F464343

General Info

Members Datasets Scaffolds Average Seq Length
566 414 401 279

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1001039|Ga0065165_100103915
Length 318
Sequence MVKFPGAVYKSNRLTPVEGGRTIQKTCIFWISNDCITTMEKVWFITGCSTGFGRALAKQVLQAGYKAGVSARRVEDVADIVNEYPQTAIAIPLDVTRNEQIAAAVKQLHDVFGRIDVLVNNAGIGYFGAIEESEAPEVRRMFEINFFGLANVTTAVLPVMRVQRSGHILNIASIAGLVGYPAVGYYNATKFAVDGFSESLARETAHLGIKVTVIAPGGFRTDWAGRSANESPIVIDDYAPSAGANKISIRNSSGNQPGDPVRAAQAMIAVVESAAPPMRLLLGAGALRSARKKLELLQKDYDAWEATTLGADAPAEGV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
4 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
5 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
6 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
7 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
8 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
9 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
10 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
11 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
12 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
13 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
14 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
15 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
16 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
17 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
18 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
19 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
20 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
21 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
22 2738541284 Pedobacter sp. YR016 Isolate Unclassified
23 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
24 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
25 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
26 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
27 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
28 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
29 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
30 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
31 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
32 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
33 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
34 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
35 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
36 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
37 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
38 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
39 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
40 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
41 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
42 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
43 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
44 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
45 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
46 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
47 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
48 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
49 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
50 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
51 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
52 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
53 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
54 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
55 2902330777 Methylobacterium sp. 2A Isolate Unclassified
56 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
57 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
58 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
59 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
60 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
61 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
62 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
63 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
64 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
65 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
66 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
67 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
68 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
69 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
70 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
71 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
72 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
73 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
74 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
75 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
76 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
77 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
78 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
79 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
80 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
81 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
82 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
83 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
84 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
85 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
86 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
87 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
88 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
89 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
90 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
91 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
92 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
93 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
94 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
95 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
96 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
97 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
98 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
99 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
100 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
101 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
102 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
103 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
104 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
105 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
106 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
107 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
108 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
109 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
110 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
111 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
112 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
113 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
114 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
115 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
116 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
117 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
118 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
119 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
120 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
121 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
122 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
123 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
124 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
125 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
126 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
127 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
128 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
129 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
130 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
131 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
132 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
133 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
134 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
135 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
136 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
137 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
138 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
139 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
140 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
141 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
142 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
143 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
144 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
145 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
146 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
147 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
148 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
149 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
150 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
151 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
152 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
153 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
154 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
155 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
156 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
157 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
158 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
159 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
160 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
161 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
162 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
163 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
164 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
165 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
166 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
167 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
168 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
169 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
170 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
171 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
172 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
173 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
174 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
175 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
176 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
177 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
178 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
179 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
180 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
181 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
184 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
185 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
186 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
187 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
188 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
189 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
190 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
191 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
192 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
193 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
194 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
195 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
196 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
197 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
198 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
199 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
200 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
201 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
202 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
203 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
204 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
205 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
206 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
207 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
208 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
209 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
210 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
211 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
212 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
213 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
214 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
215 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
216 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
217 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
218 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
219 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
220 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
221 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
222 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
223 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
224 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
225 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
226 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
227 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
228 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
229 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
230 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
231 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
232 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
233 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
234 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
235 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
236 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
237 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
238 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
239 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
240 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
241 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
242 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
243 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
244 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
245 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
246 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
247 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
248 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
249 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
250 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
251 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
252 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
253 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
255 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
257 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
258 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
298 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
299 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
303 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
304 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
305 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
306 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
307 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
308 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
309 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
310 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
311 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
312 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
313 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
314 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
315 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
316 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
317 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
318 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
319 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
320 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
321 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
322 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
323 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
324 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
325 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
326 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
327 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
328 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
329 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
330 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
331 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
332 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
333 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
334 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
335 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
336 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
337 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
338 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
339 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
340 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
341 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
342 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
343 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
344 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
345 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
348 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
349 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
352 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
353 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
354 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
355 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
356 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
357 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
358 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
361 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
365 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
366 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
367 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
368 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
369 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
370 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
389 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
392 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
400 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
401 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
402 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
403 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
404 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
405 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
406 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
409 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
410 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
411 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
412 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
413 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
414 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.85
Metatranscriptomes 0
Isolates 29.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.59
Nodule 23.67
Rhizoplane 3
Rhizosphere 55.83
Stem 0
Stem Tuber 0
Unclassified 12.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1753856 2162886007 Bacteria 19418
2 SwRhRL2b_contig_663477 2162886007 Bacteria 1897
3 MBSR1b_contig_11807390 2162886012 Unclassified 2023
4 JGI25156J39149_1000358 3300002705 Bacteria 29530
5 JGI25152J39213_1000606 3300002773 Bacteria 19305
6 JGI25150J39212_1000238 3300002774 Bacteria 29744
7 JGI25151J46595_10000645 3300003187 Bacteria 29743
8 rootL2_10113107 3300003322 Bacteria 8355
9 rootL2_10128370 3300003322 Bacteria 8880
10 rootL2_10133946 3300003322 Unclassified 3708
11 rootH1_10004142 3300003323 Bacteria 6658
12 rootH1_10006645 3300003323 Bacteria 138273
13 rootH1_10034883 3300003323 Bacteria 6043
14 rootH1_10068849 3300003323 Bacteria 4058
15 rootH1_10120515 3300003323 Bacteria 4190
16 rootH1_10130918 3300003323 Bacteria 2689
17 Ga0065165_1001039 3300005262 Bacteria 33510
18 Ga0065714_10002453 3300005288 Bacteria 27201
19 Ga0065714_10064538 3300005288 Bacteria 39923
20 Ga0065704_10070224 3300005289 Bacteria 60921
21 Ga0065704_10077043 3300005289 Bacteria 4875
22 Ga0065704_10215827 3300005289 Bacteria 1091
23 Ga0065715_10089350 3300005293 Bacteria 10967
24 Ga0065715_10307505 3300005293 Bacteria 1021
25 Ga0070658_10158150 3300005327 Unclassified 1900
26 Ga0070683_100020380 3300005329 Bacteria 5902
27 Ga0070670_100000803 3300005331 Bacteria 24439
28 Ga0070670_100419676 3300005331 Unclassified 1183
29 Ga0068869_100003673 3300005334 Bacteria 9434
30 Ga0068868_100002227 3300005338 Bacteria 13406
31 Ga0068868_100007167 3300005338 Bacteria 7922
32 Ga0068868_100015149 3300005338 Bacteria 5697
33 Ga0070689_100373571 3300005340 Bacteria 1200
34 Ga0070661_100124096 3300005344 Unclassified 1936
35 Ga0070668_100005572 3300005347 Bacteria 9344
36 Ga0070669_100016950 3300005353 Bacteria 5202
37 Ga0070669_100191392 3300005353 Bacteria 1605
38 Ga0070671_100033053 3300005355 Bacteria 4276
39 Ga0070671_100423620 3300005355 Bacteria 1140
40 Ga0070674_100050097 3300005356 Bacteria 2874
41 Ga0070673_100150389 3300005364 Bacteria 1971
42 Ga0070673_100233531 3300005364 Bacteria 1596
43 Ga0070688_100134284 3300005365 Unclassified 1673
44 Ga0070667_100023576 3300005367 Bacteria 5107
45 Ga0070709_10006746 3300005434 Bacteria 6267
46 Ga0070710_10211802 3300005437 Bacteria 1229
47 Ga0070711_100221825 3300005439 Bacteria 1470
48 Ga0070705_100077960 3300005440 Bacteria 2025
49 Ga0070678_100083317 3300005456 Bacteria 2430
50 Ga0070678_100351017 3300005456 Bacteria 1268
51 Ga0068867_100005632 3300005459 Bacteria 8876
52 Ga0068867_100035345 3300005459 Bacteria 3624
53 Ga0070685_10019576 3300005466 Bacteria 3654
54 Ga0070707_100259161 3300005468 Unclassified 1692
55 Ga0070679_100243399 3300005530 Bacteria 1756
56 Ga0070684_100147237 3300005535 Bacteria 2132
57 Ga0068853_100032190 3300005539 Bacteria 4441
58 Ga0068853_100101278 3300005539 Bacteria 2547
59 Ga0068853_100412004 3300005539 Bacteria 1266
60 Ga0070672_100312039 3300005543 Bacteria 1335
61 Ga0070672_100368532 3300005543 Bacteria 1227
62 Ga0070686_100049160 3300005544 Unclassified 2674
63 Ga0070695_100082867 3300005545 Bacteria 2124
64 Ga0070665_100002226 3300005548 Bacteria 21619
65 Ga0070665_100459185 3300005548 Bacteria 1284
66 Ga0068855_100242320 3300005563 Bacteria 2014
67 Ga0068857_100002340 3300005577 Bacteria 15428
68 Ga0068856_100013759 3300005614 Bacteria 7822
69 Ga0068856_100425255 3300005614 Bacteria 1348
70 Ga0070702_100151436 3300005615 Bacteria 1489
71 Ga0068859_100017642 3300005617 Bacteria 7176
72 Ga0068859_100038682 3300005617 Bacteria 4785
73 Ga0068859_100118652 3300005617 Bacteria 2711
74 Ga0068864_100001905 3300005618 Bacteria 17126
75 Ga0068851_10025300 3300005834 Bacteria 2911
76 Ga0068870_10009916 3300005840 Bacteria 4350
77 Ga0068863_100011110 3300005841 Bacteria 8731
78 Ga0068863_100077255 3300005841 Bacteria 3151
79 Ga0068863_100090690 3300005841 Unclassified 2898
80 Ga0068863_100131692 3300005841 Bacteria 2388
81 Ga0068858_100010823 3300005842 Bacteria 8623
82 Ga0068858_100065885 3300005842 Bacteria 3352
83 Ga0068860_100008883 3300005843 Bacteria 10011
84 Ga0068860_100016505 3300005843 Bacteria 7202
85 Ga0068860_100029432 3300005843 Bacteria 5283
86 Ga0068862_100004646 3300005844 Bacteria 11571
87 Ga0068862_100031008 3300005844 Bacteria 4509
88 Ga0070716_100003254 3300006173 Bacteria 7630
89 Ga0070712_100389337 3300006175 Bacteria 1149
90 Ga0075370_10233037 3300006353 Bacteria 1090
91 Ga0068871_100021427 3300006358 Unclassified 4967
92 Ga0075433_10175931 3300006852 Bacteria 1904
93 Ga0075434_100037978 3300006871 Bacteria 4769
94 Ga0068865_100081392 3300006881 Bacteria 2325
95 Ga0075436_100096673 3300006914 Bacteria 2054
96 Ga0097620_100017642 3300006931 Bacteria 7176
97 Ga0097620_100038682 3300006931 Bacteria 4785
98 Ga0097620_100118641 3300006931 Bacteria 2711
99 Ga0079104_1000550 3300006946 Bacteria 39050
100 Ga0099826_10184523 3300006948 Bacteria 1157
101 Ga0105240_10000126 3300009093 Bacteria 157403
102 Ga0105240_10127465 3300009093 Bacteria 3056
103 Ga0105245_10070061 3300009098 Bacteria 3181
104 Ga0105245_10088039 3300009098 Bacteria 2851
105 Ga0105247_10011845 3300009101 Bacteria 5244
106 Ga0105247_10026726 3300009101 Bacteria 3487
107 Ga0105243_10764806 3300009148 Bacteria 948
108 Ga0105241_10013819 3300009174 Bacteria 5914
109 Ga0105241_10274261 3300009174 Bacteria 1438
110 Ga0105248_10015510 3300009177 Bacteria 8401
111 Ga0105237_10000233 3300009545 Bacteria 79346
112 Ga0105249_10044658 3300009553 Unclassified 4029
113 Ga0105239_10000162 3300010375 Bacteria 95804
114 Ga0105239_10015327 3300010375 Bacteria 8492
115 Ga0105239_10211304 3300010375 Bacteria 2175
116 Ga0105246_10112741 3300011119 Bacteria 2001
117 Ga0157373_10000188 3300013100 Bacteria 50875
118 Ga0157373_10000354 3300013100 Bacteria 36909
119 Ga0157373_10182925 3300013100 Bacteria 1476
120 Ga0157371_10000014 3300013102 Bacteria 347490
121 Ga0157371_10003045 3300013102 Bacteria 15555
122 Ga0157371_10004764 3300013102 Bacteria 11693
123 Ga0157370_10066063 3300013104 Bacteria 3421
124 Ga0157370_10213645 3300013104 Bacteria 1787
125 Ga0157369_10236280 3300013105 Bacteria 1910
126 Ga0157374_10012121 3300013296 Bacteria 7488
127 Ga0157378_10060685 3300013297 Bacteria 3374
128 Ga0163162_10017567 3300013306 Bacteria 7000
129 Ga0163162_10044672 3300013306 Bacteria 4438
130 Ga0163162_10079525 3300013306 Bacteria 3345
131 Ga0163162_10084356 3300013306 Bacteria 3252
132 Ga0163162_10341571 3300013306 Bacteria 1630
133 Ga0157372_10000458 3300013307 Bacteria 44772
134 Ga0157375_10003153 3300013308 Bacteria 14313
135 Ga0157375_10311447 3300013308 Bacteria 1739
136 Ga0163163_10028458 3300014325 Bacteria 5367
137 Ga0163163_10036904 3300014325 Bacteria 4750
138 Ga0163163_10045349 3300014325 Bacteria 4315
139 Ga0182008_10000010 3300014497 Bacteria 301527
140 Ga0157379_10010749 3300014968 Bacteria 7978
141 Ga0157379_10055520 3300014968 Bacteria 3539
142 Ga0157376_10036393 3300014969 Bacteria 3987
143 Ga0182006_1039114 3300015261 Bacteria 1873
144 Ga0182005_1000146 3300015265 Bacteria 49460
145 Ga0163161_10012905 3300017792 Bacteria 5806
146 Ga0228711_1005616 3300022739 Bacteria 19035
147 Ga0228710_1003183 3300022740 Bacteria 26184
148 Ga0207425_1000385 3300025245 Bacteria 29798
149 Ga0209026_1000704 3300025250 Bacteria 19888
150 Ga0209026_1000847 3300025250 Bacteria 16105
151 Ga0209026_1010770 3300025250 Bacteria 1686
152 Ga0209759_1000626 3300025256 Bacteria 33660
153 Ga0209129_1000467 3300025258 Bacteria 29791
154 Ga0209673_1029296 3300025273 Bacteria 1755
155 Ga0209025_1000603 3300025294 Bacteria 64824
156 Ga0209025_1002885 3300025294 Bacteria 17221
157 Ga0209025_1036128 3300025294 Bacteria 2218
158 Ga0209564_1009462 3300025295 Bacteria 4633
159 Ga0209758_1002343 3300025297 Bacteria 19519
160 Ga0207426_1001247 3300025302 Bacteria 22346
161 Ga0207655_1010327 3300025728 Bacteria 5668
162 Ga0207710_10008119 3300025900 Bacteria 4432
163 Ga0207710_10153900 3300025900 Bacteria 1117
164 Ga0207680_10041612 3300025903 Bacteria 2683
165 Ga0207680_10041920 3300025903 Bacteria 2674
166 Ga0207685_10090085 3300025905 Bacteria 1289
167 Ga0207699_10115902 3300025906 Bacteria 1724
168 Ga0207645_10018440 3300025907 Bacteria 4590
169 Ga0207705_10178227 3300025909 Unclassified 1603
170 Ga0207654_10207543 3300025911 Bacteria 1293
171 Ga0207695_10000013 3300025913 Bacteria 821265
172 Ga0207695_10195887 3300025913 Bacteria 1936
173 Ga0207671_10001284 3300025914 Bacteria 29519
174 Ga0207663_10234846 3300025916 Bacteria 1342
175 Ga0207646_10183652 3300025922 Unclassified 1889
176 Ga0207681_10017562 3300025923 Bacteria 4494
177 Ga0207694_10047173 3300025924 Bacteria 3332
178 Ga0207650_10005238 3300025925 Bacteria 8840
179 Ga0207644_10051890 3300025931 Unclassified 2945
180 Ga0207644_10464244 3300025931 Bacteria 1041
181 Ga0207706_10035855 3300025933 Bacteria 4407
182 Ga0207670_10086287 3300025936 Unclassified 2208
183 Ga0207669_10027806 3300025937 Bacteria 3103
184 Ga0207704_10074734 3300025938 Bacteria 2164
185 Ga0207704_10154143 3300025938 Bacteria 1626
186 Ga0207665_10015274 3300025939 Bacteria 5042
187 Ga0207711_10009789 3300025941 Bacteria 7971
188 Ga0207711_10032570 3300025941 Bacteria 4407
189 Ga0207689_10000998 3300025942 Bacteria 27153
190 Ga0207661_10004762 3300025944 Bacteria 9502
191 Ga0207667_10209955 3300025949 Bacteria 1995
192 Ga0207651_10058664 3300025960 Bacteria 2661
193 Ga0207651_10179596 3300025960 Bacteria 1678
194 Ga0207712_10001734 3300025961 Bacteria 14592
195 Ga0207712_10010764 3300025961 Bacteria 5815
196 Ga0207712_10070216 3300025961 Bacteria 2515
197 Ga0207668_10006768 3300025972 Bacteria 6785
198 Ga0207677_10015450 3300026023 Bacteria 4491
199 Ga0207677_10036592 3300026023 Bacteria 3201
200 Ga0207677_10037406 3300026023 Bacteria 3172
201 Ga0207703_10000460 3300026035 Bacteria 42799
202 Ga0207703_10075447 3300026035 Unclassified 2795
203 Ga0207639_10105458 3300026041 Unclassified 2287
204 Ga0207639_10143070 3300026041 Bacteria 1995
205 Ga0207639_10222004 3300026041 Bacteria 1633
206 Ga0207639_10442865 3300026041 Bacteria 1178
207 Ga0207678_10323561 3300026067 Bacteria 1327
208 Ga0207702_10038898 3300026078 Bacteria 3985
209 Ga0207641_10076137 3300026088 Unclassified 2900
210 Ga0207641_10282402 3300026088 Bacteria 1562
211 Ga0207641_10452143 3300026088 Bacteria 1241
212 Ga0207648_10000298 3300026089 Bacteria 53974
213 Ga0207648_10062600 3300026089 Bacteria 3243
214 Ga0207648_10544598 3300026089 Bacteria 1065
215 Ga0207676_10069592 3300026095 Bacteria 2819
216 Ga0207676_10207260 3300026095 Bacteria 1737
217 Ga0207674_10005636 3300026116 Bacteria 14846
218 Ga0207675_100003275 3300026118 Bacteria 15860
219 Ga0207683_10090488 3300026121 Unclassified 2725
220 Ga0207683_10272893 3300026121 Bacteria 1545
221 Ga0209281_1000590 3300027111 Bacteria 42187
222 Ga0209281_1000640 3300027111 Bacteria 38244
223 Ga0209281_1002124 3300027111 Bacteria 8752
224 Ga0209282_1000049 3300027666 Bacteria 109875
225 Ga0268266_10002965 3300028379 Bacteria 17506
226 Ga0268266_10243754 3300028379 Bacteria 1660
227 Ga0268266_10334608 3300028379 Bacteria 1420
228 Ga0268265_10003720 3300028380 Bacteria 10848
229 Ga0268265_10059260 3300028380 Bacteria 2928
230 Ga0268264_10005582 3300028381 Bacteria 10655
231 Ga0268264_10006975 3300028381 Bacteria 9482
232 Ga0268264_10050954 3300028381 Bacteria 3448
233 Ga0268264_10069671 3300028381 Unclassified 2975
234 Ga0307515_10000010 3300028794 Bacteria 651586
235 Ga0265338_10078879 3300028800 Bacteria 2774
236 Ga0265324_10026352 3300029957 Bacteria 2057
237 Ga0316178_1013162 3300030735 Bacteria 2296
238 Ga0265320_10092178 3300031240 Bacteria 1403
239 Ga0265331_10000337 3300031250 Bacteria 50233
240 Ga0265331_10026030 3300031250 Bacteria 2947
241 Ga0265327_10000013 3300031251 Bacteria 519549
242 Ga0265327_10000201 3300031251 Bacteria 124359
243 Ga0265316_10158365 3300031344 Bacteria 1694
244 Ga0307408_100103978 3300031548 Bacteria 2169
245 Ga0307410_10278836 3300031852 Bacteria 1311
246 Ga0307406_10191147 3300031901 Bacteria 1499
247 Ga0307406_10284318 3300031901 Bacteria 1263
248 Ga0307412_10000018 3300031911 Bacteria 284374
249 Ga0307412_10032447 3300031911 Bacteria 3309
250 Ga0315914_1000005 3300031967 Bacteria 242195
251 Ga0307409_100064817 3300031995 Bacteria 2872
252 Ga0307416_100150243 3300032002 Bacteria 2135
253 Ga0307414_10001267 3300032004 Bacteria 13021
254 Ga0307414_10652546 3300032004 Bacteria 949
255 Ga0307411_10009600 3300032005 Bacteria 5101
256 Ga0307415_100705215 3300032126 Unclassified 911
257 Ga0307510_10118659 3300033180 Bacteria 2358
258 Ga0315913_1001476 3300033430 Bacteria 26019
259 Ga0315915_1000004 3300033464 Bacteria 403083
260 Ga0373941_0073817 3300035115 Bacteria 1138
261 Ga0373960_0007693 3300035121 Bacteria 2562
262 Ga0373931_0253047 3300035691 Bacteria 1072
263 Ga0395899_0055222 3300037312 Bacteria 2938
264 Ga0395900_0033833 3300037418 Bacteria 5259
265 Ga0395898_0487075 3300037466 Bacteria 1173
266 Ga0395905_0018850 3300037471 Bacteria 6545
267 Ga0395901_0095262 3300038443 Bacteria 3119
268 Ga0436365_1488383 3300039437 Bacteria 2336
269 Ga0439438_000090 3300041405 Bacteria 41861
270 Ga0439439_0048741 3300041406 Bacteria 1108
271 Ga0439447_016288 3300041407 Bacteria 2044
272 Ga0439466_0000736 3300041411 Bacteria 12403
273 Ga0439451_000744 3300042009 Bacteria 6194
274 Ga0439452_000059 3300042010 Bacteria 101639
275 Ga0439456_002102 3300042013 Bacteria 4015
276 Ga0439457_011980 3300042014 Bacteria 1960
277 Ga0450911_000021 3300042115 Bacteria 98705
278 Ga0450894_004129 3300042131 Bacteria 1892
279 Ga0450906_000015 3300042145 Bacteria 34411
280 Ga0466963_0025684 3300044694 Bacteria 3759
281 Ga0451576_0000002 3300045051 Bacteria 1670975
282 Ga0495627_000467 3300046453 Bacteria 34894
283 Ga0495603_0008779 3300046455 Bacteria 6110
284 Ga0495591_002675 3300046458 Bacteria 9692
285 Ga0495591_018906 3300046458 Bacteria 2323
286 Ga0495638_0058090 3300046460 Bacteria 2398
287 Ga0495638_0140060 3300046460 Bacteria 1413
288 Ga0495641_0118870 3300046461 Bacteria 1179
289 Ga0495650_0000447 3300046471 Bacteria 65735
290 Ga0495650_0109852 3300046471 Bacteria 1025
291 Ga0495580_0013992 3300046472 Bacteria 6102
292 Ga0495605_0000209 3300046474 Bacteria 71906
293 Ga0495607_0000003 3300046501 Bacteria 366900
294 Ga0495607_0018189 3300046501 Bacteria 4486
295 Ga0495607_0030510 3300046501 Bacteria 3308
296 Ga0495607_0056366 3300046501 Bacteria 2256
297 Ga0495607_0078649 3300046501 Bacteria 1819
298 Ga0495607_0123020 3300046501 Bacteria 1359
299 Ga0495583_0005498 3300046506 Bacteria 8583
300 Ga0495583_0019781 3300046506 Bacteria 3506
301 Ga0495606_0000844 3300046507 Bacteria 46120
302 Ga0495606_0002529 3300046507 Bacteria 21031
303 Ga0495606_0005006 3300046507 Bacteria 12923
304 Ga0495610_0007517 3300046512 Bacteria 7228
305 Ga0495610_0013691 3300046512 Bacteria 4806
306 Ga0495616_0000538 3300046513 Bacteria 28605
307 Ga0495620_0001562 3300046515 Bacteria 13600
308 Ga0495632_0003406 3300046519 Bacteria 11315
309 Ga0495632_0060651 3300046519 Bacteria 1837
310 Ga0495643_0016853 3300046522 Bacteria 4286
311 Ga0495643_0026036 3300046522 Bacteria 3306
312 Ga0495654_0000554 3300046530 Bacteria 30162
313 Ga0495654_0008742 3300046530 Bacteria 5578
314 Ga0495654_0009684 3300046530 Bacteria 5275
315 Ga0495609_0040887 3300046538 Bacteria 2085
316 Ga0495609_0066324 3300046538 Bacteria 1590
317 Ga0495633_0002987 3300046558 Bacteria 11568
318 Ga0495633_0069306 3300046558 Bacteria 1646
319 Ga0495668_0138509 3300046616 Bacteria 1332
