929 | Ga0496126_0001561 | Ga0496126_0001561_7861_9132 | 409 |
| 481 | 3300049460 | Ga0495682_0016710 | Ga0495682_0016710_1456_2736 | 409 |
| 482 | 3300053093 | Ga0500651_0000012 | Ga0500651_0000012_71700_72986 | 409 |
| 483 | 3300053119 | Ga0500595_000027 | Ga0500595_000027_50624_51895 | 409 |
| 484 | 3300055283 | Ga0500661_002018 | Ga0500661_002018_2154_3434 | 409 |
| 485 | 3300005436 | Ga0070713_100103920 | Ga0070713_1001039203 | 410 |
| 486 | 3300025928 | Ga0207700_10076619 | Ga0207700_100766193 | 410 |
| 487 | 3300046506 | Ga0495583_0035647 | Ga0495583_0035647_540_1877 | 410 |
| 488 | 3300005439 | Ga0070711_100010931 | Ga0070711_1000109315 | 411 |
| 489 | 3300006914 | Ga0075436_100059352 | Ga0075436_1000593522 | 411 |
| 490 | 3300025915 | Ga0207693_10005596 | Ga0207693_100055964 | 411 |
| 491 | 3300031241 | Ga0265325_10002176 | Ga0265325_100021763 | 411 |
| 492 | 3300031247 | Ga0265340_10059230 | Ga0265340_100592302 | 411 |
| 493 | 3300031249 | Ga0265339_10067213 | Ga0265339_100672131 | 411 |
| 494 | 3300031251 | Ga0265327_10028851 | Ga0265327_100288513 | 411 |
| 495 | 3300039438 | Ga0436360_0493045 | Ga0436360_0493045_671_1930 | 411 |
| 496 | 3300050514 | nmdc:mga08x19_8802_c1 | nmdc:mga08x19_8802_c1_2589_3953 | 411 |
| 497 | 3300037853 | Ga0436364_0815945 | Ga0436364_0815945_1788_3065 | 412 |
| 498 | 3300005293 | Ga0065715_10101096 | Ga0065715_101010963 | 422 |
| 499 | 3300005328 | Ga0070676_10025598 | Ga0070676_100255983 | 422 |
| 500 | 3300005329 | Ga0070683_100063454 | Ga0070683_1000634542 | 422 |
| 501 | 3300005331 | Ga0070670_100093759 | Ga0070670_1000937592 | 422 |
| 502 | 3300005334 | Ga0068869_100130893 | Ga0068869_1001308932 | 422 |
| 503 | 3300005335 | Ga0070666_10088166 | Ga0070666_100881662 | 422 |
| 504 | 3300005338 | Ga0068868_100004502 | Ga0068868_1000045024 | 422 |
| 505 | 3300005339 | Ga0070660_100005413 | Ga0070660_1000054131 | 422 |
| 506 | 3300005340 | Ga0070689_100013667 | Ga0070689_1000136672 | 422 |
| 507 | 3300005344 | Ga0070661_100003838 | Ga0070661_1000038384 | 422 |
| 508 | 3300005347 | Ga0070668_100032700 | Ga0070668_1000327003 | 422 |
| 509 | 3300005354 | Ga0070675_100019034 | Ga0070675_1000190344 | 422 |
| 510 | 3300005365 | Ga0070688_100055667 | Ga0070688_1000556673 | 422 |
| 511 | 3300005367 | Ga0070667_100184226 | Ga0070667_1001842261 | 422 |
| 512 | 3300005456 | Ga0070678_100039473 | Ga0070678_1000394733 | 422 |
| 513 | 3300005535 | Ga0070684_100004173 | Ga0070684_1000041735 | 422 |
| 514 | 3300005543 | Ga0070672_100227333 | Ga0070672_1002273331 | 422 |
| 515 | 3300005544 | Ga0070686_100002933 | Ga0070686_1000029333 | 422 |
| 516 | 3300005577 | Ga0068857_100002120 | Ga0068857_1000021209 | 422 |
| 517 | 3300005615 | Ga0070702_100003077 | Ga0070702_1000030771 | 422 |
| 518 | 3300005616 | Ga0068852_100104645 | Ga0068852_1001046452 | 422 |
| 519 | 3300005618 | Ga0068864_100029576 | Ga0068864_1000295764 | 422 |
| 520 | 3300005718 | Ga0068866_10016713 | Ga0068866_100167133 | 422 |
| 521 | 3300005840 | Ga0068870_10000328 | Ga0068870_100003288 | 422 |
| 522 | 3300005841 | Ga0068863_100096975 | Ga0068863_1000969753 | 422 |
| 523 | 3300005844 | Ga0068862_100099629 | Ga0068862_1000996292 | 422 |
| 524 | 3300006881 | Ga0068865_100020197 | Ga0068865_1000201971 | 422 |
| 525 | 3300009101 | Ga0105247_10004769 | Ga0105247_100047692 | 422 |
| 526 | 3300009174 | Ga0105241_10137885 | Ga0105241_101378852 | 422 |
| 527 | 3300009176 | Ga0105242_10034283 | Ga0105242_100342833 | 422 |
| 528 | 3300009553 | Ga0105249_10323770 | Ga0105249_103237701 | 422 |
| 529 | 3300010375 | Ga0105239_10009275 | Ga0105239_100092756 | 422 |
| 530 | 3300011119 | Ga0105246_10000514 | Ga0105246_100005148 | 422 |
| 531 | 3300013102 | Ga0157371_10093027 | Ga0157371_100930272 | 422 |
| 532 | 3300013105 | Ga0157369_10020633 | Ga0157369_100206332 | 422 |
| 533 | 3300013296 | Ga0157374_10007075 | Ga0157374_100070755 | 422 |
| 534 | 3300013306 | Ga0163162_10018581 | Ga0163162_100185817 | 422 |
| 535 | 3300014745 | Ga0157377_10001169 | Ga0157377_100011696 | 422 |
