F464380

General Info

Members Datasets Scaffolds Average Seq Length
566 296 1132 193

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10053386|Ga0105243_100533864
Length 213
Sequence LAQFVFGAERNEEEPMTKVLAGITTSVDGYVAGPDDRAGQGLGVGGERLHYWVFGGPWTYDHEPEGGANGEDAAWLEETMSRLGAVVSGRWTYEAADHWGGENPWGMPLFIVTHRPEEQPEGTGFTFVSGVEEAVARAKEAAGGKDVHIMGGADVIRQALEAGLVEELTIIVAPVVLGGGKRLFDGFSQSLELEHIGLRQSPNATFIDYRVKR

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
104 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
181 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
221 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
222 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 2643221714 Streptomyces sp. Root264 Isolate Unclassified
293 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
294 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
295 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
296 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 6.18
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 4.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10053386 3300009148 Bacteria 3206
2 JGI24751J29686_10013918 3300002459 Bacteria 1661
3 Ga0070658_10380347 3300005327 Bacteria 1211
4 Ga0070676_10049987 3300005328 Bacteria 2449
5 Ga0070676_10197390 3300005328 Bacteria 1317
6 Ga0070676_10563304 3300005328 Bacteria 817
7 Ga0070683_100059730 3300005329 Bacteria 3543
8 Ga0070683_100078609 3300005329 Bacteria 3086
9 Ga0070683_100252705 3300005329 Bacteria 1676
10 Ga0070683_100988663 3300005329 Unclassified 808
11 Ga0070690_100089805 3300005330 Bacteria 2022
12 Ga0070670_100173154 3300005331 Bacteria 1872
13 Ga0070670_100297551 3300005331 Bacteria 1411
14 Ga0070670_100567065 3300005331 Bacteria 1014
15 Ga0068869_100037850 3300005334 Bacteria 3432
16 Ga0070666_10089575 3300005335 Bacteria 2112
17 Ga0070680_100027397 3300005336 Bacteria 4562
18 Ga0070682_100027753 3300005337 Bacteria 3399
19 Ga0070682_100215051 3300005337 Bacteria 1364
20 Ga0068868_100075860 3300005338 Bacteria 2687
21 Ga0068868_100148092 3300005338 Bacteria 1931
22 Ga0070660_100232867 3300005339 Bacteria 1499
23 Ga0070689_100074557 3300005340 Bacteria 2655
24 Ga0070689_100339658 3300005340 Bacteria 1257
25 Ga0070691_10036902 3300005341 Bacteria 2304
26 Ga0070691_10097500 3300005341 Bacteria 1457
27 Ga0070687_100018005 3300005343 Bacteria 3259
28 Ga0070687_100261303 3300005343 Bacteria 1080
29 Ga0070661_100036593 3300005344 Bacteria 3567
30 Ga0070692_10005999 3300005345 Bacteria 5235
31 Ga0070692_10024740 3300005345 Bacteria 2954
32 Ga0070692_10074710 3300005345 Bacteria 1814
33 Ga0070692_10178768 3300005345 Bacteria 1228
34 Ga0070668_100013944 3300005347 Bacteria 6010
35 Ga0070668_100196865 3300005347 Bacteria 1653
36 Ga0070668_100439464 3300005347 Bacteria 1120
37 Ga0070669_100060162 3300005353 Bacteria 2790
38 Ga0070675_100023940 3300005354 Bacteria 4886
39 Ga0070675_100131459 3300005354 Bacteria 2133
40 Ga0070671_100060213 3300005355 Bacteria 3161
41 Ga0070671_100158311 3300005355 Bacteria 1914
42 Ga0070674_100024379 3300005356 Bacteria 3925
43 Ga0070674_100066022 3300005356 Bacteria 2541
44 Ga0070674_100080550 3300005356 Unclassified 2325
45 Ga0070673_100016643 3300005364 Bacteria 5206
46 Ga0070673_100447479 3300005364 Bacteria 1162
47 Ga0070688_100012313 3300005365 Bacteria 4789
48 Ga0070659_100072234 3300005366 Unclassified 2745
49 Ga0070667_100534600 3300005367 Bacteria 1076
50 Ga0070703_10023509 3300005406 Bacteria 1816
51 Ga0070709_10000393 3300005434 Bacteria 26736
52 Ga0070709_10030693 3300005434 Bacteria 3227
53 Ga0070714_100000595 3300005435 Bacteria 25861
54 Ga0070714_100001847 3300005435 Bacteria 15419
55 Ga0070714_100002652 3300005435 Bacteria 13180
56 Ga0070714_100110878 3300005435 Bacteria 2429
57 Ga0070714_100540776 3300005435 Bacteria 1114
58 Ga0070714_100847030 3300005435 Bacteria 886
59 Ga0070714_100862949 3300005435 Unclassified 878
60 Ga0070713_100003090 3300005436 Bacteria 10950
61 Ga0070713_100023396 3300005436 Bacteria 4795
62 Ga0070713_100050891 3300005436 Bacteria 3424
63 Ga0070713_100077820 3300005436 Bacteria 2821
64 Ga0070713_100282789 3300005436 Bacteria 1522
65 Ga0070713_101091397 3300005436 Unclassified 771
66 Ga0070713_101430621 3300005436 Bacteria 671
67 Ga0070710_10000118 3300005437 Bacteria 37278
68 Ga0070710_10095856 3300005437 Bacteria 1758
69 Ga0070710_10115574 3300005437 Bacteria 1617
70 Ga0070710_10247997 3300005437 Bacteria 1143
71 Ga0070701_10022049 3300005438 Bacteria 3049
72 Ga0070701_10023664 3300005438 Unclassified 2962
73 Ga0070701_10140407 3300005438 Bacteria 1381
74 Ga0070711_100084034 3300005439 Bacteria 2276
75 Ga0070711_100737772 3300005439 Bacteria 831
76 Ga0070705_100080415 3300005440 Bacteria 1999
77 Ga0070705_100416532 3300005440 Unclassified 999
78 Ga0070700_100000421 3300005441 Bacteria 21556
79 Ga0070700_100141413 3300005441 Bacteria 1636
80 Ga0070694_100261607 3300005444 Bacteria 1312
81 Ga0070708_100223250 3300005445 Bacteria 1767
82 Ga0070708_100470478 3300005445 Bacteria 1186
83 Ga0070663_100005253 3300005455 Bacteria 7676
84 Ga0070663_100246077 3300005455 Bacteria 1413
85 Ga0070678_100036666 3300005456 Unclassified 3434
86 Ga0070678_100130390 3300005456 Bacteria 1996
87 Ga0070678_100151640 3300005456 Bacteria 1868
88 Ga0070681_10077966 3300005458 Bacteria 3270
89 Ga0068867_100138261 3300005459 Bacteria 1901
90 Ga0070685_10018112 3300005466 Bacteria 3783
91 Ga0070685_10268922 3300005466 Bacteria 1137
92 Ga0070685_10639124 3300005466 Unclassified 770
93 Ga0070707_100944934 3300005468 Bacteria 827
94 Ga0070698_100190339 3300005471 Bacteria 1990
95 Ga0070699_100001106 3300005518 Bacteria 25074
96 Ga0070699_101109163 3300005518 Bacteria 726
97 Ga0070679_100030817 3300005530 Bacteria 5298
98 Ga0070679_100050593 3300005530 Bacteria 4139
99 Ga0070684_100017994 3300005535 Bacteria 5810
100 Ga0070684_100022910 3300005535 Bacteria 5215
101 Ga0070684_100091006 3300005535 Bacteria 2713
102 Ga0070684_101218847 3300005535 Bacteria 708
103 Ga0070697_100056820 3300005536 Bacteria 3184
104 Ga0068853_100185356 3300005539 Bacteria 1889
105 Ga0070672_100002381 3300005543 Bacteria 11904
106 Ga0070686_100048665 3300005544 Bacteria 2686
107 Ga0070686_100077063 3300005544 Bacteria 2197
108 Ga0070686_100089109 3300005544 Bacteria 2061
109 Ga0070696_100013185 3300005546 Bacteria 5545
110 Ga0070693_100032343 3300005547 Bacteria 2875
111 Ga0070665_100038995 3300005548 Bacteria 4777
112 Ga0070665_100201575 3300005548 Bacteria 1990
113 Ga0070704_100081917 3300005549 Bacteria 2378
114 Ga0068855_100211269 3300005563 Bacteria 2180
115 Ga0070664_100012281 3300005564 Bacteria 6961
116 Ga0070664_100070736 3300005564 Bacteria 2989
117 Ga0070664_100342621 3300005564 Bacteria 1358
118 Ga0068857_100003333 3300005577 Bacteria 13364
119 Ga0068857_100172028 3300005577 Bacteria 1969
120 Ga0068857_100188256 3300005577 Bacteria 1879
121 Ga0068857_100194079 3300005577 Bacteria 1850
122 Ga0068857_100378118 3300005577 Unclassified 1315
123 Ga0068857_100619164 3300005577 Bacteria 1024
124 Ga0068854_100229905 3300005578 Bacteria 1471
125 Ga0068854_100280883 3300005578 Bacteria 1341
126 Ga0068856_100076377 3300005614 Bacteria 3319
127 Ga0070702_100009396 3300005615 Bacteria 4783
128 Ga0070702_100015356 3300005615 Bacteria 3909
129 Ga0070702_100049165 3300005615 Bacteria 2403
130 Ga0068852_100024808 3300005616 Bacteria 4850
131 Ga0068859_100120119 3300005617 Bacteria 2694
132 Ga0068859_100129875 3300005617 Bacteria 2591
133 Ga0068859_100879543 3300005617 Bacteria 981
134 Ga0068864_100032611 3300005618 Unclassified 4427
135 Ga0068864_100336083 3300005618 Bacteria 1422
136 Ga0068866_10002769 3300005718 Bacteria 7233
137 Ga0068866_10035539 3300005718 Bacteria 2435
138 Ga0068861_100005945 3300005719 Bacteria 8287
139 Ga0068851_10162022 3300005834 Bacteria 1229
140 Ga0068870_10004458 3300005840 Bacteria 6027
141 Ga0068870_10009797 3300005840 Bacteria 4373
142 Ga0068863_100309399 3300005841 Bacteria 1533
143 Ga0068858_100062442 3300005842 Bacteria 3444
144 Ga0068858_100334336 3300005842 Bacteria 1449
145 Ga0068860_100371464 3300005843 Bacteria 1410
146 Ga0081455_10036651 3300005937 Bacteria 4363
147 Ga0081455_10293974 3300005937 Bacteria 1168
148 Ga0081538_10000482 3300005981 Bacteria 44773
149 Ga0081538_10008043 3300005981 Bacteria 9014
150 Ga0081538_10030527 3300005981 Bacteria 3657
151 Ga0081540_1001787 3300005983 Bacteria 18027
152 Ga0081540_1055223 3300005983 Bacteria 1935
153 Ga0081539_10000249 3300005985 Bacteria 125691
154 Ga0081539_10001289 3300005985 Bacteria 44042
155 Ga0081539_10048350 3300005985 Bacteria 2420
156 Ga0081539_10064368 3300005985 Bacteria 1995
157 Ga0070717_10001162 3300006028 Bacteria 17781
158 Ga0070717_10132330 3300006028 Bacteria 2146
159 Ga0070717_10140446 3300006028 Bacteria 2083
160 Ga0070717_10492427 3300006028 Bacteria 1107
161 Ga0075365_10110885 3300006038 Bacteria 1885
162 Ga0075365_10143559 3300006038 Bacteria 1658
163 Ga0075365_10167119 3300006038 Bacteria 1535
164 Ga0075368_10010428 3300006042 Bacteria 3358
165 Ga0075363_100093703 3300006048 Bacteria 1655
166 Ga0075432_10022817 3300006058 Bacteria 2142
167 Ga0070715_10066652 3300006163 Bacteria 1597
168 Ga0070715_10117672 3300006163 Bacteria 1262
169 Ga0070716_100000214 3300006173 Bacteria 23074
170 Ga0070716_100581731 3300006173 Bacteria 839
171 Ga0070716_100599162 3300006173 Bacteria 828
172 Ga0070712_100007454 3300006175 Bacteria 6829
173 Ga0070712_100165682 3300006175 Bacteria 1710
174 Ga0070712_100335885 3300006175 Bacteria 1232
175 Ga0070712_100371397 3300006175 Bacteria 1175
176 Ga0097621_100191950 3300006237 Bacteria 1769
177 Ga0075370_10050727 3300006353 Bacteria 2354
178 Ga0075370_10205707 3300006353 Bacteria 1162
179 Ga0068871_100589000 3300006358 Bacteria 1010
180 Ga0068871_101063148 3300006358 Bacteria 756
181 Ga0075428_100374809 3300006844 Bacteria 1526
182 Ga0075428_100728663 3300006844 Bacteria 1056
183 Ga0075428_101349405 3300006844 Unclassified 749
184 Ga0075433_10112351 3300006852 Bacteria 2417
185 Ga0075434_100248387 3300006871 Bacteria 1798
186 Ga0075434_100996969 3300006871 Bacteria 852
187 Ga0068865_100039703 3300006881 Bacteria 3194
188 Ga0068865_100286417 3300006881 Bacteria 1313
189 Ga0097620_100120118 3300006931 Bacteria 2694
190 Ga0097620_100129880 3300006931 Bacteria 2591
191 Ga0097620_100879598 3300006931 Bacteria 981
192 Ga0075435_100207108 3300007076 Bacteria 1663
193 Ga0075435_100993840 3300007076 Bacteria 733
194 Ga0105240_10406586 3300009093 Bacteria 1532
195 Ga0105240_10539486 3300009093 Bacteria 1292
196 Ga0111539_10020452 3300009094 Bacteria 8151
197 Ga0111539_10042944 3300009094 Bacteria 5424
198 Ga0111539_10043822 3300009094 Bacteria 5363
199 Ga0111539_10069741 3300009094 Bacteria 4150
200 Ga0105245_10032076 3300009098 Bacteria 4651
201 Ga0105245_10061855 3300009098 Bacteria 3376
202 Ga0105245_10090344 3300009098 Bacteria 2817
203 Ga0105245_10257958 3300009098 Bacteria 1696
204 Ga0105245_10300245 3300009098 Bacteria 1576
205 Ga0114129_10003023 3300009147 Bacteria 23586
206 Ga0114129_10105689 3300009147 Bacteria 3890
207 Ga0114129_10196046 3300009147 Bacteria 2739
208 Ga0114129_10230502 3300009147 Bacteria 2494
209 Ga0105243_10002070 3300009148 Bacteria 17014
210 Ga0105243_10017169 3300009148 Bacteria 5474
211 Ga0105243_10079716 3300009148 Bacteria 2669
212 Ga0105243_10117025 3300009148 Bacteria 2240
213 Ga0105241_10076200 3300009174 Bacteria 2615
214 Ga0105242_10020079 3300009176 Bacteria 5236
215 Ga0105242_10091714 3300009176 Bacteria 2558
216 Ga0105248_10023760 3300009177 Bacteria 6812
217 Ga0105248_10165458 3300009177 Bacteria 2494
218 Ga0105248_10908301 3300009177 Bacteria 994
219 Ga0105238_10090413 3300009551 Bacteria 3049
220 Ga0105238_10245340 3300009551 Bacteria 1769
221 Ga0105249_10014990 3300009553 Bacteria 6856
222 Ga0105249_10549841 3300009553 Bacteria 1205
223 Ga0105249_11440203 3300009553 Unclassified 761
224 Ga0105032_101402 3300009979 Bacteria 2209
225 Ga0105028_105368 3300009993 Bacteria 1333
226 Ga0105239_10038117 3300010375 Bacteria 5266
227 Ga0105239_10144885 3300010375 Bacteria 2649
228 Ga0105239_10801563 3300010375 Bacteria 1079
229 Ga0105246_10009347 3300011119 Bacteria 6040
230 Ga0105246_10017780 3300011119 Bacteria 4522
231 Ga0105246_10035319 3300011119 Bacteria 3340
232 Ga0105246_10049445 3300011119 Bacteria 2879
233 Ga0105246_10066776 3300011119 Bacteria 2519
234 Ga0157371_10155336 3300013102 Bacteria 1633
235 Ga0157371_10233175 3300013102 Bacteria 1323
236 Ga0157369_10145232 3300013105 Bacteria 2509
237 Ga0157369_10236097 3300013105 Bacteria 1910
238 Ga0157374_10234983 3300013296 Bacteria 1801
239 Ga0157374_10285074 3300013296 Bacteria 1631
240 Ga0157374_10455265 3300013296 Bacteria 1281
241 Ga0157378_10052748 3300013297 Bacteria 3618
242 Ga0163162_10209370 3300013306 Bacteria 2079
243 Ga0157372_10076312 3300013307 Bacteria 3784
244 Ga0157372_11262484 3300013307 Bacteria 853
245 Ga0157375_10010836 3300013308 Bacteria 8033
246 Ga0157375_10192223 3300013308 Bacteria 2196
247 Ga0163163_10016642 3300014325 Bacteria 6836
248 Ga0163163_10044244 3300014325 Bacteria 4368
249 Ga0163163_10130030 3300014325 Bacteria 2558
250 Ga0157380_10016621 3300014326 Bacteria 5431
251 Ga0157380_10399652 3300014326 Bacteria 1303
252 Ga0157377_10005733 3300014745 Bacteria 5858
253 Ga0157377_10010251 3300014745 Bacteria 4628
254 Ga0157377_10032925 3300014745 Bacteria 2826
255 Ga0157379_10164174 3300014968 Bacteria 2005
256 Ga0157379_10267598 3300014968 Bacteria 1554
257 Ga0157376_10120037 3300014969 Bacteria 2328
258 Ga0157376_10256561 3300014969 Bacteria 1636
259 Ga0157376_10374217 3300014969 Bacteria 1370
260 Ga0213875_10131737 3300021388 Bacteria 1169
261 Ga0207692_10000713 3300025898 Bacteria 11699
262 Ga0207692_10016334 3300025898 Bacteria 3285
263 Ga0207692_10018855 3300025898 Bacteria 3105
264 Ga0207642_10125811 3300025899 Bacteria 1330
265 Ga0207710_10043507 3300025900 Bacteria 1998
266 Ga0207688_10002542 3300025901 Bacteria 9850
267 Ga0207688_10013948 3300025901 Bacteria 4368
268 Ga0207688_10038588 3300025901 Unclassified 2651
269 Ga0207688_10132608 3300025901 Bacteria 1461
270 Ga0207680_10584383 3300025903 Bacteria 798
271 Ga0207685_10053139 3300025905 Bacteria 1572
272 Ga0207699_10028456 3300025906 Bacteria 3106
273 Ga0207699_10096464 3300025906 Bacteria 1867
274 Ga0207699_10369114 3300025906 Bacteria 1017
275 Ga0207699_10377341 3300025906 Bacteria 1006
276 Ga0207645_10044064 3300025907 Bacteria 2855
277 Ga0207645_10159239 3300025907 Bacteria 1476
278 Ga0207643_10004005 3300025908 Bacteria 7926
279 Ga0207643_10043804 3300025908 Bacteria 2526
280 Ga0207705_10110879 3300025909 Bacteria 2027
281 Ga0207705_10562637 3300025909 Bacteria 886
282 Ga0207684_10492985 3300025910 Bacteria 1050
283 Ga0207695_10110704 3300025913 Bacteria 2726
284 Ga0207671_10122109 3300025914 Bacteria 1992
285 Ga0207693_10006570 3300025915 Bacteria 9623
286 Ga0207693_10046021 3300025915 Bacteria 3428
287 Ga0207663_10157578 3300025916 Bacteria 1599
288 Ga0207663_10316398 3300025916 Bacteria 1171
289 Ga0207662_10008719 3300025918 Bacteria 5562
290 Ga0207662_10068618 3300025918 Bacteria 2141
291 Ga0207657_10001979 3300025919 Bacteria 22119
292 Ga0207649_10539512 3300025920 Bacteria 891
293 Ga0207646_10004121 3300025922 Bacteria 15968
294 Ga0207646_10461285 3300025922 Bacteria 1146
295 Ga0207681_10181144 3300025923 Bacteria 1605
296 Ga0207694_10073320 3300025924 Bacteria 2678
297 Ga0207694_10218610 3300025924 Bacteria 1553
298 Ga0207650_10006917 3300025925 Bacteria 7732
299 Ga0207650_10041047 3300025925 Bacteria 3388
300 Ga0207650_10326328 3300025925 Bacteria 1258
301 Ga0207659_10036808 3300025926 Bacteria 3393
302 Ga0207659_10052221 3300025926 Bacteria 2911
303 Ga0207659_10053375 3300025926 Bacteria 2883
304 Ga0207687_10023648 3300025927 Bacteria 4099
305 Ga0207687_10070470 3300025927 Bacteria 2496
306 Ga0207687_10494504 3300025927 Bacteria 1020
307 Ga0207700_10000043 3300025928 Bacteria 92646
308 Ga0207700_10032021 3300025928 Bacteria 3744
309 Ga0207700_10161671 3300025928 Bacteria 1860
310 Ga0207700_10411413 3300025928 Bacteria 1186
311 Ga0207664_10000123 3300025929 Bacteria 68003
312 Ga0207664_10000336 3300025929 Bacteria 34551
313 Ga0207664_10013451 3300025929 Bacteria 5874
314 Ga0207664_10014023 3300025929 Bacteria 5777
315 Ga0207664_10014504 3300025929 Bacteria 5694
316 Ga0207664_10046921 3300025929 Bacteria 3392
317 Ga0207664_10236549 3300025929 Bacteria 1589
318 Ga0207664_10363174 3300025929 Bacteria 1283
319 Ga0207664_10559848 3300025929 Unclassified 1026
320 Ga0207664_11097199 3300025929 Bacteria 711
321 Ga0207644_10280596 3300025931 Bacteria 1337
322 Ga0207690_10086523 3300025932 Bacteria 2203
323 Ga0207690_10114953 3300025932 Bacteria 1944
324 Ga0207706_10239654 3300025933 Bacteria 1586
325 Ga0207686_10178194 3300025934 Bacteria 1505
326 Ga0207709_10017172 3300025935 Bacteria 4035
327 Ga0207709_10036545 3300025935 Bacteria 2911
328 Ga0207709_10103559 3300025935 Bacteria 1887
329 Ga0207709_10165607 3300025935 Bacteria 1546
330 Ga0207709_10531252 3300025935 Bacteria 922
331 Ga0207670_10337987 3300025936 Bacteria 1189
332 Ga0207670_10437638 3300025936 Bacteria 1052
333 Ga0207669_10048462 3300025937 Bacteria 2524
334 Ga0207669_10064116 3300025937 Bacteria 2272
335 Ga0207704_10014615 3300025938 Bacteria 3970
336 Ga0207704_10380330 3300025938 Bacteria 1108
337 Ga0207704_10410200 3300025938 Bacteria 1071
338 Ga0207665_10032867 3300025939 Bacteria 3436
339 Ga0207691_10006122 3300025940 Bacteria 11630
340 Ga0207691_10398973 3300025940 Bacteria 1173
341 Ga0207711_10076070 3300025941 Bacteria 2923
342 Ga0207689_10029129 3300025942 Bacteria 4614
343 Ga0207661_10028113 3300025944 Bacteria 4303
344 Ga0207661_10178922 3300025944 Bacteria 1851
345 Ga0207661_10187321 3300025944 Bacteria 1812
346 Ga0207661_10299060 3300025944 Bacteria 1442
347 Ga0207679_10039246 3300025945 Bacteria 3380
348 Ga0207679_10054505 3300025945 Bacteria 2944
349 Ga0207679_10725117 3300025945 Bacteria 903
350 Ga0207651_10088020 3300025960 Bacteria 2263
351 Ga0207651_10107925 3300025960 Bacteria 2082
352 Ga0207712_10382450 3300025961 Bacteria 1178
353 Ga0207668_10007416 3300025972 Bacteria 6519
354 Ga0207668_10043574 3300025972 Unclassified 3047
355 Ga0207640_10068474 3300025981 Bacteria 2379
356 Ga0207640_10429620 3300025981 Bacteria 1083
357 Ga0207658_10049725 3300025986 Bacteria 3082
358 Ga0207677_10157539 3300026023 Bacteria 1760
359 Ga0207703_10133566 3300026035 Bacteria 2146
360 Ga0207703_10293107 3300026035 Bacteria 1481
361 Ga0207639_10127824 3300026041 Bacteria 2099
362 Ga0207639_10230405 3300026041 Bacteria 1605
363 Ga0207678_10032449 3300026067 Bacteria 4551
364 Ga0207678_10072927 3300026067 Bacteria 2942
365 Ga0207708_10000924 3300026075 Bacteria 21984
366 Ga0207708_10003523 3300026075 Bacteria 11535
367 Ga0207708_10058283 3300026075 Bacteria 2947
368 Ga0207702_10070446 3300026078 Bacteria 3007
369 Ga0207702_10070767 3300026078 Bacteria 3001
370 Ga0207648_10000688 3300026089 Bacteria 37846
371 Ga0207676_10121184 3300026095 Bacteria 2206
372 Ga0207676_10257079 3300026095 Bacteria 1575
373 Ga0207676_10707546 3300026095 Bacteria 976
374 Ga0207676_11385054 3300026095 Bacteria 699
375 Ga0207674_10006320 3300026116 Bacteria 13962
376 Ga0207674_10014999 3300026116 Bacteria 8536
377 Ga0207674_10055497 3300026116 Bacteria 4027
378 Ga0207675_100002074 3300026118 Bacteria 19942
379 Ga0207675_100009193 3300026118 Bacteria 9272
380 Ga0207683_10001518 3300026121 Bacteria 20903
381 Ga0207683_10290002 3300026121 Bacteria 1496
382 Ga0207698_10081658 3300026142 Bacteria 2610
383 Ga0207698_10393539 3300026142 Bacteria 1322
384 Ga0207428_10045178 3300027907 Bacteria 3550
385 Ga0268264_10290767 3300028381 Bacteria 1534
386 Ga0307515_10036026 3300028794 Bacteria 8022
387 Ga0316176_1218947 3300030732 Bacteria 1184
388 Ga0314311_1191965 3300030733 Bacteria 4143
389 Ga0265325_10120300 3300031241 Bacteria 1266
390 Ga0307513_10722896 3300031456 Bacteria 701
391 Ga0307509_10257573 3300031507 Bacteria 1523
392 Ga0307408_100297843 3300031548 Bacteria 1350
393 Ga0307408_100438221 3300031548 Bacteria 1131
394 Ga0307408_100464129 3300031548 Bacteria 1101
395 Ga0307508_10374413 3300031616 Bacteria 1015
396 Ga0307514_10337068 3300031649 Bacteria 815
397 Ga0307516_10125645 3300031730 Bacteria 2350
398 Ga0307405_10067839 3300031731 Bacteria 2280
399 Ga0307405_10624405 3300031731 Bacteria 883
400 Ga0307413_10905533 3300031824 Bacteria 749
401 Ga0307410_10066649 3300031852 Bacteria 2481
402 Ga0307410_10173380 3300031852 Bacteria 1627
403 Ga0307406_10492359 3300031901 Bacteria 992
404 Ga0307406_10546940 3300031901 Bacteria 946
405 Ga0307412_10172170 3300031911 Bacteria 1620
406 Ga0307409_100034871 3300031995 Bacteria 3681
407 Ga0307409_100165126 3300031995 Bacteria 1942
408 Ga0307416_100163259 3300032002 Bacteria 2062
409 Ga0307416_100261266 3300032002 Bacteria 1692
410 Ga0307414_10038421 3300032004 Bacteria 3215
411 Ga0307411_10452446 3300032005 Bacteria 1074
412 Ga0307411_11065201 3300032005 Bacteria 727
413 Ga0307415_100073050 3300032126 Bacteria 2418
414 Ga0307415_100322067 3300032126 Bacteria 1289
415 Ga0373948_0054632 3300034817 Bacteria 865
416 Ga0373929_0010654 3300035085 Bacteria 1722
417 Ga0373940_0109360 3300035088 Bacteria 847
418 Ga0373952_0022472 3300035092 Bacteria 1340
419 Ga0373932_0056853 3300035112 Bacteria 1178
420 Ga0373939_0050557 3300035114 Bacteria 1289
421 Ga0373946_0032058 3300035171 Bacteria 2109
422 Ga0373955_0312462 3300035172 Bacteria 949