320 Ga0495625_0000972 3300046660 Bacteria 38083
321 Ga0495625_0122279 3300046660 Bacteria 1770
322 Ga0495661_0000365 3300046665 Bacteria 49049
323 Ga0495661_0006736 3300046665 Bacteria 8061
324 Ga0495588_0013948 3300046674 Bacteria 3838
325 Ga0495649_0000014 3300046694 Bacteria 287408
326 Ga0495649_0000262 3300046694 Bacteria 46820
327 Ga0495589_0001286 3300046794 Bacteria 14836
328 Ga0495660_0007245 3300046810 Bacteria 6530
329 Ga0495660_0011460 3300046810 Bacteria 5144
330 Ga0495672_0000088 3300047320 Bacteria 153860
331 Ga0495672_0000666 3300047320 Bacteria 38236
332 Ga0495672_0106100 3300047320 Bacteria 1515
333 Ga0495683_0000014 3300047323 Bacteria 199398
334 Ga0495679_008836 3300047446 Bacteria 4067
335 Ga0495681_0005850 3300047470 Bacteria 8168
336 Ga0495681_0058409 3300047470 Bacteria 1787
337 Ga0495686_0000913 3300047472 Bacteria 37043
338 Ga0495686_0001449 3300047472 Bacteria 25844
339 Ga0495686_0001792 3300047472 Bacteria 21777
340 Ga0495686_0002459 3300047472 Bacteria 17466
341 Ga0495686_0099064 3300047472 Bacteria 1760
342 Ga0495686_0189098 3300047472 Unclassified 1188
343 Ga0496100_0011598 3300048903 Bacteria 5021
344 Ga0496101_0001957 3300048904 Bacteria 12478
345 Ga0496101_0003590 3300048904 Bacteria 9683
346 Ga0496102_0068878 3300048905 Bacteria 3247
347 Ga0496102_0269569 3300048905 Bacteria 1605
348 Ga0496103_0024336 3300048906 Bacteria 3655
349 Ga0496103_0025916 3300048906 Bacteria 3547
350 Ga0496104_0376246 3300048907 Bacteria 1333
351 Ga0496107_0007718 3300048910 Bacteria 7431
352 Ga0496112_0075839 3300048915 Bacteria 3325
353 Ga0496113_0030706 3300048916 Bacteria 3892
354 Ga0496113_0049499 3300048916 Bacteria 3129
355 Ga0496114_0011813 3300048917 Bacteria 6988
356 Ga0496116_0001605 3300048919 Bacteria 24833
357 Ga0496116_0016666 3300048919 Bacteria 5740
358 Ga0496117_0000033 3300048920 Bacteria 345605
359 Ga0496117_0044637 3300048920 Bacteria 3209
360 Ga0496118_0000748 3300048921 Bacteria 52574
361 Ga0496118_0020578 3300048921 Bacteria 5845
362 Ga0496118_0054098 3300048921 Bacteria 3044
363 Ga0496118_0154491 3300048921 Bacteria 1430
364 Ga0496119_0001309 3300048922 Bacteria 30695
365 Ga0496120_0000509 3300048923 Bacteria 60589
366 Ga0496121_0001262 3300048924 Bacteria 43756
367 Ga0496121_0001820 3300048924 Bacteria 34405
368 Ga0496121_0018324 3300048924 Bacteria 7067
369 Ga0496121_0227343 3300048924 Bacteria 1309
370 Ga0496122_0000365 3300048925 Bacteria 97184
371 Ga0496122_0003590 3300048925 Bacteria 20223
372 Ga0496122_0017448 3300048925 Bacteria 6710
373 Ga0496122_0028164 3300048925 Bacteria 4778
374 Ga0496123_0000298 3300048926 Bacteria 97184
375 Ga0496123_0002846 3300048926 Bacteria 20442
376 Ga0496123_0011370 3300048926 Bacteria 7724
377 Ga0496123_0015241 3300048926 Bacteria 6317
378 Ga0496123_0026210 3300048926 Bacteria 4374
379 Ga0496124_0001649 3300048927 Bacteria 31949
380 Ga0496124_0002269 3300048927 Bacteria 25484
381 Ga0496124_0056791 3300048927 Bacteria 3300
382 Ga0496125_0001442 3300048928 Bacteria 34575
383 Ga0496125_0032410 3300048928 Bacteria 4642
384 Ga0496125_0064705 3300048928 Bacteria 2903
385 Ga0496126_0013056 3300048929 Bacteria 8476
386 Ga0495682_0047346 3300049460 Bacteria 1569
387 Ga0501034_0515539 3300049571 Bacteria 1108
388 Ga0501046_0000045 3300049580 Bacteria 144492
389 Ga0501070_0168616 3300049586 Bacteria 1804
390 Ga0500651_0009724 3300053093 Bacteria 5731
391 Ga0500562_013492 3300053108 Bacteria 2088
392 Ga0500562_030128 3300053108 Bacteria 1429
393 Ga0500562_066486 3300053108 Bacteria 971
394 Ga0500618_001398 3300053125 Bacteria 10845
395 Ga0500573_0024559 3300053140 Bacteria 3465
396 Ga0500588_0075978 3300053146 Bacteria 1113
397 Ga0500604_0016312 3300053151 Bacteria 2045
398 Ga0500604_0064469 3300053151 Bacteria 1158
399 Ga0500624_000279 3300053157 Bacteria 17646
400 Ga0500627_0163141 3300053158 Bacteria 1005
401 Ga0500611_000059 3300053727 Bacteria 48867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2967686174 2967689848 221
2 3300053108 Ga0500562_066486 Ga0500562_066486_27_707 225
3 3300010375 Ga0105239_10211304 Ga0105239_102113042 240
4 3300013105 Ga0157369_10236280 Ga0157369_102362802 240
5 3300013296 Ga0157374_10012121 Ga0157374_100121219 240
6 3300013306 Ga0163162_10341571 Ga0163162_103415712 240
7 3300025302 Ga0207426_1001247 Ga0207426_100124712 240
8 3300025924 Ga0207694_10047173 Ga0207694_100471732 240
9 3300048903 Ga0496100_0011598 Ga0496100_0011598_3392_4126 240
10 3300048904 Ga0496101_0003590 Ga0496101_0003590_3580_4314 240
11 3300048905 Ga0496102_0068878 Ga0496102_0068878_2308_3042 240
12 3300048907 Ga0496104_0376246 Ga0496104_0376246_288_1022 240
13 3300048915 Ga0496112_0075839 Ga0496112_0075839_2555_3289 240
14 3300048916 Ga0496113_0049499 Ga0496113_0049499_287_1021 240
15 3300048921 Ga0496118_0154491 Ga0496118_0154491_98_832 240
16 3300048924 Ga0496121_0001820 Ga0496121_0001820_718_1452 240
17 3300048926 Ga0496123_0015241 Ga0496123_0015241_3488_4222 240
18 3300048927 Ga0496124_0056791 Ga0496124_0056791_2219_2953 240
19 3300048928 Ga0496125_0064705 Ga0496125_0064705_2132_2866 240
20 3300025294 Ga0209025_1002885 Ga0209025_100288511 255
21 3300005456 Ga0070678_100083317 Ga0070678_1000833171 258
22 3300009098 Ga0105245_10088039 Ga0105245_100880391 258
23 3300026023 Ga0207677_10036592 Ga0207677_100365924 258
24 3300046530 Ga0495654_0008742 Ga0495654_0008742_248_1096 260
25 3300003323 rootH1_10068849 rootH1_100688493 261
26 3300049586 Ga0501070_0168616 Ga0501070_0168616_561_1406 261
27 iso_pu_bacteria 2967693043 2967699203 264
28 iso_pu_bacteria 2970129317 2970135221 264
29 3300028794 Ga0307515_10000010 Ga0307515_1000001067 265
30 3300046616 Ga0495668_0138509 Ga0495668_0138509_94_900 266
31 3300053151 Ga0500604_0016312 Ga0500604_0016312_462_1268 266
32 3300009174 Ga0105241_10274261 Ga0105241_102742612 269
33 3300025911 Ga0207654_10207543 Ga0207654_102075432 269
34 3300046522 Ga0495643_0016853 Ga0495643_0016853_190_1038 269
35 3300006353 Ga0075370_10233037 Ga0075370_102330371 272
36 3300025250 Ga0209026_1010770 Ga0209026_10107702 272
37 3300047472 Ga0495686_0001449 Ga0495686_0001449_12274_13140 272
38 3300053146 Ga0500588_0075978 Ga0500588_0075978_223_1062 272
39 3300053151 Ga0500604_0064469 Ga0500604_0064469_103_939 272
40 iso_pu_bacteria 2600255286 2601638230 272
41 iso_pu_bacteria 8055632911 8055633668 272
42 3300049571 Ga0501034_0515539 Ga0501034_0515539_251_1072 273
43 3300053108 Ga0500562_013492 Ga0500562_013492_27_860 273
44 iso_pu_bacteria 2842832357 2842835140 273
45 iso_pu_bacteria 2919385768 2919390119 273
46 iso_pu_bacteria 8029995093 8029998299 273
47 iso_pu_bacteria 8056166840 8056168682 273
48 iso_pu_bacteria 2738541284 2738760935 274
49 iso_pu_bacteria 2775506987 2776613106 274
50 iso_pu_bacteria 2818991442 2819573861 274
51 iso_pu_bacteria 2838074704 2838079711 274
52 iso_pu_bacteria 2896384573 2896391177 274
53 iso_pu_bacteria 2920760137 2920761218 274
54 3300002773 JGI25152J39213_1000606 JGI25152J39213_100060611 275
55 3300002774 JGI25150J39212_1000238 JGI25150J39212_100023829 275