| 536 | 3300025315 | Ga0207697_10002002 | Ga0207697_100020024 | 422 |
| 537 | 3300025893 | Ga0207682_10030414 | Ga0207682_100304142 | 422 |
| 538 | 3300025899 | Ga0207642_10057337 | Ga0207642_100573372 | 422 |
| 539 | 3300025901 | Ga0207688_10002641 | Ga0207688_100026412 | 422 |
| 540 | 3300025903 | Ga0207680_10003203 | Ga0207680_100032033 | 422 |
| 541 | 3300025904 | Ga0207647_10042767 | Ga0207647_100427673 | 422 |
| 542 | 3300025908 | Ga0207643_10004729 | Ga0207643_100047293 | 422 |
| 543 | 3300025918 | Ga0207662_10015656 | Ga0207662_100156562 | 422 |
| 544 | 3300025919 | Ga0207657_10008967 | Ga0207657_100089672 | 422 |
| 545 | 3300025920 | Ga0207649_10000250 | Ga0207649_1000025029 | 422 |
| 546 | 3300025925 | Ga0207650_10000124 | Ga0207650_1000012454 | 422 |
| 547 | 3300025932 | Ga0207690_10021654 | Ga0207690_100216541 | 422 |
| 548 | 3300025933 | Ga0207706_10007858 | Ga0207706_100078583 | 422 |
| 549 | 3300025942 | Ga0207689_10004365 | Ga0207689_100043653 | 422 |
| 550 | 3300025944 | Ga0207661_10001369 | Ga0207661_100013692 | 422 |
| 551 | 3300025945 | Ga0207679_10000651 | Ga0207679_1000065110 | 422 |
| 552 | 3300025960 | Ga0207651_10002544 | Ga0207651_100025444 | 422 |
| 553 | 3300025986 | Ga0207658_10023412 | Ga0207658_100234123 | 422 |
| 554 | 3300026067 | Ga0207678_10002295 | Ga0207678_100022956 | 422 |
| 555 | 3300026088 | Ga0207641_10000006 | Ga0207641_10000006191 | 422 |
| 556 | 3300026089 | Ga0207648_10006340 | Ga0207648_100063403 | 422 |
| 557 | 3300026095 | Ga0207676_10000272 | Ga0207676_100002728 | 422 |
| 558 | 3300026116 | Ga0207674_10001665 | Ga0207674_100016659 | 422 |
| 559 | 3300028380 | Ga0268265_10070671 | Ga0268265_100706712 | 422 |
| 560 | 3300028381 | Ga0268264_10115995 | Ga0268264_101159952 | 422 |
| 561 | 3300048911 | Ga0496108_0000200 | Ga0496108_0000200_18843_20111 | 422 |
| 562 | 3300048912 | Ga0496109_0002994 | Ga0496109_0002994_6511_7779 | 422 |
| 563 | 3300048913 | Ga0496110_0001074 | Ga0496110_0001074_11030_12298 | 422 |
| 564 | 3300048914 | Ga0496111_0009147 | Ga0496111_0009147_1213_2481 | 422 |
| 565 | 3300048915 | Ga0496112_0000070 | Ga0496112_0000070_1186_2454 | 422 |
| 566 | 3300048916 | Ga0496113_0000064 | Ga0496113_0000064_8092_9360 | 422 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bsi-assembly1.cif.gz_SK | giardia ribosome chimeric hybrid-like gdp+pi bound state (b1) | 0.9656 | 355 | 391 |
| 7oyc-assembly1.cif.gz_J2 | cryo-em structure of the xenopus egg 80s ribosome | 0.9624 | 355 | 391 |
| 6bqz-assembly1.cif.gz_A | crystal structure of tyrosine-trna synthetase from acinetobacter baumannii with bound l-tyrosine | 0.9537 | 1 | 222 |
| 6bqz-assembly2.cif.gz_B | crystal structure of tyrosine-trna synthetase from acinetobacter baumannii with bound l-tyrosine | 0.9524 | 3 | 222 |
| 7pwo-assembly1.cif.gz_J1 | cryo-em structure of giardia lamblia ribosome at 2.75 a resolution | 0.9485 | 355 | 391 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1h3fB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9567 | 7 | 223 | 3.40.50.620 |
| 1h3fB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9475 | 7 | 223 | 3.40.50.620 |
| af_Q54WD9_9_271_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9206 | 39 | 223 | 3.40.50.620 |
| af_P54020_104_182_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9164 | 355 | 396 | 3.10.290.10 |
| af_Q4DSJ7_105_180_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9071 | 355 | 396 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S0PG61-F1-model_v4 | Tyrosine--tRNA ligase (EC 6.1.1.1) (Tyrosyl-tRNA synthetase) | 0.9804 | 137 | 232 |
GO:0004831
GO:0005524 GO:0005829 GO:0006437 |
| AF-A0A7W0V2K0-F1-model_v4 | Tyrosine--tRNA ligase (EC 6.1.1.1) | 0.9785 | 4 | 298 |
GO:0004831
GO:0005524 GO:0005829 GO:0006437 |
| AF-A0A3D3SE74-F1-model_v4 | deleted | 0.978 | 179 | 317 |
|
| AF-X1JGY7-F1-model_v4 | tyrosine--tRNA ligase (EC 6.1.1.1) | 0.9778 | 143 | 242 |
GO:0004831
GO:0005524 GO:0005829 GO:0006437 |
| AF-A0A6I1INX2-F1-model_v4 | deleted | 0.9744 | 113 | 262 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar