F464349

General Info

Members Datasets Scaffolds Average Seq Length
566 213 1132 69

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10199606|Ga0070681_101996062
Length 70
Sequence VVSGLIEAARFNMPYQADLCRMFLESHGIDAVVFDAQSYGYSEGAMVGVRVMVLDDDLDDARHALRDYEP

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
151 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
180 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.94
Rhizosphere 98.06
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10199606 3300005458 Bacteria 1919
2 MRS1b_contig_4604851 2162886011 Bacteria 814
3 JGI24741J21665_1010030 3300001915 Bacteria 1714
4 JGI24741J21665_1014349 3300001915 Bacteria 1327
5 JGI24746J21847_1006603 3300001977 Bacteria 1793
6 JGI24740J21852_10002740 3300001979 Bacteria 7875
7 JGI24740J21852_10020628 3300001979 Bacteria 2296
8 JGI24735J21928_10016800 3300002067 Bacteria 2265
9 JGI24735J21928_10022539 3300002067 Bacteria 1916
10 JGI24748J21848_1050787 3300002074 Bacteria 541
11 JGI24742J22300_10044137 3300002244 Bacteria 798
12 JGI24751J29686_10029978 3300002459 Bacteria 1129
13 JGI24751J29686_10114378 3300002459 Bacteria 566
14 Ga0065714_10489001 3300005288 Bacteria 530
15 Ga0065712_10309642 3300005290 Bacteria 834
16 Ga0065715_10006249 3300005293 Bacteria 3563
17 Ga0065715_10121365 3300005293 Bacteria 2232
18 Ga0070658_10000572 3300005327 Bacteria 32008
19 Ga0070658_10078340 3300005327 Bacteria 2712
20 Ga0070658_10679536 3300005327 Unclassified 893
21 Ga0070658_11440993 3300005327 Bacteria 597
22 Ga0070658_11983308 3300005327 Bacteria 502
23 Ga0070676_10024463 3300005328 Bacteria 3402
24 Ga0070683_100008839 3300005329 Bacteria 8573
25 Ga0070683_100626298 3300005329 Bacteria 1030
26 Ga0070683_100637141 3300005329 Bacteria 1020
27 Ga0070690_100124913 3300005330 Bacteria 1731
28 Ga0070670_100002173 3300005331 Bacteria 16112
29 Ga0070670_100007258 3300005331 Bacteria 9393
30 Ga0070670_100957772 3300005331 Bacteria 777
31 Ga0070677_10002063 3300005333 Bacteria 6400
32 Ga0070680_100006573 3300005336 Bacteria 8841
33 Ga0070680_100012920 3300005336 Bacteria 6494
34 Ga0070680_100036275 3300005336 Bacteria 3983
35 Ga0070680_100105083 3300005336 Bacteria 2347
36 Ga0070680_100193850 3300005336 Bacteria 1713
37 Ga0070680_100463735 3300005336 Bacteria 1082
38 Ga0070682_100092978 3300005337 Bacteria 1977
39 Ga0070660_100001537 3300005339 Bacteria 15849
40 Ga0070660_100139436 3300005339 Bacteria 1944
41 Ga0070660_100172064 3300005339 Bacteria 1749
42 Ga0070660_100867166 3300005339 Bacteria 760
43 Ga0070660_101454126 3300005339 Bacteria 582
44 Ga0070689_100293334 3300005340 Bacteria 1352
45 Ga0070661_100113707 3300005344 Bacteria 2023
46 Ga0070661_100323468 3300005344 Bacteria 1205
47 Ga0070661_100521051 3300005344 Bacteria 953
48 Ga0070661_100571239 3300005344 Bacteria 912
49 Ga0070692_10059291 3300005345 Bacteria 2012
50 Ga0070692_10984747 3300005345 Bacteria 589
51 Ga0070668_100002909 3300005347 Bacteria 12652
52 Ga0070668_100042624 3300005347 Bacteria 3479
53 Ga0070669_100001630 3300005353 Bacteria 16233
54 Ga0070669_100825194 3300005353 Bacteria 789
55 Ga0070675_100016149 3300005354 Bacteria 5920
56 Ga0070671_100025246 3300005355 Bacteria 4875
57 Ga0070671_100112880 3300005355 Bacteria 2283
58 Ga0070674_100004925 3300005356 Bacteria 7653
59 Ga0070673_100033831 3300005364 Bacteria 3862
60 Ga0070688_101444383 3300005365 Bacteria 558
61 Ga0070659_100018567 3300005366 Bacteria 5248
62 Ga0070659_100098857 3300005366 Bacteria 2347
63 Ga0070659_100229248 3300005366 Bacteria 1535
64 Ga0070667_100017583 3300005367 Bacteria 5925
65 Ga0070667_100065068 3300005367 Bacteria 3095
66 Ga0070709_11317878 3300005434 Bacteria 583
67 Ga0070714_100060486 3300005435 Bacteria 3251
68 Ga0070714_100061020 3300005435 Bacteria 3237
69 Ga0070714_100504625 3300005435 Bacteria 1154
70 Ga0070714_101176365 3300005435 Bacteria 748
71 Ga0070713_100610087 3300005436 Bacteria 1037
72 Ga0070713_101071106 3300005436 Unclassified 779
73 Ga0070701_10099451 3300005438 Bacteria 1608
74 Ga0070705_100448663 3300005440 Bacteria 967
75 Ga0070705_100713414 3300005440 Bacteria 789
76 Ga0070663_100000033 3300005455 Bacteria 71453
77 Ga0070663_100135939 3300005455 Bacteria 1872
78 Ga0070663_100433134 3300005455 Bacteria 1081
79 Ga0070663_100462269 3300005455 Bacteria 1048
80 Ga0070663_100498867 3300005455 Bacteria 1010
81 Ga0070663_100950675 3300005455 Bacteria 745
82 Ga0070678_100015044 3300005456 Bacteria 4903
83 Ga0070662_100001025 3300005457 Bacteria 17087
84 Ga0070662_100106522 3300005457 Bacteria 2130
85 Ga0070662_100321504 3300005457 Bacteria 1262
86 Ga0070681_10025252 3300005458 Bacteria 5976
87 Ga0070681_10047991 3300005458 Bacteria 4267
88 Ga0070681_10054443 3300005458 Bacteria 3987
89 Ga0070681_10346235 3300005458 Bacteria 1396
90 Ga0068867_100061891 3300005459 Bacteria 2780
91 Ga0070679_100001358 3300005530 Bacteria 21597
92 Ga0070679_100071021 3300005530 Bacteria 3472
93 Ga0070679_100500933 3300005530 Bacteria 1158
94 Ga0070679_100674236 3300005530 Bacteria 976
95 Ga0070679_100820058 3300005530 Bacteria 873
96 Ga0070679_100951740 3300005530 Bacteria 802
97 Ga0070679_102084351 3300005530 Bacteria 516
98 Ga0070684_100011066 3300005535 Bacteria 7176
99 Ga0070684_101599592 3300005535 Bacteria 615
100 Ga0068853_100231832 3300005539 Bacteria 1689
101 Ga0068853_100402799 3300005539 Bacteria 1281
102 Ga0068853_101951757 3300005539 Bacteria 569
103 Ga0070672_100037750 3300005543 Bacteria 3687
104 Ga0070695_100640509 3300005545 Bacteria 838
105 Ga0070695_101658514 3300005545 Bacteria 534
106 Ga0070696_100067516 3300005546 Bacteria 2510
107 Ga0070693_100125459 3300005547 Bacteria 1598
108 Ga0070693_100861341 3300005547 Bacteria 676
109 Ga0070665_101536706 3300005548 Bacteria 674
110 Ga0068855_100000660 3300005563 Bacteria 42200
111 Ga0068855_101042491 3300005563 Bacteria 857
112 Ga0068855_101097870 3300005563 Bacteria 832
113 Ga0070664_100061549 3300005564 Bacteria 3199
114 Ga0070664_100076486 3300005564 Bacteria 2876
115 Ga0070664_100390234 3300005564 Bacteria 1272
116 Ga0070664_101156294 3300005564 Bacteria 729
117 Ga0068857_100009347 3300005577 Bacteria 8511
118 Ga0068857_100130092 3300005577 Bacteria 2270
119 Ga0068857_101039318 3300005577 Bacteria 789
120 Ga0068854_100019582 3300005578 Bacteria 4564
121 Ga0068854_100126228 3300005578 Bacteria 1949
122 Ga0068854_100200970 3300005578 Bacteria 1567
123 Ga0068854_100301978 3300005578 Bacteria 1295
124 Ga0068854_100442538 3300005578 Bacteria 1084
125 Ga0068856_100003322 3300005614 Bacteria 16341
126 Ga0068856_100109689 3300005614 Bacteria 2756
127 Ga0068856_100216321 3300005614 Bacteria 1931
128 Ga0068856_100275939 3300005614 Bacteria 1697
129 Ga0068856_100632457 3300005614 Bacteria 1091
130 Ga0068856_100978691 3300005614 Bacteria 864
131 Ga0068856_100993629 3300005614 Bacteria 857
132 Ga0068856_101080852 3300005614 Bacteria 820
133 Ga0068852_100062025 3300005616 Bacteria 3250
134 Ga0068852_100071755 3300005616 Bacteria 3042
135 Ga0068852_100088094 3300005616 Bacteria 2771
136 Ga0068852_100147842 3300005616 Bacteria 2181
137 Ga0068852_100388384 3300005616 Bacteria 1370
138 Ga0068852_100416912 3300005616 Bacteria 1324
139 Ga0068859_100048164 3300005617 Bacteria 4282
140 Ga0068859_100182532 3300005617 Bacteria 2181
141 Ga0068864_100004705 3300005618 Bacteria 11194
142 Ga0068864_100328793 3300005618 Bacteria 1437
143 Ga0068864_101432648 3300005618 Bacteria 693
144 Ga0068861_100011789 3300005719 Bacteria 6083
145 Ga0068851_10027270 3300005834 Bacteria 2814
146 Ga0068851_10082008 3300005834 Bacteria 1686
147 Ga0068851_10099547 3300005834 Bacteria 1541
148 Ga0068851_10376441 3300005834 Bacteria 831
149 Ga0068863_100011027 3300005841 Bacteria 8767
150 Ga0068858_100179298 3300005842 Bacteria 2000
151 Ga0068860_100069187 3300005843 Bacteria 3355
152 Ga0068860_101410687 3300005843 Bacteria 718
153 Ga0068862_100055996 3300005844 Bacteria 3378
154 Ga0068862_100087678 3300005844 Bacteria 2707
155 Ga0068862_100093663 3300005844 Bacteria 2620
156 Ga0068862_100539358 3300005844 Bacteria 1113
157 Ga0097621_100086047 3300006237 Bacteria 2622
158 Ga0097621_100638684 3300006237 Bacteria 976
159 Ga0068871_100014538 3300006358 Bacteria 5871
160 Ga0075431_100006645 3300006847 Bacteria 11486
161 Ga0075433_10738272 3300006852 Bacteria 861
162 Ga0075434_102129928 3300006871 Bacteria 565
163 Ga0097620_100048164 3300006931 Bacteria 4282
164 Ga0097620_100182552 3300006931 Bacteria 2181
165 Ga0075435_101526289 3300007076 Bacteria 586
166 Ga0105251_10053026 3300009011 Bacteria 1929
167 Ga0105240_10191521 3300009093 Bacteria 2404
168 Ga0111539_10124772 3300009094 Bacteria 3017
169 Ga0111539_10233048 3300009094 Bacteria 2144
170 Ga0105247_11408195 3300009101 Bacteria 564
171 Ga0105243_10155918 3300009148 Bacteria 1963
172 Ga0105241_10092429 3300009174 Bacteria 2389
173 Ga0105241_11232309 3300009174 Bacteria 710
174 Ga0105241_11559260 3300009174 Bacteria 638
175 Ga0105248_10214889 3300009177 Bacteria 2166
176 Ga0105237_10289053 3300009545 Bacteria 1642
177 Ga0105237_10709461 3300009545 Unclassified 1012
178 Ga0105238_10163079 3300009551 Bacteria 2205
179 Ga0105249_10186903 3300009553 Bacteria 2019
180 Ga0157373_10170173 3300013100 Bacteria 1533
181 Ga0157373_10192405 3300013100 Bacteria 1437
182 Ga0157373_10258987 3300013100 Bacteria 1231
183 Ga0157373_10314856 3300013100 Bacteria 1112
184 Ga0157373_10417530 3300013100 Bacteria 963
185 Ga0157371_10117626 3300013102 Bacteria 1889
186 Ga0157371_10178201 3300013102 Bacteria 1520
187 Ga0157371_10414658 3300013102 Bacteria 987
188 Ga0157371_10924712 3300013102 Bacteria 662
189 Ga0157371_10968943 3300013102 Bacteria 648
190 Ga0157370_10024570 3300013104 Bacteria 5968
191 Ga0157370_10096893 3300013104 Bacteria 2767
192 Ga0157370_10109163 3300013104 Bacteria 2586
193 Ga0157370_10224147 3300013104 Bacteria 1741
194 Ga0157370_10230568 3300013104 Bacteria 1714
195 Ga0157369_10007317 3300013105 Bacteria 12709
196 Ga0157369_10029336 3300013105 Bacteria 6080
197 Ga0157369_10064994 3300013105 Bacteria 3929
198 Ga0157369_10145163 3300013105 Bacteria 2509
199 Ga0157369_10247187 3300013105 Bacteria 1862
200 Ga0157369_10299021 3300013105 Bacteria 1674
201 Ga0157369_10990247 3300013105 Bacteria 861
202 Ga0157374_10575414 3300013296 Bacteria 1135
203 Ga0157378_12599682 3300013297 Bacteria 558
204 Ga0163162_12264637 3300013306 Bacteria 624
205 Ga0157372_10195110 3300013307 Bacteria 2346
206 Ga0157372_10199715 3300013307 Bacteria 2316
207 Ga0157372_10282591 3300013307 Bacteria 1930
208 Ga0157372_12854115 3300013307 Bacteria 554
209 Ga0157375_10400538 3300013308 Bacteria 1539
210 Ga0163163_10186432 3300014325 Bacteria 2122
211 Ga0163163_12878440 3300014325 Bacteria 537
212 Ga0157380_10004717 3300014326 Bacteria 9487
213 Ga0157380_10030698 3300014326 Bacteria 4118
214 Ga0157380_10077402 3300014326 Bacteria 2711
215 Ga0157380_10354506 3300014326 Bacteria 1374
216 Ga0157380_12389800 3300014326 Bacteria 594
217 Ga0182008_10044086 3300014497 Bacteria 2219
218 Ga0182008_10733191 3300014497 Bacteria 567
219 Ga0157379_10011600 3300014968 Bacteria 7696
220 Ga0163161_10103286 3300017792 Bacteria 2124
221 Ga0206356_10638853 3300020070 Bacteria 1539
222 Ga0206354_11551980 3300020081 Bacteria 1083
223 Ga0206353_11134231 3300020082 Bacteria 1442
224 Ga0206353_11423275 3300020082 Bacteria 1646
225 Ga0207673_1027743 3300025290 Bacteria 779
226 Ga0207697_10011497 3300025315 Bacteria 3742
227 Ga0207656_10028971 3300025321 Bacteria 2277
228 Ga0207656_10418056 3300025321 Bacteria 675
229 Ga0207682_10002054 3300025893 Bacteria 9109
230 Ga0207688_10223107 3300025901 Bacteria 1136
231 Ga0207647_10000736 3300025904 Bacteria 25695
232 Ga0207647_10019133 3300025904 Bacteria 4610
233 Ga0207647_10127277 3300025904 Bacteria 1499
234 Ga0207647_10581030 3300025904 Bacteria 619
235 Ga0207645_10034475 3300025907 Bacteria 3253
236 Ga0207705_10000067 3300025909 Bacteria 136004
237 Ga0207705_10006793 3300025909 Bacteria 8452
238 Ga0207705_10043093 3300025909 Bacteria 3241
239 Ga0207705_10077104 3300025909 Bacteria 2424
240 Ga0207705_10363521 3300025909 Bacteria 1116
241 Ga0207705_10400056 3300025909 Bacteria 1062
242 Ga0207705_10611245 3300025909 Bacteria 848
243 Ga0207707_10015587 3300025912 Bacteria 6621
244 Ga0207707_10030878 3300025912 Bacteria 4687
245 Ga0207707_10581586 3300025912 Bacteria 949
246 Ga0207707_10660540 3300025912 Unclassified 880
247 Ga0207707_10951760 3300025912 Bacteria 707
248 Ga0207695_10305103 3300025913 Bacteria 1483
249 Ga0207671_10143796 3300025914 Bacteria 1839
250 Ga0207671_10323654 3300025914 Unclassified 1220
251 Ga0207660_10000789 3300025917 Bacteria 20979
252 Ga0207660_10001211 3300025917 Bacteria 17251
253 Ga0207660_10108916 3300025917 Bacteria 2081
254 Ga0207660_10298905 3300025917 Bacteria 1281
255 Ga0207660_10345635 3300025917 Bacteria 1191
256 Ga0207660_10952920 3300025917 Bacteria 700
257 Ga0207662_10024441 3300025918 Bacteria 3477
258 Ga0207657_10000346 3300025919 Bacteria 49145
259 Ga0207657_10002136 3300025919 Bacteria 21417
260 Ga0207657_10008025 3300025919 Bacteria 10765
261 Ga0207657_10050634 3300025919 Bacteria 3614
262 Ga0207657_10119910 3300025919 Bacteria 2165
263 Ga0207649_10054470 3300025920 Bacteria 2489
264 Ga0207649_10111616 3300025920 Bacteria 1827
265 Ga0207649_10180753 3300025920 Bacteria 1476
266 Ga0207649_10231613 3300025920 Bacteria 1321
267 Ga0207652_10000527 3300025921 Bacteria 38846
268 Ga0207652_10042876 3300025921 Bacteria 3852
269 Ga0207652_10323523 3300025921 Bacteria 1392
270 Ga0207652_10628709 3300025921 Bacteria 961
271 Ga0207652_10766307 3300025921 Bacteria 858
272 Ga0207652_11728065 3300025921 Bacteria 530
273 Ga0207681_10008780 3300025923 Bacteria 6174
274 Ga0207681_10747023 3300025923 Bacteria 815
275 Ga0207681_11545510 3300025923 Bacteria 556
276 Ga0207694_10809631 3300025924 Bacteria 791
277 Ga0207650_10009879 3300025925 Bacteria 6527
278 Ga0207650_10187959 3300025925 Bacteria 1649
279 Ga0207650_10314380 3300025925 Bacteria 1282
280 Ga0207659_10010123 3300025926 Bacteria 5912
281 Ga0207700_10483331 3300025928 Bacteria 1094
282 Ga0207700_10488283 3300025928 Unclassified 1089
283 Ga0207664_10054015 3300025929 Bacteria 3182
284 Ga0207664_10203114 3300025929 Bacteria 1712
285 Ga0207664_10567648 3300025929 Bacteria 1018
286 Ga0207664_11230718 3300025929 Bacteria 667
287 Ga0207644_10027473 3300025931 Bacteria 3930
288 Ga0207644_10130742 3300025931 Bacteria 1921
289 Ga0207690_10037643 3300025932 Bacteria 3142
290 Ga0207690_10052119 3300025932 Bacteria 2740
291 Ga0207706_10001052 3300025933 Bacteria 28061
292 Ga0207706_10092373 3300025933 Bacteria 2661
293 Ga0207706_10140375 3300025933 Bacteria 2125
294 Ga0207709_10074778 3300025935 Bacteria 2163
295 Ga0207670_10252787 3300025936 Bacteria 1363
296 Ga0207669_10470767 3300025937 Bacteria 999
297 Ga0207691_10048680 3300025940 Bacteria 3885
298 Ga0207711_10479986 3300025941 Bacteria 1158
299 Ga0207689_11061568 3300025942 Bacteria 683
300 Ga0207661_10005831 3300025944 Bacteria 8687
301 Ga0207661_10385697 3300025944 Bacteria 1269
302 Ga0207679_10340523 3300025945 Bacteria 1304
303 Ga0207679_10443379 3300025945 Bacteria 1150
304 Ga0207679_11430407 3300025945 Bacteria 634
305 Ga0207667_10003664 3300025949 Bacteria 18944
306 Ga0207667_10020763 3300025949 Bacteria 7296
307 Ga0207667_10888228 3300025949 Bacteria 884
308 Ga0207712_10196566 3300025961 Bacteria 1596
309 Ga0207668_10001211 3300025972 Bacteria 15317
310 Ga0207668_10106193 3300025972 Bacteria 2097
311 Ga0207668_11495743 3300025972 Unclassified 609
312 Ga0207640_10044770 3300025981 Bacteria 2838
313 Ga0207640_10086852 3300025981 Bacteria 2155
314 Ga0207640_10108382 3300025981 Bacteria 1963
315 Ga0207640_10385969 3300025981 Bacteria 1136
316 Ga0207640_10775644 3300025981 Bacteria 828
317 Ga0207640_11975790 3300025981 Unclassified 528
318 Ga0207658_10310148 3300025986 Bacteria 1362
319 Ga0207658_11034645 3300025986 Bacteria 749
320 Ga0207703_10259458 3300026035 Bacteria 1570
321 Ga0207639_10178703 3300026041 Bacteria 1803
322 Ga0207639_10591739 3300026041 Bacteria 1022
323 Ga0207639_11196727 3300026041 Bacteria 713
324 Ga0207678_10001292 3300026067 Bacteria 23171
325 Ga0207678_10048448 3300026067 Bacteria 3673
326 Ga0207678_10123621 3300026067 Bacteria 2208
327 Ga0207678_10169604 3300026067 Bacteria 1863
328 Ga0207678_10194079 3300026067 Bacteria 1736
329 Ga0207678_10431473 3300026067 Bacteria 1144
330 Ga0207702_10018032 3300026078 Bacteria 5841
331 Ga0207702_10034068 3300026078 Bacteria 4255
332 Ga0207702_10039707 3300026078 Bacteria 3945
333 Ga0207702_10114724 3300026078 Bacteria 2401
334 Ga0207702_10222258 3300026078 Bacteria 1760
335 Ga0207702_11019801 3300026078 Bacteria 821
336 Ga0207641_10028901 3300026088 Bacteria 4582
337 Ga0207648_10081775 3300026089 Bacteria 2817
338 Ga0207676_10009108 3300026095 Bacteria 7070
339 Ga0207676_10406005 3300026095 Bacteria 1274
340 Ga0207676_11316458 3300026095 Bacteria 717
341 Ga0207676_11664433 3300026095 Bacteria 636
342 Ga0207674_10000284 3300026116 Bacteria 64099
343 Ga0207674_10009227 3300026116 Bacteria 11305
344 Ga0207675_100018165 3300026118 Bacteria 6557
345 Ga0207683_10007764 3300026121 Bacteria 9179
346 Ga0207698_10065291 3300026142 Bacteria 2857
347 Ga0207698_10078874 3300026142 Bacteria 2646
348 Ga0207698_10088511 3300026142 Bacteria 2525
349 Ga0207698_10136688 3300026142 Bacteria 2104
350 Ga0207698_10163266 3300026142 Bacteria 1951
351 Ga0207698_11177003 3300026142 Bacteria 780
352 Ga0268265_10004491 3300028380 Bacteria 9660
353 Ga0268265_10407790 3300028380 Bacteria 1258
354 Ga0268265_11889590 3300028380 Bacteria 604
355 Ga0268264_10094928 3300028381 Bacteria 2579
356 Ga0268264_10755609 3300028381 Bacteria 969
357 Ga0316176_1127325 3300030732 Bacteria 809
358 Ga0316182_1378764 3300030745 Bacteria 1778
359 Ga0307408_100202627 3300031548 Bacteria 1607
360 Ga0307408_100228786 3300031548 Bacteria 1521
361 Ga0307408_100268877 3300031548 Bacteria 1414
362 Ga0307408_100335058 3300031548 Bacteria 1279
363 Ga0307408_100658294 3300031548 Bacteria 937
364 Ga0307408_101031868 3300031548 Bacteria 759
365 Ga0307408_102068741 3300031548 Bacteria 548
366 Ga0307405_10155244 3300031731 Bacteria 1614
367 Ga0307405_10315143 3300031731 Bacteria 1192
368 Ga0307405_10372740 3300031731 Bacteria 1108
369 Ga0307405_10432895 3300031731 Bacteria 1038
370 Ga0307405_10472082 3300031731 Bacteria 999
371 Ga0307405_10509141 3300031731 Bacteria 966
372 Ga0307405_10733468 3300031731 Bacteria 821
373 Ga0307405_11144384 3300031731 Bacteria 671
374 Ga0307405_11455586 3300031731 Bacteria 600
375 Ga0307413_10077145 3300031824 Bacteria 2120
376 Ga0307413_10085788 3300031824 Bacteria 2034
377 Ga0307413_10106323 3300031824 Bacteria 1867
378 Ga0307413_10274757 3300031824 Bacteria 1263
379 Ga0307413_10410591 3300031824 Bacteria 1063
380 Ga0307413_10655529 3300031824 Bacteria 866
381 Ga0307413_10681879 3300031824 Bacteria 851
382 Ga0307413_10734712 3300031824 Bacteria 823
383 Ga0307410_10000367 3300031852 Bacteria 17606
384 Ga0307410_10049477 3300031852 Bacteria 2822
385 Ga0307410_10202126 3300031852 Bacteria 1517
386 Ga0307410_10204501 3300031852 Bacteria 1509
387 Ga0307410_10500719 3300031852 Bacteria 999
388 Ga0307410_10570130 3300031852 Bacteria 940
389 Ga0307410_10615406 3300031852 Bacteria 907
390 Ga0307410_10702609 3300031852 Bacteria 852
391 Ga0307410_10733035 3300031852 Bacteria 835
392 Ga0307410_11075266 3300031852 Bacteria 696
393 Ga0307410_11303193 3300031852 Bacteria 635
394 Ga0307410_11321628 3300031852 Bacteria 631
395 Ga0307406_10078333 3300031901 Bacteria 2189
396 Ga0307406_10192094 3300031901 Bacteria 1495
397 Ga0307406_10228994 3300031901 Bacteria 1387
398 Ga0307406_10288329 3300031901 Bacteria 1255
399 Ga0307406_11813774 3300031901 Bacteria 542
400 Ga0307406_11864282 3300031901 Bacteria 535
401 Ga0307406_11923341 3300031901 Bacteria 528
402 Ga0307407_10020440 3300031903 Bacteria 3393
403 Ga0307407_10092805 3300031903 Bacteria 1855
404 Ga0307407_10105566 3300031903 Bacteria 1757
405 Ga0307407_10194125 3300031903 Bacteria 1356
406 Ga0307407_10499346 3300031903 Bacteria 891
407 Ga0307407_10508697 3300031903 Bacteria 884
408 Ga0307407_10742478 3300031903 Bacteria 742
409 Ga0307407_11313917 3300031903 Bacteria 568
410 Ga0307412_10014875 3300031911 Bacteria 4599
411 Ga0307412_10088107 3300031911 Bacteria 2164
412 Ga0307412_10092454 3300031911 Bacteria 2120
413 Ga0307412_10113658 3300031911 Bacteria 1937
414 Ga0307412_10150954 3300031911 Bacteria 1714
415 Ga0307412_10159755 3300031911 Bacteria 1673
416 Ga0307412_10327566 3300031911 Bacteria 1221
417 Ga0307412_10427021 3300031911 Bacteria 1085
418 Ga0307412_10437039 3300031911 Bacteria 1074
419 Ga0307412_10674180 3300031911 Bacteria 884
420 Ga0307412_10871012 3300031911 Bacteria 787
421 Ga0307412_11236181 3300031911 Bacteria 670
422 Ga0307412_11411614 3300031911 Bacteria 630
423 Ga0307412_11584593 3300031911 Bacteria 597
424 Ga0307412_11718104 3300031911 Bacteria 575
425 Ga0307409_100075284 3300031995 Bacteria 2702
426 Ga0307409_100229934 3300031995 Bacteria 1680
427 Ga0307409_100234042 3300031995 Bacteria 1667
428 Ga0307409_100292394 3300031995 Bacteria 1511
429 Ga0307409_100586978 3300031995 Bacteria 1099
430 Ga0307409_101388849 3300031995 Bacteria 728
431 Ga0307409_101596653 3300031995 Bacteria 680
432 Ga0307409_101610550 3300031995 Bacteria 677
433 Ga0307416_100308948 3300032002 Bacteria 1576
434 Ga0307416_100710293 3300032002 Bacteria 1095
435 Ga0307416_101383045 3300032002 Bacteria 809
436 Ga0307416_101954560 3300032002 Bacteria 689
437 Ga0307416_102109543 3300032002 Bacteria 665
438 Ga0307416_102707141 3300032002 Bacteria 592
439 Ga0307416_103241513 3300032002 Bacteria 544
440 Ga0307416_103869925 3300032002 Bacteria 501
441 Ga0307414_10003487 3300032004 Bacteria 8405
442 Ga0307414_10074874 3300032004 Bacteria 2455
443 Ga0307414_10167099 3300032004 Bacteria 1754
444 Ga0307414_10177521 3300032004 Bacteria 1709
445 Ga0307414_10314520 3300032004 Bacteria 1330
446 Ga0307414_10333259 3300032004 Bacteria 1296
447 Ga0307414_10746809 3300032004 Bacteria 889
448 Ga0307414_10785384 3300032004 Bacteria 867
449 Ga0307414_10791433 3300032004 Bacteria 864
450 Ga0307414_10852154 3300032004 Bacteria 833
451 Ga0307414_11234984 3300032004 Bacteria 692
452 Ga0307414_11413504 3300032004 Bacteria 647
453 Ga0307414_11431862 3300032004 Bacteria 642
454 Ga0307414_11729824 3300032004 Bacteria 583
455 Ga0307414_11888292 3300032004 Bacteria 557
456 Ga0307414_11975447 3300032004 Bacteria 544
457 Ga0307414_12256516 3300032004 Bacteria 508
458 Ga0307411_10003566 3300032005 Bacteria 7249
459 Ga0307411_10003832 3300032005 Bacteria 7078
460 Ga0307411_10022730 3300032005 Bacteria 3699
461 Ga0307411_10041184 3300032005 Bacteria 2936
462 Ga0307411_10062116 3300032005 Bacteria 2490
463 Ga0307411_10088159 3300032005 Bacteria 2157
464 Ga0307411_10297780 3300032005 Bacteria 1292
465 Ga0307411_10829324 3300032005 Bacteria 816
466 Ga0307411_10964542 3300032005 Bacteria 761
467 Ga0307411_10998016 3300032005 Bacteria 749
468 Ga0307411_11807783 3300032005 Bacteria 567
469 Ga0307411_11979817 3300032005 Bacteria 543
470 Ga0307415_100013154 3300032126 Bacteria 4819
471 Ga0307415_100081806 3300032126 Bacteria 2308
472 Ga0307415_100115010 3300032126 Bacteria 2004
473 Ga0307415_100215258 3300032126 Bacteria 1536
474 Ga0307415_100231954 3300032126 Bacteria 1487
475 Ga0307415_100450890 3300032126 Bacteria 1112
476 Ga0307415_100558747 3300032126 Bacteria 1011
477 Ga0307415_101107757 3300032126 Bacteria 741
478 Ga0307415_101472282 3300032126 Bacteria 650
479 Ga0307415_102055896 3300032126 Bacteria 557
480 Ga0373923_0016944 3300035111 Bacteria 2779
481 Ga0373953_0264503 3300035117 Bacteria 748
482 Ga0373954_0011568 3300035118 Bacteria 3913
483 Ga0373956_0116098 3300035119 Unclassified 1248
484 Ga0373957_0169664 3300035120 Unclassified 901
485 Ga0373955_0004824 3300035172 Bacteria 6009
486 Ga0373933_0038989 3300035724 Bacteria 2794
487 Ga0373937_0002354 3300036401 Bacteria 15753
488 Ga0395899_0001516 3300037312 Bacteria 19629
489 Ga0395899_0047069 3300037312 Bacteria 3211
490 Ga0395899_0406231 3300037312 Bacteria 900
491 Ga0395899_0628609 3300037312 Bacteria 681
492 Ga0395900_0000731 3300037418 Bacteria 43691
493 Ga0395900_0002620 3300037418 Bacteria 19629
494 Ga0395900_0137662 3300037418 Bacteria 2502
495 Ga0395900_0250580 3300037418 Bacteria 1772
496 Ga0395900_0273608 3300037418 Bacteria 1683
497 Ga0395900_0394171 3300037418 Bacteria 1350
498 Ga0395898_0008080 3300037466 Bacteria 11145
499 Ga0395898_0061652 3300037466 Bacteria 3644
500 Ga0395898_0724909 3300037466 Bacteria 936
501 Ga0395898_1407708 3300037466 Bacteria 625
502 Ga0395905_0000383 3300037471 Bacteria 63049
503 Ga0395905_0000801 3300037471 Bacteria 41315
504 Ga0395905_0001753 3300037471 Bacteria 25334
505 Ga0395905_0019060 3300037471 Bacteria 6508
506 Ga0395905_0074142 3300037471 Bacteria 3189
507 Ga0395905_0237430 3300037471 Bacteria 1704
508 Ga0395905_0314800 3300037471 Bacteria 1454
509 Ga0395905_1409144 3300037471 Bacteria 601
510 Ga0395901_0000677 3300038443 Bacteria 39201
511 Ga0395901_0002295 3300038443 Bacteria 19494
512 Ga0395901_0184331 3300038443 Bacteria 2189
513 Ga0395901_1173665 3300038443 Bacteria 735
514 Ga0395901_1302550 3300038443 Bacteria 688
515 Ga0439436_0253699 3300041404 Bacteria 511
516 Ga0439449_0072638 3300042007 Bacteria 1268
517 Ga0450912_001651 3300042116 Bacteria 1400
518 Ga0450890_044980 3300042127 Bacteria 662
519 Ga0466963_0151773 3300044694 Bacteria 1609
520 Ga0495585_0138134 3300046492 Bacteria 1278
521 Ga0495596_0035249 3300046500 Bacteria 1985
522 Ga0495596_0386781 3300046500 Bacteria 545
523 Ga0495663_0004162 3300046525 Bacteria 4090
524 Ga0495663_0017872 3300046525 Bacteria 2015
525 Ga0495663_0058046 3300046525 Bacteria 1212
526 Ga0495663_0150887 3300046525 Bacteria 793
527 Ga0495642_0090645 3300046528 Bacteria 1294
528 Ga0495598_0007610 3300046537 Bacteria 2492
529 Ga0495621_0003427 3300046539 Bacteria 4382
530 Ga0495621_0044811 3300046539 Bacteria 1564
531 Ga0495621_0073377 3300046539 Bacteria 1264
532 Ga0495633_0280280 3300046558 Bacteria 758
533 Ga0495633_0354298 3300046558 Bacteria 665
534 Ga0495659_0055644 3300046664 Bacteria 1450
535 Ga0495659_0144906 3300046664 Bacteria 950
536 Ga0495661_0164978 3300046665 Bacteria 1186
537 Ga0495623_0001974 3300046679 Bacteria 13778
538 Ga0495669_0153886 3300046684 Bacteria 1089
539 Ga0495669_0287000 3300046684 Bacteria 792
540 Ga0495670_0141232 3300046691 Unclassified 1259
541 Ga0495670_0163477 3300046691 Bacteria 1170
542 Ga0495670_0394405 3300046691 Bacteria 747
543 Ga0495670_0415642 3300046691 Bacteria 727
544 Ga0495670_0445670 3300046691 Bacteria 701
545 Ga0495636_0526389 3300047318 Bacteria 573
546 Ga0495677_0391185 3300047445 Bacteria 550
547 Ga0495685_046528 3300047447 Bacteria 1476
548 Ga0495602_0026366 3300048088 Bacteria 5606
549 Ga0495615_0061519 3300048090 Bacteria 992
550 Ga0496102_0018756 3300048905 Bacteria 6084
551 Ga0496104_0050059 3300048907 Bacteria 3942
552 Ga0496106_0059457 3300048909 Bacteria 2895
553 Ga0496107_0161909 3300048910 Bacteria 1658
554 Ga0496108_0004150 3300048911 Bacteria 11653
555 Ga0496109_0008253 3300048912 Bacteria 8844
556 Ga0496109_0319940 3300048912 Bacteria 1464
557 Ga0496110_0056994 3300048913 Bacteria 3438
558 Ga0496111_0015950 3300048914 Bacteria 5168
559 Ga0496112_0149318 3300048915 Bacteria 2304
560 Ga0496113_0027515 3300048916 Bacteria 4077
561 Ga0501067_0143959 3300049583 Bacteria 1328
562 Ga0501268_046086 3300049765 Unclassified 833
563 nmdc:mga06r32_1572_c1 3300050510 Bacteria 20565
564 nmdc:mga08y16_1109987_c1 3300050511 Bacteria 765
565 nmdc:mga08y16_933838_c1 3300050511 Bacteria 852
566 Ga0495612_0104207 3300053078 Bacteria 1210
567 Ga0070681_10199606
568 MRS1b_contig_4604851
569 JGI24741J21665_1010030
570 JGI24741J21665_1014349
571 JGI24746J21847_1006603
572 JGI24740J21852_10002740
573 JGI24740J21852_10020628
574 JGI24735J21928_10016800
575 JGI24735J21928_10022539
576 JGI24748J21848_1050787
577 JGI24742J22300_10044137
578 JGI24751J29686_10029978
579 JGI24751J29686_10114378
580 Ga0065714_10489001
581 Ga0065712_10309642
582 Ga0065715_10006249
583 Ga0065715_10121365
584 Ga0070658_10000572
585 Ga0070658_10078340
586 Ga0070658_10679536
587 Ga0070658_11440993
588 Ga0070658_11983308
589 Ga0070676_10024463
590 Ga0070683_100008839
591 Ga0070683_100626298
592 Ga0070683_100637141
593 Ga0070690_100124913
594 Ga0070670_100002173
595 Ga0070670_100007258
596 Ga0070670_100957772
597 Ga0070677_10002063
598 Ga0070680_100006573
599 Ga0070680_100012920
600 Ga0070680_100036275
601 Ga0070680_100105083
602 Ga0070680_100193850
603 Ga0070680_100463735
604 Ga0070682_100092978
605 Ga0070660_100001537
606 Ga0070660_100139436
607 Ga0070660_100172064
608 Ga0070660_100867166
609 Ga0070660_101454126
610 Ga0070689_100293334
611 Ga0070661_100113707
612 Ga0070661_100323468
613 Ga0070661_100521051
614 Ga0070661_100571239
615 Ga0070692_10059291
616 Ga0070692_10984747
617 Ga0070668_100002909
618 Ga0070668_100042624
619 Ga0070669_100001630
620 Ga0070669_100825194
621 Ga0070675_100016149
622 Ga0070671_100025246
623 Ga0070671_100112880
624 Ga0070674_100004925
625 Ga0070673_100033831
626 Ga0070688_101444383
627 Ga0070659_100018567
628 Ga0070659_100098857
629 Ga0070659_100229248
630 Ga0070667_100017583
631 Ga0070667_100065068
632 Ga0070709_11317878
633 Ga0070714_100060486
634 Ga0070714_100061020
635 Ga0070714_100504625
636 Ga0070714_101176365
637 Ga0070713_100610087
638 Ga0070713_101071106
639 Ga0070701_10099451
640 Ga0070705_100448663
641 Ga0070705_100713414
642 Ga0070663_100000033
643 Ga0070663_100135939
644 Ga0070663_100433134
645 Ga0070663_100462269
646 Ga0070663_100498867
647 Ga0070663_100950675
648 Ga0070678_100015044
649 Ga0070662_100001025
650 Ga0070662_100106522
651 Ga0070662_100321504
652 Ga0070681_10025252
653 Ga0070681_10047991
654 Ga0070681_10054443
655 Ga0070681_10346235
656 Ga0068867_100061891
657 Ga0070679_100001358
658 Ga0070679_100071021
659 Ga0070679_100500933
660 Ga0070679_100674236
661 Ga0070679_100820058
662 Ga0070679_100951740
663 Ga0070679_102084351
664 Ga0070684_100011066
665 Ga0070684_101599592
666 Ga0068853_100231832
667 Ga0068853_100402799
668 Ga0068853_101951757
669 Ga0070672_100037750
670 Ga0070695_100640509
671 Ga0070695_101658514
672 Ga0070696_100067516
673 Ga0070693_100125459
674 Ga0070693_100861341
675 Ga0070665_101536706
676 Ga0068855_100000660
677 Ga0068855_101042491
678 Ga0068855_101097870
679 Ga0070664_100061549
680 Ga0070664_100076486
681 Ga0070664_100390234
682 Ga0070664_101156294
683 Ga0068857_100009347
684 Ga0068857_100130092
685 Ga0068857_101039318
686 Ga0068854_100019582
687 Ga0068854_100126228
688 Ga0068854_100200970
689 Ga0068854_100301978
690 Ga0068854_100442538
691 Ga0068856_100003322
692 Ga0068856_100109689
693 Ga0068856_100216321
694 Ga0068856_100275939
695 Ga0068856_100632457
696 Ga0068856_100978691
697 Ga0068856_100993629
698 Ga0068856_101080852
699 Ga0068852_100062025
700 Ga0068852_100071755
701 Ga0068852_100088094
702 Ga0068852_100147842
703 Ga0068852_100388384
704 Ga0068852_100416912
705 Ga0068859_100048164
706 Ga0068859_100182532
707 Ga0068864_100004705
708 Ga0068864_100328793
709 Ga0068864_101432648
710 Ga0068861_100011789
711 Ga0068851_10027270
712 Ga0068851_10082008
713 Ga0068851_10099547
714 Ga0068851_10376441
715 Ga0068863_100011027
716 Ga0068858_100179298
717 Ga0068860_100069187
718 Ga0068860_101410687
719 Ga0068862_100055996
720 Ga0068862_100087678
721 Ga0068862_100093663
722 Ga0068862_100539358
723 Ga0097621_100086047
724 Ga0097621_100638684
725 Ga0068871_100014538
726 Ga0075431_100006645
727 Ga0075433_10738272
728 Ga0075434_102129928
729 Ga0097620_100048164
730 Ga0097620_100182552
731 Ga0075435_101526289
732 Ga0105251_10053026
733 Ga0105240_10191521
734 Ga0111539_10124772
735 Ga0111539_10233048
736 Ga0105247_11408195
737 Ga0105243_10155918
738 Ga0105241_10092429
739 Ga0105241_11232309
740 Ga0105241_11559260
741 Ga0105248_10214889