56 3300003187 JGI25151J46595_10000645 JGI25151J46595_1000064529 275
57 3300005353 Ga0070669_100191392 Ga0070669_1001913922 275
58 3300005548 Ga0070665_100002226 Ga0070665_10000222613 275
59 3300006946 Ga0079104_1000550 Ga0079104_100055021 275
60 3300006948 Ga0099826_10184523 Ga0099826_101845231 275
61 3300013100 Ga0157373_10182925 Ga0157373_101829251 275
62 3300022739 Ga0228711_1005616 Ga0228711_100561615 275
63 3300022740 Ga0228710_1003183 Ga0228710_100318320 275
64 3300025245 Ga0207425_1000385 Ga0207425_100038525 275
65 3300025258 Ga0209129_1000467 Ga0209129_100046725 275
66 3300025273 Ga0209673_1029296 Ga0209673_10292963 275
67 3300025294 Ga0209025_1000603 Ga0209025_10006037 275
68 3300025294 Ga0209025_1036128 Ga0209025_10361281 275
69 3300025295 Ga0209564_1009462 Ga0209564_10094624 275
70 3300025297 Ga0209758_1002343 Ga0209758_100234311 275
71 3300025903 Ga0207680_10041612 Ga0207680_100416123 275
72 3300026023 Ga0207677_10015450 Ga0207677_100154504 275
73 3300026067 Ga0207678_10323561 Ga0207678_103235612 275
74 3300027111 Ga0209281_1000590 Ga0209281_100059024 275
75 3300027111 Ga0209281_1000640 Ga0209281_100064018 275
76 3300027111 Ga0209281_1002124 Ga0209281_10021244 275
77 3300027666 Ga0209282_1000049 Ga0209282_100004973 275
78 3300028379 Ga0268266_10002965 Ga0268266_100029657 275
79 3300030735 Ga0316178_1013162 Ga0316178_10131622 275
80 3300031344 Ga0265316_10158365 Ga0265316_101583652 275
81 3300031548 Ga0307408_100103978 Ga0307408_1001039783 275
82 3300031911 Ga0307412_10032447 Ga0307412_100324471 275
83 3300031967 Ga0315914_1000005 Ga0315914_1000005156 275
84 3300032005 Ga0307411_10009600 Ga0307411_100096005 275
85 3300033430 Ga0315913_1001476 Ga0315913_100147620 275
86 3300033464 Ga0315915_1000004 Ga0315915_1000004174 275
87 3300041405 Ga0439438_000090 Ga0439438_000090_13511_14344 275
88 3300041406 Ga0439439_0048741 Ga0439439_0048741_192_1031 275
89 3300041407 Ga0439447_016288 Ga0439447_016288_591_1424 275
90 3300041411 Ga0439466_0000736 Ga0439466_0000736_9455_10288 275
91 3300042009 Ga0439451_000744 Ga0439451_000744_4950_5783 275
92 3300042010 Ga0439452_000059 Ga0439452_000059_23353_24186 275
93 3300042013 Ga0439456_002102 Ga0439456_002102_165_998 275
94 3300042115 Ga0450911_000021 Ga0450911_000021_20473_21306 275
95 3300042145 Ga0450906_000015 Ga0450906_000015_3651_4484 275
96 3300046455 Ga0495603_0008779 Ga0495603_0008779_1868_2707 275
97 3300046461 Ga0495641_0118870 Ga0495641_0118870_209_1048 275
98 3300046472 Ga0495580_0013992 Ga0495580_0013992_1455_2294 275
99 3300046660 Ga0495625_0122279 Ga0495625_0122279_858_1697 275
100 3300046810 Ga0495660_0007245 Ga0495660_0007245_3143_3982 275
101 3300047320 Ga0495672_0000088 Ga0495672_0000088_142365_143204 275
102 3300048910 Ga0496107_0007718 Ga0496107_0007718_3606_4445 275
103 3300048916 Ga0496113_0030706 Ga0496113_0030706_219_1058 275
104 3300048919 Ga0496116_0001605 Ga0496116_0001605_20120_20959 275
105 3300048919 Ga0496116_0016666 Ga0496116_0016666_4567_5406 275
106 3300048920 Ga0496117_0000033 Ga0496117_0000033_22650_23489 275
107 3300048921 Ga0496118_0000748 Ga0496118_0000748_35166_36005 275
108 3300048922 Ga0496119_0001309 Ga0496119_0001309_7683_8522 275
109 3300048923 Ga0496120_0000509 Ga0496120_0000509_36734_37573 275
110 3300048925 Ga0496122_0000365 Ga0496122_0000365_73329_74168 275
111 3300048925 Ga0496122_0003590 Ga0496122_0003590_15520_16359 275
112 3300048925 Ga0496122_0017448 Ga0496122_0017448_2790_3629 275
113 3300048925 Ga0496122_0028164 Ga0496122_0028164_934_1773 275
114 3300048926 Ga0496123_0000298 Ga0496123_0000298_23017_23856 275
115 3300048926 Ga0496123_0002846 Ga0496123_0002846_15749_16588 275
116 3300048926 Ga0496123_0011370 Ga0496123_0011370_2973_3812 275
117 3300048926 Ga0496123_0026210 Ga0496123_0026210_1127_1966 275
118 3300048927 Ga0496124_0001649 Ga0496124_0001649_20443_21282 275
119 3300048927 Ga0496124_0002269 Ga0496124_0002269_3875_4714 275
120 3300048928 Ga0496125_0001442 Ga0496125_0001442_13294_14133 275
121 3300048928 Ga0496125_0032410 Ga0496125_0032410_2006_2845 275
122 3300048929 Ga0496126_0013056 Ga0496126_0013056_3824_4663 275
123 3300053157 Ga0500624_000279 Ga0500624_000279_2278_3117 275
124 iso_pu_bacteria 2512875026 2512974941 275
125 iso_pu_bacteria 2513237086 2513585915 275
126 iso_pu_bacteria 2513237089 2513603724 275
127 iso_pu_bacteria 2513237156 2513987718 275
128 iso_pu_bacteria 2513237159 2514000605 275
129 iso_pu_bacteria 2513237160 2514004318 275
130 iso_pu_bacteria 2517487022 2517567588 275
131 iso_pu_bacteria 2524023207 2524453796 275
132 iso_pu_bacteria 2551306084 2551681749 275
133 iso_pu_bacteria 2551306085 2551685239 275
134 iso_pu_bacteria 2551306086 2551690481 275
135 iso_pu_bacteria 2551306091 2551729240 275
136 iso_pu_bacteria 2551306092 2551732445 275
137 iso_pu_bacteria 2599185210 2599605380 275
138 iso_pu_bacteria 2802428858 2802718218 275
139 iso_pu_bacteria 2802428859 2802725987 275
140 iso_pu_bacteria 2802428860 2802731301 275
141 iso_pu_bacteria 2802428861 2802736505 275
142 iso_pu_bacteria 2802428862 2802744480 275
143 iso_pu_bacteria 2802428863 2802749931 275
144 iso_pu_bacteria 2821123053 2821130512 275
145 iso_pu_bacteria 2838714209 2838719448 275
146 iso_pu_bacteria 2838719591 2838724839 275
147 iso_pu_bacteria 2842170452 2842175693 275
148 iso_pu_bacteria 2842187318 2842192565 275
149 iso_pu_bacteria 2842211629 2842216902 275
150 iso_pu_bacteria 2842224351 2842229586 275
151 iso_pu_bacteria 2842521101 2842523594 275
152 iso_pu_bacteria 2855825444 2855830065 275
153 iso_pu_bacteria 2855839649 2855844956 275
154 iso_pu_bacteria 2857531043 2857535792 275
155 iso_pu_bacteria 2858800743 2858804668 275
156 iso_pu_bacteria 2899845264 2899846068 275
157 iso_pu_bacteria 2915980308 2915986874 275
158 iso_pu_bacteria 2915993759 2915993975 275
159 iso_pu_bacteria 2916007675 2916010185 275
160 iso_pu_bacteria 2916014648 2916016306 275
161 iso_pu_bacteria 2916035215 2916040924 275
162 iso_pu_bacteria 2916041962 2916046206 275
163 iso_pu_bacteria 2916061851 2916063789 275
164 iso_pu_bacteria 2921237296 2921238128 275
165 iso_pu_bacteria 2921244191 2921247990 275
166 iso_pu_bacteria 2921250672 2921253471 275
167 iso_pu_bacteria 2921282425 2921286141 275
168 iso_pu_bacteria 2921289301 2921292761 275
169 iso_pu_bacteria 2921296804 2921304668 275
170 iso_pu_bacteria 2924144063 2924149764 275
171 iso_pu_bacteria 2924150972 2924153084 275
172 iso_pu_bacteria 2924165586 2924169742 275
173 iso_pu_bacteria 2924200457 2924203670 275
174 iso_pu_bacteria 2924207177 2924212389 275
175 iso_pu_bacteria 2924214083 2924221388 275
176 iso_pu_bacteria 2924221636 2924228148 275
177 iso_pu_bacteria 2924228884 2924231796 275
178 iso_pu_bacteria 2926754445 2926759778 275
179 iso_pu_bacteria 2928521798 2928526479 275
180 iso_pu_bacteria 2929212328 2929217331 275
181 iso_pu_bacteria 2937002841 2937003830 275
182 iso_pu_bacteria 2937016420 2937018893 275
183 iso_pu_bacteria 2937029754 2937035328 275
184 iso_pu_bacteria 2937036028 2937040085 275