423 Ga0373942_0007667 3300035207 Bacteria 2509
424 Ga0373961_0069646 3300035241 Bacteria 1085
425 Ga0373962_0025703 3300035242 Bacteria 1582
426 Ga0373931_0008896 3300035691 Bacteria 4783
427 Ga0373947_0049499 3300035725 Bacteria 2524
428 Ga0373937_0577621 3300036401 Bacteria 1067
429 Ga0395899_0025415 3300037312 Bacteria 4471
430 Ga0395899_0036099 3300037312 Bacteria 3709
431 Ga0395899_0273904 3300037312 Bacteria 1150
432 Ga0395900_0065158 3300037418 Bacteria 3742
433 Ga0395900_0077698 3300037418 Bacteria 3410
434 Ga0395900_0118231 3300037418 Bacteria 2720
435 Ga0395898_0026682 3300037466 Bacteria 5807
436 Ga0395898_0042594 3300037466 Bacteria 4478
437 Ga0395898_0155199 3300037466 Bacteria 2190
438 Ga0395898_0853670 3300037466 Bacteria 850
439 Ga0395905_0038588 3300037471 Unclassified 4482
440 Ga0395905_0074499 3300037471 Bacteria 3181
441 Ga0395905_0447680 3300037471 Bacteria 1189
442 Ga0395905_0723536 3300037471 Bacteria 898
443 Ga0436364_1272163 3300037853 Bacteria 2284
444 Ga0395901_0060255 3300038443 Bacteria 3949
445 Ga0395901_0100155 3300038443 Bacteria 3039
446 Ga0395901_0108941 3300038443 Unclassified 2907
447 Ga0395901_0586578 3300038443 Bacteria 1125
448 Ga0436363_1088855 3300039450 Bacteria 1134
449 Ga0451835_0177489 3300041492 Bacteria 869
450 Ga0451843_1143978 3300041509 Bacteria 2108
451 Ga0451843_1348459 3300041509 Bacteria 1148
452 Ga0439458_0091665 3300042157 Bacteria 783
453 Ga0466972_0018382 3300044658 Bacteria 3494
454 Ga0466965_0001021 3300044683 Bacteria 10833
455 Ga0466965_0018259 3300044683 Bacteria 3360
456 Ga0466965_0019865 3300044683 Bacteria 3226
457 Ga0466963_0664110 3300044694 Bacteria 736
458 Ga0466970_0004304 3300044765 Bacteria 7002
459 Ga0466960_0001459 3300044901 Bacteria 8626
460 Ga0466967_0010108 3300045976 Bacteria 7053
461 Ga0466967_0036080 3300045976 Bacteria 4217
462 Ga0466967_0179875 3300045976 Bacteria 1994
463 Ga0466967_0859084 3300045976 Unclassified 902
464 Ga0495629_0171641 3300046459 Bacteria 1505
465 Ga0495653_0132045 3300046463 Bacteria 1766
466 Ga0495608_0031556 3300046511 Bacteria 3582
467 Ga0495628_0104259 3300046516 Bacteria 2186
468 Ga0495630_0209939 3300046517 Bacteria 1486
469 Ga0495667_0161083 3300046559 Bacteria 1443
470 Ga0495635_0202012 3300046663 Bacteria 1348
471 Ga0495635_0660304 3300046663 Bacteria 680
472 Ga0495599_0232003 3300046678 Bacteria 1127
473 Ga0495599_0339516 3300046678 Bacteria 902
474 Ga0495599_0615035 3300046678 Unclassified 632
475 Ga0495646_0139294 3300046680 Bacteria 1358
476 Ga0495658_0613637 3300046683 Unclassified 697
477 Ga0495600_0089266 3300046809 Bacteria 2011
478 Ga0495600_0121765 3300046809 Bacteria 1697
479 Ga0495674_0046470 3300047319 Bacteria 3853
480 Ga0495680_0209978 3300047322 Bacteria 1394
481 Ga0495680_0286073 3300047322 Bacteria 1161
482 Ga0495684_0088548 3300047471 Bacteria 2346
483 Ga0495602_0324409 3300048088 Bacteria 1119
484 Ga0496100_0023061 3300048903 Bacteria 3775
485 Ga0496100_0504216 3300048903 Bacteria 933
486 Ga0496101_0161095 3300048904 Bacteria 1720
487 Ga0496102_0191202 3300048905 Bacteria 1929
488 Ga0496103_0049960 3300048906 Bacteria 2586
489 Ga0496103_0107031 3300048906 Bacteria 1774
490 Ga0496103_0547636 3300048906 Bacteria 739
491 Ga0496104_0024542 3300048907 Bacteria 5546
492 Ga0496104_0523717 3300048907 Bacteria 1097
493 Ga0496105_0213683 3300048908 Bacteria 1571
494 Ga0496105_0353406 3300048908 Bacteria 1173
495 Ga0496106_0068360 3300048909 Bacteria 2709
496 Ga0496107_0169962 3300048910 Bacteria 1617
497 Ga0496107_0178904 3300048910 Bacteria 1575
498 Ga0496108_0053880 3300048911 Bacteria 3375
499 Ga0496108_0073357 3300048911 Bacteria 2889
500 Ga0496108_0074694 3300048911 Bacteria 2862
501 Ga0496108_0077997 3300048911 Bacteria 2803
502 Ga0496108_0372217 3300048911 Bacteria 1247
503 Ga0496109_0064355 3300048912 Bacteria 3356
504 Ga0496109_0091853 3300048912 Unclassified 2807
505 Ga0496109_0152843 3300048912 Bacteria 2161
506 Ga0496109_0308280 3300048912 Bacteria 1493
507 Ga0496109_0348241 3300048912 Bacteria 1399
508 Ga0496109_0417171 3300048912 Bacteria 1268
509 Ga0496110_0133474 3300048913 Bacteria 2243
510 Ga0496111_0007611 3300048914 Bacteria 7116
511 Ga0496111_0173585 3300048914 Bacteria 1602
512 Ga0496112_0000125 3300048915 Bacteria 47606
513 Ga0496112_0147336 3300048915 Bacteria 2322
514 Ga0496113_0350049 3300048916 Bacteria 1185
515 Ga0496114_0121772 3300048917 Bacteria 2244
516 Ga0496114_0181107 3300048917 Bacteria 1840
517 Ga0496114_0354249 3300048917 Bacteria 1298
518 Ga0496115_0205514 3300048918 Bacteria 1627
519 Ga0501037_0074650 3300049573 Bacteria 2464
520 Ga0501038_0387561 3300049574 Bacteria 1083
521 Ga0501039_0176015 3300049575 Bacteria 1683
522 Ga0501042_0140492 3300049578 Bacteria 1741
523 Ga0501043_0069407 3300049579 Bacteria 2768
524 Ga0501048_0054367 3300049582 Bacteria 2844
525 Ga0501068_0436773 3300049584 Unclassified 846
526 Ga0501071_0357117 3300049587 Bacteria 1112
527 Ga0501072_0096013 3300049588 Bacteria 2356
528 Ga0501075_0233225 3300049591 Bacteria 1403
529 Ga0501075_0338982 3300049591 Bacteria 1146
530 Ga0501076_0320939 3300049592 Bacteria 1270
531 Ga0501076_0520490 3300049592 Unclassified 980
532 Ga0501077_0152970 3300049593 Bacteria 1464
533 Ga0501260_014972 3300049689 Bacteria 807
534 Ga0501079_0342387 3300049741 Bacteria 1171
535 Ga0501080_0418396 3300049742 Bacteria 1204