742 Ga0105237_10289053
743 Ga0105237_10709461
744 Ga0105238_10163079
745 Ga0105249_10186903
746 Ga0157373_10170173
747 Ga0157373_10192405
748 Ga0157373_10258987
749 Ga0157373_10314856
750 Ga0157373_10417530
751 Ga0157371_10117626
752 Ga0157371_10178201
753 Ga0157371_10414658
754 Ga0157371_10924712
755 Ga0157371_10968943
756 Ga0157370_10024570
757 Ga0157370_10096893
758 Ga0157370_10109163
759 Ga0157370_10224147
760 Ga0157370_10230568
761 Ga0157369_10007317
762 Ga0157369_10029336
763 Ga0157369_10064994
764 Ga0157369_10145163
765 Ga0157369_10247187
766 Ga0157369_10299021
767 Ga0157369_10990247
768 Ga0157374_10575414
769 Ga0157378_12599682
770 Ga0163162_12264637
771 Ga0157372_10195110
772 Ga0157372_10199715
773 Ga0157372_10282591
774 Ga0157372_12854115
775 Ga0157375_10400538
776 Ga0163163_10186432
777 Ga0163163_12878440
778 Ga0157380_10004717
779 Ga0157380_10030698
780 Ga0157380_10077402
781 Ga0157380_10354506
782 Ga0157380_12389800
783 Ga0182008_10044086
784 Ga0182008_10733191
785 Ga0157379_10011600
786 Ga0163161_10103286
787 Ga0206356_10638853
788 Ga0206354_11551980
789 Ga0206353_11134231
790 Ga0206353_11423275
791 Ga0207673_1027743
792 Ga0207697_10011497
793 Ga0207656_10028971
794 Ga0207656_10418056
795 Ga0207682_10002054
796 Ga0207688_10223107
797 Ga0207647_10000736
798 Ga0207647_10019133
799 Ga0207647_10127277
800 Ga0207647_10581030
801 Ga0207645_10034475
802 Ga0207705_10000067
803 Ga0207705_10006793
804 Ga0207705_10043093
805 Ga0207705_10077104
806 Ga0207705_10363521
807 Ga0207705_10400056
808 Ga0207705_10611245
809 Ga0207707_10015587
810 Ga0207707_10030878
811 Ga0207707_10581586
812 Ga0207707_10660540
813 Ga0207707_10951760
814 Ga0207695_10305103
815 Ga0207671_10143796
816 Ga0207671_10323654
817 Ga0207660_10000789
818 Ga0207660_10001211
819 Ga0207660_10108916
820 Ga0207660_10298905
821 Ga0207660_10345635
822 Ga0207660_10952920
823 Ga0207662_10024441
824 Ga0207657_10000346
825 Ga0207657_10002136
826 Ga0207657_10008025
827 Ga0207657_10050634
828 Ga0207657_10119910
829 Ga0207649_10054470
830 Ga0207649_10111616
831 Ga0207649_10180753
832 Ga0207649_10231613
833 Ga0207652_10000527
834 Ga0207652_10042876
835 Ga0207652_10323523
836 Ga0207652_10628709
837 Ga0207652_10766307
838 Ga0207652_11728065
839 Ga0207681_10008780
840 Ga0207681_10747023
841 Ga0207681_11545510
842 Ga0207694_10809631
843 Ga0207650_10009879
844 Ga0207650_10187959
845 Ga0207650_10314380
846 Ga0207659_10010123
847 Ga0207700_10483331
848 Ga0207700_10488283
849 Ga0207664_10054015
850 Ga0207664_10203114
851 Ga0207664_10567648
852 Ga0207664_11230718
853 Ga0207644_10027473
854 Ga0207644_10130742
855 Ga0207690_10037643
856 Ga0207690_10052119
857 Ga0207706_10001052
858 Ga0207706_10092373
859 Ga0207706_10140375
860 Ga0207709_10074778
861 Ga0207670_10252787
862 Ga0207669_10470767
863 Ga0207691_10048680
864 Ga0207711_10479986
865 Ga0207689_11061568
866 Ga0207661_10005831
867 Ga0207661_10385697
868 Ga0207679_10340523
869 Ga0207679_10443379
870 Ga0207679_11430407
871 Ga0207667_10003664
872 Ga0207667_10020763
873 Ga0207667_10888228
874 Ga0207712_10196566
875 Ga0207668_10001211
876 Ga0207668_10106193
877 Ga0207668_11495743
878 Ga0207640_10044770
879 Ga0207640_10086852
880 Ga0207640_10108382
881 Ga0207640_10385969
882 Ga0207640_10775644
883 Ga0207640_11975790
884 Ga0207658_10310148
885 Ga0207658_11034645
886 Ga0207703_10259458
887 Ga0207639_10178703
888 Ga0207639_10591739
889 Ga0207639_11196727
890 Ga0207678_10001292
891 Ga0207678_10048448
892 Ga0207678_10123621
893 Ga0207678_10169604
894 Ga0207678_10194079
895 Ga0207678_10431473
896 Ga0207702_10018032
897 Ga0207702_10034068
898 Ga0207702_10039707
899 Ga0207702_10114724
900 Ga0207702_10222258
901 Ga0207702_11019801
902 Ga0207641_10028901
903 Ga0207648_10081775
904 Ga0207676_10009108
905 Ga0207676_10406005
906 Ga0207676_11316458
907 Ga0207676_11664433
908 Ga0207674_10000284
909 Ga0207674_10009227
910 Ga0207675_100018165
911 Ga0207683_10007764
912 Ga0207698_10065291
913 Ga0207698_10078874
914 Ga0207698_10088511
915 Ga0207698_10136688
916 Ga0207698_10163266
917 Ga0207698_11177003
918 Ga0268265_10004491
919 Ga0268265_10407790
920 Ga0268265_11889590
921 Ga0268264_10094928
922 Ga0268264_10755609
923 Ga0316176_1127325
924 Ga0316182_1378764
925 Ga0307408_100202627
926 Ga0307408_100228786
927 Ga0307408_100268877
928 Ga0307408_100335058
929 Ga0307408_100658294
930 Ga0307408_101031868
931 Ga0307408_102068741
932 Ga0307405_10155244
933 Ga0307405_10315143
934 Ga0307405_10372740
935 Ga0307405_10432895
936 Ga0307405_10472082
937 Ga0307405_10509141
938 Ga0307405_10733468
939 Ga0307405_11144384
940 Ga0307405_11455586
941 Ga0307413_10077145
942 Ga0307413_10085788
943 Ga0307413_10106323
944 Ga0307413_10274757
945 Ga0307413_10410591
946 Ga0307413_10655529
947 Ga0307413_10681879
948 Ga0307413_10734712
949 Ga0307410_10000367
950 Ga0307410_10049477
951 Ga0307410_10202126
952 Ga0307410_10204501
953 Ga0307410_10500719
954 Ga0307410_10570130
955 Ga0307410_10615406
956 Ga0307410_10702609
957 Ga0307410_10733035
958 Ga0307410_11075266
959 Ga0307410_11303193
960 Ga0307410_11321628
961 Ga0307406_10078333
962 Ga0307406_10192094
963 Ga0307406_10228994
964 Ga0307406_10288329
965 Ga0307406_11813774
966 Ga0307406_11864282
967 Ga0307406_11923341
968 Ga0307407_10020440
969 Ga0307407_10092805
970 Ga0307407_10105566
971 Ga0307407_10194125
972 Ga0307407_10499346
973 Ga0307407_10508697
974 Ga0307407_10742478
975 Ga0307407_11313917
976 Ga0307412_10014875
977 Ga0307412_10088107
978 Ga0307412_10092454
979 Ga0307412_10113658
980 Ga0307412_10150954
981 Ga0307412_10159755
982 Ga0307412_10327566
983 Ga0307412_10427021
984 Ga0307412_10437039
985 Ga0307412_10674180
986 Ga0307412_10871012
987 Ga0307412_11236181
988 Ga0307412_11411614
989 Ga0307412_11584593
990 Ga0307412_11718104
991 Ga0307409_100075284
992 Ga0307409_100229934
993 Ga0307409_100234042
994 Ga0307409_100292394
995 Ga0307409_100586978
996 Ga0307409_101388849
997 Ga0307409_101596653
998 Ga0307409_101610550
999 Ga0307416_100308948
1000 Ga0307416_100710293
1001 Ga0307416_101383045
1002 Ga0307416_101954560
1003 Ga0307416_102109543
1004 Ga0307416_102707141
1005 Ga0307416_103241513
1006 Ga0307416_103869925
1007 Ga0307414_10003487
1008 Ga0307414_10074874
1009 Ga0307414_10167099
1010 Ga0307414_10177521
1011 Ga0307414_10314520
1012 Ga0307414_10333259
1013 Ga0307414_10746809
1014 Ga0307414_10785384
1015 Ga0307414_10791433
1016 Ga0307414_10852154
1017 Ga0307414_11234984
1018 Ga0307414_11413504
1019 Ga0307414_11431862
1020 Ga0307414_11729824
1021 Ga0307414_11888292
1022 Ga0307414_11975447
1023 Ga0307414_12256516
1024 Ga0307411_10003566
1025 Ga0307411_10003832
1026 Ga0307411_10022730
1027 Ga0307411_10041184
1028 Ga0307411_10062116
1029 Ga0307411_10088159
1030 Ga0307411_10297780
1031 Ga0307411_10829324
1032 Ga0307411_10964542
1033 Ga0307411_10998016
1034 Ga0307411_11807783
1035 Ga0307411_11979817
1036 Ga0307415_100013154
1037 Ga0307415_100081806
1038 Ga0307415_100115010
1039 Ga0307415_100215258
1040 Ga0307415_100231954
1041 Ga0307415_100450890
1042 Ga0307415_100558747
1043 Ga0307415_101107757
1044 Ga0307415_101472282
1045 Ga0307415_102055896
1046 Ga0373923_0016944
1047 Ga0373953_0264503
1048 Ga0373954_0011568
1049 Ga0373956_0116098
1050 Ga0373957_0169664
1051 Ga0373955_0004824
1052 Ga0373933_0038989
1053 Ga0373937_0002354
1054 Ga0395899_0001516
1055 Ga0395899_0047069
1056 Ga0395899_0406231
1057 Ga0395899_0628609
1058 Ga0395900_0000731
1059 Ga0395900_0002620
1060 Ga0395900_0137662
1061 Ga0395900_0250580
1062 Ga0395900_0273608
1063 Ga0395900_0394171
1064 Ga0395898_0008080
1065 Ga0395898_0061652
1066 Ga0395898_0724909
1067 Ga0395898_1407708
1068 Ga0395905_0000383
1069 Ga0395905_0000801
1070 Ga0395905_0001753
1071 Ga0395905_0019060
1072 Ga0395905_0074142
1073 Ga0395905_0237430
1074 Ga0395905_0314800
1075 Ga0395905_1409144
1076 Ga0395901_0000677
1077 Ga0395901_0002295
1078 Ga0395901_0184331
1079 Ga0395901_1173665
1080 Ga0395901_1302550
1081 Ga0439436_0253699
1082 Ga0439449_0072638
1083 Ga0450912_001651
1084 Ga0450890_044980
1085 Ga0466963_0151773
1086 Ga0495585_0138134
1087 Ga0495596_0035249
1088 Ga0495596_0386781
1089 Ga0495663_0004162
1090 Ga0495663_0017872
1091 Ga0495663_0058046
1092 Ga0495663_0150887
1093 Ga0495642_0090645
1094 Ga0495598_0007610
1095 Ga0495621_0003427
1096 Ga0495621_0044811
1097 Ga0495621_0073377
1098 Ga0495633_0280280
1099 Ga0495633_0354298
1100 Ga0495659_0055644
1101 Ga0495659_0144906
1102 Ga0495661_0164978
1103 Ga0495623_0001974
1104 Ga0495669_0153886
1105 Ga0495669_0287000
1106 Ga0495670_0141232
1107 Ga0495670_0163477
1108 Ga0495670_0394405
1109 Ga0495670_0415642
1110 Ga0495670_0445670
1111 Ga0495636_0526389
1112 Ga0495677_0391185
1113 Ga0495685_046528
1114 Ga0495602_0026366
1115 Ga0495615_0061519
1116 Ga0496102_0018756
1117 Ga0496104_0050059
1118 Ga0496106_0059457
1119 Ga0496107_0161909
1120 Ga0496108_0004150
1121 Ga0496109_0008253
1122 Ga0496109_0319940
1123 Ga0496110_0056994
1124 Ga0496111_0015950
1125 Ga0496112_0149318
1126 Ga0496113_0027515
1127 Ga0501067_0143959
1128 Ga0501268_046086
1129 nmdc:mga06r32_1572_c1
1130 nmdc:mga08y16_1109987_c1
1131 nmdc:mga08y16_933838_c1
1132 Ga0495612_0104207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09413

DUF2007

Putative prokaryotic signal transducing protein

5

69

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yj7-assembly1.cif.gz_A crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.8639 3 66
1yj7-assembly1.cif.gz_C crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.8451 6 66
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.8387 3 69
5gs9-assembly1.cif.gz_A crystal structure of castor1-arginine 0.8223 23 68
5gv2-assembly1.cif.gz_A crystal structure of arginine-bound castor1 from homo sapiens 0.8186 23 68
ID Description Score Start End Superfamily
af_P0AD21_4_109_2.60.40.1130 Mainly Beta;Sandwich;Immunoglobulin-like;Rab geranylgeranyltransferase alpha-subunit, insert domain 0.8902 14 66 2.60.40.1130
1yj7B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.839 6 66 3.30.70.1530
2lepA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7738 5 65 3.30.70.2350
2mkyA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.772 5 68 3.30.70.1530
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7656 5 65 3.30.70.2350
ID Description Score Start End GO Terms
AF-A0A2A8CWB8-F1-model_v4 DUF2007 domain-containing protein 0.9371 2 66 GO:0016020
AF-A0A7V5DCJ8-F1-model_v4 DUF2007 domain-containing protein 0.9312 3 65 GO:0016020
AF-A0A517MHF0-F1-model_v4 DUF2007 domain-containing protein 0.9239 3 67
AF-A0A5M4B3F2-F1-model_v4 Universal stress protein 0.9233 1 65
AF-A0A7X7TBI9-F1-model_v4 DUF2007 domain-containing protein 0.9226 3 66

Map