536 Ga0501081_0086711 3300049743 Bacteria 2198
537 Ga0501081_0182245 3300049743 Bacteria 1519
538 Ga0501045_0102704 3300049824 Bacteria 2116
539 Ga0501045_0195044 3300049824 Unclassified 1509
540 Ga0501212_034328 3300049851 Bacteria 826
541 nmdc:mga0yw44_31865_c1 3300050492 Bacteria 3068
542 nmdc:mga06z11_578593_c1 3300050494 Bacteria 683
543 nmdc:mga07m45_143336_c1 3300050496 Bacteria 1384
544 nmdc:mga05p37_26969_c1 3300050507 Bacteria 6990
545 nmdc:mga05p37_384294_c1 3300050507 Bacteria 1644
546 nmdc:mga05p37_45361_c1 3300050507 Bacteria 5407
547 nmdc:mga05p37_60267_c1 3300050507 Bacteria 4673
548 nmdc:mga08y16_162164_c1 3300050511 Bacteria 2323
549 nmdc:mga08y16_25778_c1 3300050511 Bacteria 6204
550 nmdc:mga08y16_32993_c1 3300050511 Bacteria 5441
551 nmdc:mga0n895_58993_c1 3300050512 Bacteria 3786
552 nmdc:mga0rr50_32466_c1 3300050513 Bacteria 3720
553 nmdc:mga08x19_392074_c1 3300050514 Bacteria 973
554 nmdc:mga0a205_37124_c1 3300050515 Bacteria 4684
555 Ga0500635_0176068 3300053080 Bacteria 825
556 Ga0501084_0236824 3300054114 Bacteria 1541
557 Ga0501084_0344745 3300054114 Unclassified 1258
558 Ga0590075_019311 3300059424 Bacteria 1691
559 Ga0501082_0154444 3300060353 Bacteria 1994
560 Ga0530510_0146276 3300061734 Bacteria 1743
561 Ga0530510_0278484 3300061734 Unclassified 1249
562 2644626028 2643221714 Bacteria 9015452
563 2837270280 2837268691 Bacteria 7850704
564 2868090190 2868088558 Bacteria 7609351
565 2919449876 2919446982 Bacteria 3994487
566 3003000471 3002998708 Bacteria 11715108
567 Ga0105243_10053386
568 JGI24751J29686_10013918
569 Ga0070658_10380347
570 Ga0070676_10049987
571 Ga0070676_10197390
572 Ga0070676_10563304
573 Ga0070683_100059730
574 Ga0070683_100078609
575 Ga0070683_100252705
576 Ga0070683_100988663
577 Ga0070690_100089805
578 Ga0070670_100173154
579 Ga0070670_100297551
580 Ga0070670_100567065
581 Ga0068869_100037850
582 Ga0070666_10089575
583 Ga0070680_100027397
584 Ga0070682_100027753
585 Ga0070682_100215051
586 Ga0068868_100075860
587 Ga0068868_100148092
588 Ga0070660_100232867
589 Ga0070689_100074557
590 Ga0070689_100339658
591 Ga0070691_10036902
592 Ga0070691_10097500
593 Ga0070687_100018005
594 Ga0070687_100261303
595 Ga0070661_100036593
596 Ga0070692_10005999
597 Ga0070692_10024740
598 Ga0070692_10074710
599 Ga0070692_10178768
600 Ga0070668_100013944
601 Ga0070668_100196865
602 Ga0070668_100439464
603 Ga0070669_100060162
604 Ga0070675_100023940
605 Ga0070675_100131459
606 Ga0070671_100060213
607 Ga0070671_100158311
608 Ga0070674_100024379
609 Ga0070674_100066022
610 Ga0070674_100080550
611 Ga0070673_100016643
612 Ga0070673_100447479
613 Ga0070688_100012313
614 Ga0070659_100072234
615 Ga0070667_100534600
616 Ga0070703_10023509
617 Ga0070709_10000393
618 Ga0070709_10030693
619 Ga0070714_100000595
620 Ga0070714_100001847
621 Ga0070714_100002652
622 Ga0070714_100110878
623 Ga0070714_100540776
624 Ga0070714_100847030
625 Ga0070714_100862949
626 Ga0070713_100003090
627 Ga0070713_100023396
628 Ga0070713_100050891
629 Ga0070713_100077820
630 Ga0070713_100282789
631 Ga0070713_101091397
632 Ga0070713_101430621
633 Ga0070710_10000118
634 Ga0070710_10095856
635 Ga0070710_10115574
636 Ga0070710_10247997
637 Ga0070701_10022049
638 Ga0070701_10023664
639 Ga0070701_10140407
640 Ga0070711_100084034
641 Ga0070711_100737772
642 Ga0070705_100080415
643 Ga0070705_100416532
644 Ga0070700_100000421
645 Ga0070700_100141413
646 Ga0070694_100261607
647 Ga0070708_100223250
648 Ga0070708_100470478
649 Ga0070663_100005253
650 Ga0070663_100246077
651 Ga0070678_100036666
652 Ga0070678_100130390
653 Ga0070678_100151640
654 Ga0070681_10077966
655 Ga0068867_100138261
656 Ga0070685_10018112
657 Ga0070685_10268922
658 Ga0070685_10639124
659 Ga0070707_100944934
660 Ga0070698_100190339
661 Ga0070699_100001106
662 Ga0070699_101109163
663 Ga0070679_100030817
664 Ga0070679_100050593
665 Ga0070684_100017994
666 Ga0070684_100022910
667 Ga0070684_100091006
668 Ga0070684_101218847
669 Ga0070697_100056820
670 Ga0068853_100185356
671 Ga0070672_100002381
672 Ga0070686_100048665
673 Ga0070686_100077063
674 Ga0070686_100089109
675 Ga0070696_100013185
676 Ga0070693_100032343
677 Ga0070665_100038995
678 Ga0070665_100201575
679 Ga0070704_100081917
680 Ga0068855_100211269
681 Ga0070664_100012281
682 Ga0070664_100070736
683 Ga0070664_100342621
684 Ga0068857_100003333
685 Ga0068857_100172028
686 Ga0068857_100188256
687 Ga0068857_100194079
688 Ga0068857_100378118
689 Ga0068857_100619164
690 Ga0068854_100229905
691 Ga0068854_100280883
692 Ga0068856_100076377
693 Ga0070702_100009396
694 Ga0070702_100015356
695 Ga0070702_100049165
696 Ga0068852_100024808
697 Ga0068859_100120119
698 Ga0068859_100129875
699 Ga0068859_100879543
700 Ga0068864_100032611
701 Ga0068864_100336083
702 Ga0068866_10002769
703 Ga0068866_10035539
704 Ga0068861_100005945
705 Ga0068851_10162022
706 Ga0068870_10004458
707 Ga0068870_10009797
708 Ga0068863_100309399
709 Ga0068858_100062442
710 Ga0068858_100334336
711 Ga0068860_100371464
712 Ga0081455_10036651
713 Ga0081455_10293974
714 Ga0081538_10000482
715 Ga0081538_10008043
716 Ga0081538_10030527
717 Ga0081540_1001787
718 Ga0081540_1055223
719 Ga0081539_10000249
720 Ga0081539_10001289
721 Ga0081539_10048350
722 Ga0081539_10064368
723 Ga0070717_10001162
724 Ga0070717_10132330
725 Ga0070717_10140446
726 Ga0070717_10492427
727 Ga0075365_10110885
728 Ga0075365_10143559
729 Ga0075365_10167119
730 Ga0075368_10010428
731 Ga0075363_100093703
732 Ga0075432_10022817
733 Ga0070715_10066652
734 Ga0070715_10117672
735 Ga0070716_100000214
736 Ga0070716_100581731
737 Ga0070716_100599162
738 Ga0070712_100007454
739 Ga0070712_100165682
740 Ga0070712_100335885
741 Ga0070712_100371397
742 Ga0097621_100191950
743 Ga0075370_10050727
744 Ga0075370_10205707
745 Ga0068871_100589000
746 Ga0068871_101063148
747 Ga0075428_100374809
748 Ga0075428_100728663
749 Ga0075428_101349405
750 Ga0075433_10112351
751 Ga0075434_100248387
752 Ga0075434_100996969
753 Ga0068865_100039703
754 Ga0068865_100286417
755 Ga0097620_100120118
756 Ga0097620_100129880
757 Ga0097620_100879598
758 Ga0075435_100207108
759 Ga0075435_100993840
760 Ga0105240_10406586
761 Ga0105240_10539486
762 Ga0111539_10020452
763 Ga0111539_10042944
764 Ga0111539_10043822
765 Ga0111539_10069741
766 Ga0105245_10032076
767 Ga0105245_10061855
768 Ga0105245_10090344
769 Ga0105245_10257958
770 Ga0105245_10300245
771 Ga0114129_10003023
772 Ga0114129_10105689
773 Ga0114129_10196046
774 Ga0114129_10230502
775 Ga0105243_10002070
776 Ga0105243_10017169
777 Ga0105243_10079716
778 Ga0105243_10117025
779 Ga0105241_10076200
780 Ga0105242_10020079
781 Ga0105242_10091714
782 Ga0105248_10023760
783 Ga0105248_10165458
784 Ga0105248_10908301
785 Ga0105238_10090413
786 Ga0105238_10245340
787 Ga0105249_10014990
788 Ga0105249_10549841
789 Ga0105249_11440203
790 Ga0105032_101402
791 Ga0105028_105368
792 Ga0105239_10038117
793 Ga0105239_10144885
794 Ga0105239_10801563
795 Ga0105246_10009347
796 Ga0105246_10017780
797 Ga0105246_10035319
798 Ga0105246_10049445
799 Ga0105246_10066776
800 Ga0157371_10155336
801 Ga0157371_10233175
802 Ga0157369_10145232
803 Ga0157369_10236097
804 Ga0157374_10234983
805 Ga0157374_10285074
806 Ga0157374_10455265
807 Ga0157378_10052748
808 Ga0163162_10209370
809 Ga0157372_10076312
810 Ga0157372_11262484
811 Ga0157375_10010836
812 Ga0157375_10192223
813 Ga0163163_10016642
814 Ga0163163_10044244
815 Ga0163163_10130030
816 Ga0157380_10016621
817 Ga0157380_10399652
818 Ga0157377_10005733
819 Ga0157377_10010251
820 Ga0157377_10032925
821 Ga0157379_10164174
822 Ga0157379_10267598
823 Ga0157376_10120037
824 Ga0157376_10256561
825 Ga0157376_10374217
826 Ga0213875_10131737
827 Ga0207692_10000713
828 Ga0207692_10016334
829 Ga0207692_10018855
830 Ga0207642_10125811
831 Ga0207710_10043507
832 Ga0207688_10002542
833 Ga0207688_10013948
834 Ga0207688_10038588
835 Ga0207688_10132608
836 Ga0207680_10584383
837 Ga0207685_10053139
838 Ga0207699_10028456
839 Ga0207699_10096464
840 Ga0207699_10369114
841 Ga0207699_10377341
842 Ga0207645_10044064
843 Ga0207645_10159239
844 Ga0207643_10004005
845 Ga0207643_10043804
846 Ga0207705_10110879
847 Ga0207705_10562637
848 Ga0207684_10492985
849 Ga0207695_10110704
850 Ga0207671_10122109
851 Ga0207693_10006570
852 Ga0207693_10046021
853 Ga0207663_10157578
854 Ga0207663_10316398
855 Ga0207662_10008719
856 Ga0207662_10068618
857 Ga0207657_10001979
858 Ga0207649_10539512
859 Ga0207646_10004121
860 Ga0207646_10461285
861 Ga0207681_10181144
862 Ga0207694_10073320
863 Ga0207694_10218610
864 Ga0207650_10006917
865 Ga0207650_10041047
866 Ga0207650_10326328
867 Ga0207659_10036808
868 Ga0207659_10052221
869 Ga0207659_10053375
870 Ga0207687_10023648
871 Ga0207687_10070470
872 Ga0207687_10494504
873 Ga0207700_10000043
874 Ga0207700_10032021
875 Ga0207700_10161671
876 Ga0207700_10411413
877 Ga0207664_10000123
878 Ga0207664_10000336
879 Ga0207664_10013451
880 Ga0207664_10014023
881 Ga0207664_10014504
882 Ga0207664_10046921
883 Ga0207664_10236549
884 Ga0207664_10363174
885 Ga0207664_10559848
886 Ga0207664_11097199
887 Ga0207644_10280596
888 Ga0207690_10086523
889 Ga0207690_10114953
890 Ga0207706_10239654
891 Ga0207686_10178194
892 Ga0207709_10017172
893 Ga0207709_10036545
894 Ga0207709_10103559
895 Ga0207709_10165607
896 Ga0207709_10531252
897 Ga0207670_10337987
898 Ga0207670_10437638
899 Ga0207669_10048462
900 Ga0207669_10064116
901 Ga0207704_10014615
902 Ga0207704_10380330
903 Ga0207704_10410200
904 Ga0207665_10032867
905 Ga0207691_10006122
906 Ga0207691_10398973
907 Ga0207711_10076070
908 Ga0207689_10029129
909 Ga0207661_10028113
910 Ga0207661_10178922
911 Ga0207661_10187321
912 Ga0207661_10299060
913 Ga0207679_10039246
914 Ga0207679_10054505
915 Ga0207679_10725117
916 Ga0207651_10088020
917 Ga0207651_10107925
918 Ga0207712_10382450
919 Ga0207668_10007416
920 Ga0207668_10043574
921 Ga0207640_10068474
922 Ga0207640_10429620
923 Ga0207658_10049725
924 Ga0207677_10157539
925 Ga0207703_10133566
926 Ga0207703_10293107
927 Ga0207639_10127824
928 Ga0207639_10230405
929 Ga0207678_10032449
930 Ga0207678_10072927
931 Ga0207708_10000924
932 Ga0207708_10003523
933 Ga0207708_10058283
934 Ga0207702_10070446
935 Ga0207702_10070767
936 Ga0207648_10000688
937 Ga0207676_10121184
938 Ga0207676_10257079
939 Ga0207676_10707546
940 Ga0207676_11385054
941 Ga0207674_10006320
942 Ga0207674_10014999
943 Ga0207674_10055497
944 Ga0207675_100002074
945 Ga0207675_100009193
946 Ga0207683_10001518
947 Ga0207683_10290002
948 Ga0207698_10081658
949 Ga0207698_10393539
950 Ga0207428_10045178
951 Ga0268264_10290767
952 Ga0307515_10036026
953 Ga0316176_1218947
954 Ga0314311_1191965
955 Ga0265325_10120300
956 Ga0307513_10722896
957 Ga0307509_10257573
958 Ga0307408_100297843
959 Ga0307408_100438221
960 Ga0307408_100464129
961 Ga0307508_10374413
962 Ga0307514_10337068
963 Ga0307516_10125645
964 Ga0307405_10067839
965 Ga0307405_10624405
966 Ga0307413_10905533
967 Ga0307410_10066649
968 Ga0307410_10173380
969 Ga0307406_10492359
970 Ga0307406_10546940
971 Ga0307412_10172170
972 Ga0307409_100034871
973 Ga0307409_100165126
974 Ga0307416_100163259
975 Ga0307416_100261266
976 Ga0307414_10038421
977 Ga0307411_10452446
978 Ga0307411_11065201
979 Ga0307415_100073050
980 Ga0307415_100322067
981 Ga0373948_0054632
982 Ga0373929_0010654
983 Ga0373940_0109360
984 Ga0373952_0022472
985 Ga0373932_0056853
986 Ga0373939_0050557
987 Ga0373946_0032058
988 Ga0373955_0312462
989 Ga0373942_0007667
990 Ga0373961_0069646
991 Ga0373962_0025703
992 Ga0373931_0008896
993 Ga0373947_0049499
994 Ga0373937_0577621
995 Ga0395899_0025415
996 Ga0395899_0036099
997 Ga0395899_0273904
998 Ga0395900_0065158
999 Ga0395900_0077698
1000 Ga0395900_0118231
1001 Ga0395898_0026682
1002 Ga0395898_0042594
1003 Ga0395898_0155199
1004 Ga0395898_0853670
1005 Ga0395905_0038588
1006 Ga0395905_0074499
1007 Ga0395905_0447680
1008 Ga0395905_0723536
1009 Ga0436364_1272163
1010 Ga0395901_0060255
1011 Ga0395901_0100155
1012 Ga0395901_0108941
1013 Ga0395901_0586578
1014 Ga0436363_1088855
1015 Ga0451835_0177489
1016 Ga0451843_1143978
1017 Ga0451843_1348459
1018 Ga0439458_0091665
1019 Ga0466972_0018382
1020 Ga0466965_0001021
1021 Ga0466965_0018259
1022 Ga0466965_0019865
1023 Ga0466963_0664110
1024 Ga0466970_0004304
1025 Ga0466960_0001459
1026 Ga0466967_0010108
1027 Ga0466967_0036080
1028 Ga0466967_0179875
1029 Ga0466967_0859084
1030 Ga0495629_0171641
1031 Ga0495653_0132045
1032 Ga0495608_0031556
1033 Ga0495628_0104259
1034 Ga0495630_0209939
1035 Ga0495667_0161083
1036 Ga0495635_0202012
1037 Ga0495635_0660304
1038 Ga0495599_0232003
1039 Ga0495599_0339516
1040 Ga0495599_0615035
1041 Ga0495646_0139294
1042 Ga0495658_0613637
1043 Ga0495600_0089266
1044 Ga0495600_0121765
1045 Ga0495674_0046470
1046 Ga0495680_0209978
1047 Ga0495680_0286073
1048 Ga0495684_0088548
1049 Ga0495602_0324409
1050 Ga0496100_0023061
1051 Ga0496100_0504216
1052 Ga0496101_0161095
1053 Ga0496102_0191202
1054 Ga0496103_0049960
1055 Ga0496103_0107031
1056 Ga0496103_0547636
1057 Ga0496104_0024542
1058 Ga0496104_0523717
1059 Ga0496105_0213683
1060 Ga0496105_0353406
1061 Ga0496106_0068360
1062 Ga0496107_0169962
1063 Ga0496107_0178904
1064 Ga0496108_0053880
1065 Ga0496108_0073357
1066 Ga0496108_0074694
1067 Ga0496108_0077997
1068 Ga0496108_0372217
1069 Ga0496109_0064355
1070 Ga0496109_0091853
1071 Ga0496109_0152843
1072 Ga0496109_0308280
1073 Ga0496109_0348241
1074 Ga0496109_0417171
1075 Ga0496110_0133474
1076 Ga0496111_0007611
1077 Ga0496111_0173585
1078 Ga0496112_0000125
1079 Ga0496112_0147336
1080 Ga0496113_0350049
1081 Ga0496114_0121772
1082 Ga0496114_0181107
1083 Ga0496114_0354249
1084 Ga0496115_0205514
1085 Ga0501037_0074650
1086 Ga0501038_0387561
1087 Ga0501039_0176015
1088 Ga0501042_0140492
1089 Ga0501043_0069407
1090 Ga0501048_0054367
1091 Ga0501068_0436773
1092 Ga0501071_0357117
1093 Ga0501072_0096013
1094 Ga0501075_0233225
1095 Ga0501075_0338982
1096 Ga0501076_0320939
1097 Ga0501076_0520490
1098 Ga0501077_0152970
1099 Ga0501260_014972
1100 Ga0501079_0342387
1101 Ga0501080_0418396
1102 Ga0501081_0086711
1103 Ga0501081_0182245
1104 Ga0501045_0102704
1105 Ga0501045_0195044
1106 Ga0501212_034328
1107 nmdc:mga0yw44_31865_c1
1108 nmdc:mga06z11_578593_c1
1109 nmdc:mga07m45_143336_c1
1110 nmdc:mga05p37_26969_c1
1111 nmdc:mga05p37_384294_c1
1112 nmdc:mga05p37_45361_c1
1113 nmdc:mga05p37_60267_c1
1114 nmdc:mga08y16_162164_c1
1115 nmdc:mga08y16_25778_c1
1116 nmdc:mga08y16_32993_c1
1117 nmdc:mga0n895_58993_c1
1118 nmdc:mga0rr50_32466_c1
1119 nmdc:mga08x19_392074_c1
1120 nmdc:mga0a205_37124_c1
1121 Ga0500635_0176068
1122 Ga0501084_0236824
1123 Ga0501084_0344745
1124 Ga0590075_019311
1125 Ga0501082_0154444
1126 Ga0530510_0146276
1127 Ga0530510_0278484
1128 2644626028
1129 2837270280
1130 2868090190
1131 2919449876
1132 3003000471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

17

207

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8341 1 195
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8221 1 195
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8209 1 195
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.82 1 196
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8191 1 197
ID Description Score Start End Superfamily
af_Q9N3L4_13_116_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8884 178 195 3.30.200.20
af_O59697_47_319_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8525 178 195 1.10.510.10
af_Q9VR61_559_650_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8309 178 195 3.30.200.20
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8244 1 195 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8221 1 195 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6L5FZ35-F1-model_v4 Dihydrofolate reductase 0.9741 1 198 GO:0008703
GO:0009231
AF-A0A7W1F9E0-F1-model_v4 Dihydrofolate reductase family protein 0.961 96 198 GO:0008703
GO:0009231
AF-A0A538AGP2-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.953 67 198 GO:0008703
GO:0009231
AF-A0A7W1F9E0-F1-model_v4 Dihydrofolate reductase family protein 0.952 96 198 GO:0008703
GO:0009231
AF-A0A538AGP2-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9392 67 198 GO:0008703
GO:0009231

Map