185 iso_pu_bacteria 2937049772 2937053209 275
186 iso_pu_bacteria 2937071275 2937077794 275
187 iso_pu_bacteria 2937078374 2937079109 275
188 iso_pu_bacteria 2937084907 2937085026 275
189 iso_pu_bacteria 2937091812 2937095452 275
190 iso_pu_bacteria 2937126314 2937131380 275
191 iso_pu_bacteria 2937126314 2937131899 275
192 iso_pu_bacteria 2957375807 2957376168 275
193 iso_pu_bacteria 2957388812 2957391160 275
194 iso_pu_bacteria 2957408893 2957412192 275
195 iso_pu_bacteria 2957415311 2957420299 275
196 iso_pu_bacteria 2957430029 2957434473 275
197 iso_pu_bacteria 2957437181 2957440890 275
198 iso_pu_bacteria 2957464669 2957470034 275
199 iso_pu_bacteria 2957471148 2957477234 275
200 iso_pu_bacteria 2957484790 2957488319 275
201 iso_pu_bacteria 2957498199 2957501118 275
202 iso_pu_bacteria 2957505466 2957509840 275
203 iso_pu_bacteria 2960584000 2960586563 275
204 iso_pu_bacteria 2960591022 2960597537 275
205 iso_pu_bacteria 2960603979 2960606676 275
206 iso_pu_bacteria 2960624210 2960627755 275
207 iso_pu_bacteria 2960631154 2960636731 275
208 iso_pu_bacteria 2960680706 2960686235 275
209 iso_pu_bacteria 2960693952 2960696991 275
210 iso_pu_bacteria 2964621998 2964622014 275
211 iso_pu_bacteria 2964643177 2964648714 275
212 iso_pu_bacteria 2964649959 2964650684 275
213 iso_pu_bacteria 2964656573 2964656879 275
214 iso_pu_bacteria 2964663802 2964669497 275
215 iso_pu_bacteria 2964678106 2964684207 275
216 iso_pu_bacteria 2964685014 2964689652 275
217 iso_pu_bacteria 2964691889 2964697589 275
218 iso_pu_bacteria 2964705432 2964708257 275
219 iso_pu_bacteria 2964705432 2964712036 275
220 iso_pu_bacteria 2967699805 2967700076 275
221 iso_pu_bacteria 2967706974 2967713510 275
222 iso_pu_bacteria 2967714385 2967719205 275
223 iso_pu_bacteria 2967721400 2967727422 275
224 iso_pu_bacteria 2967728569 2967733256 275
225 iso_pu_bacteria 2967742019 2967748558 275
226 iso_pu_bacteria 2967748971 2967750590 275
227 iso_pu_bacteria 2967762386 2967765507 275
228 iso_pu_bacteria 2967769361 2967772442 275
229 iso_pu_bacteria 2970026789 2970031426 275
230 iso_pu_bacteria 2970040964 2970044233 275
231 iso_pu_bacteria 2970047711 2970049768 275
232 iso_pu_bacteria 2970054988 2970055781 275
233 iso_pu_bacteria 2970061556 2970061987 275
234 iso_pu_bacteria 2970088815 2970092431 275
235 iso_pu_bacteria 2970109326 2970115495 275
236 iso_pu_bacteria 2970116247 2970119432 275
237 iso_pu_bacteria 2970122695 2970127874 275
238 iso_pu_bacteria 2970136068 2970143000 275
239 iso_pu_bacteria 2970143518 2970147870 275
240 iso_pu_bacteria 2970149975 2970153451 275
241 iso_pu_bacteria 2970164137 2970166288 275
242 iso_pu_bacteria 2970170962 2970174848 275
243 iso_pu_bacteria 2970184632 2970191032 275
244 iso_pu_bacteria 2977523885 2977529358 275
245 iso_pu_bacteria 2977530762 2977536601 275
246 iso_pu_bacteria 2977537788 2977541266 275
247 iso_pu_bacteria 2977544691 2977548704 275
248 iso_pu_bacteria 2977558990 2977561529 275
249 iso_pu_bacteria 2977572785 2977574343 275
250 iso_pu_bacteria 2977579622 2977583157 275
251 iso_pu_bacteria 2979100975 2979103463 275
252 iso_pu_bacteria 648276728 648740006 275
253 iso_pu_bacteria 650716007 650741358 275
254 iso_pu_bacteria 8003999396 8004005129 275
255 3300028800 Ga0265338_10078879 Ga0265338_100788793 276
256 3300029957 Ga0265324_10026352 Ga0265324_100263522 276
257 3300031240 Ga0265320_10092178 Ga0265320_100921782 276
258 3300031250 Ga0265331_10026030 Ga0265331_100260302 276
259 3300031251 Ga0265327_10000201 Ga0265327_100002013 276
260 3300037466 Ga0395898_0487075 Ga0395898_0487075_130_978 276
261 3300045051 Ga0451576_0000002 Ga0451576_0000002_47062_47892 276
262 3300047472 Ga0495686_0002459 Ga0495686_0002459_3439_4281 276
263 3300049460 Ga0495682_0047346 Ga0495682_0047346_655_1497 276
264 3300053158 Ga0500627_0163141 Ga0500627_0163141_145_987 276
265 iso_pu_bacteria 2511231027 2511389336 276
266 iso_pu_bacteria 2765235802 2765464307 276
267 iso_pu_bacteria 2767802442 2770194643 276
268 iso_pu_bacteria 2775506902 2776272561 276
269 iso_pu_bacteria 2775506904 2776284502 276
270 iso_pu_bacteria 2839993093 2839994229 276
271 iso_pu_bacteria 2840764183 2840769379 276
272 iso_pu_bacteria 2842871566 2842873059 276
273 iso_pu_bacteria 2894652903 2894655406 276
274 iso_pu_bacteria 2902330777 2902335816 276
275 iso_pu_bacteria 2904578770 2904579103 276
276 iso_pu_bacteria 2919119836 2919122072 276
277 iso_pu_bacteria 2928521798 2928521985 276
278 iso_pu_bacteria 2954011201 2954014657 276
279 iso_pu_bacteria 3002141150 3002142622 276
280 3300005543 Ga0070672_100368532 Ga0070672_1003685321 277
281 3300005844 Ga0068862_100004646 Ga0068862_10000464610 277
282 3300006852 Ga0075433_10175931 Ga0075433_101759312 277
283 3300013102 Ga0157371_10000014 Ga0157371_10000014293 277
284 3300013306 Ga0163162_10084356 Ga0163162_100843562 277
285 3300013308 Ga0157375_10003153 Ga0157375_100031537 277
286 3300015265 Ga0182005_1000146 Ga0182005_100014614 277
287 3300025728 Ga0207655_1010327 Ga0207655_10103274 277
288 3300026095 Ga0207676_10069592 Ga0207676_100695922 277
289 3300028379 Ga0268266_10334608 Ga0268266_103346081 277
290 3300028380 Ga0268265_10059260 Ga0268265_100592604 277
291 3300028381 Ga0268264_10050954 Ga0268264_100509542 277
292 3300031250 Ga0265331_10000337 Ga0265331_1000033734 277
293 3300032002 Ga0307416_100150243 Ga0307416_1001502431 277
294 3300044694 Ga0466963_0025684 Ga0466963_0025684_2597_3478 277
295 3300046453 Ga0495627_000467 Ga0495627_000467_30184_31032 277
296 3300046458 Ga0495591_002675 Ga0495591_002675_3093_3941 277
297 3300046458 Ga0495591_018906 Ga0495591_018906_198_1067 277
298 3300046474 Ga0495605_0000209 Ga0495605_0000209_29298_30146 277
299 3300046501 Ga0495607_0018189 Ga0495607_0018189_3431_4279 277
300 3300046501 Ga0495607_0030510 Ga0495607_0030510_90_938 277
301 3300046501 Ga0495607_0056366 Ga0495607_0056366_297_1145 277
302 3300046501 Ga0495607_0078649 Ga0495607_0078649_857_1705 277
303 3300046501 Ga0495607_0123020 Ga0495607_0123020_90_938 277
304 3300046506 Ga0495583_0005498 Ga0495583_0005498_7700_8563 277
305 3300046507 Ga0495606_0002529 Ga0495606_0002529_17150_17998 277
306 3300046512 Ga0495610_0007517 Ga0495610_0007517_3614_4462 277
307 3300046515 Ga0495620_0001562 Ga0495620_0001562_5329_6177 277
308 3300046519 Ga0495632_0003406 Ga0495632_0003406_1521_2369 277
309 3300046522 Ga0495643_0026036 Ga0495643_0026036_837_1685 277
310 3300046530 Ga0495654_0000554 Ga0495654_0000554_12116_13030 277
311 3300046530 Ga0495654_0009684 Ga0495654_0009684_1661_2509 277
312 3300046538 Ga0495609_0066324 Ga0495609_0066324_233_1081 277
313 3300046558 Ga0495633_0069306 Ga0495633_0069306_152_1000 277
314 3300046665 Ga0495661_0000365 Ga0495661_0000365_5753_6601 277
315 3300046794 Ga0495589_0001286 Ga0495589_0001286_12330_13178 277
316 3300047323 Ga0495683_0000014 Ga0495683_0000014_149607_150476 277
317 3300047446 Ga0495679_008836 Ga0495679_008836_2412_3260 277
318 3300047470 Ga0495681_0005850 Ga0495681_0005850_3583_4431 277
319 3300047470 Ga0495681_0058409 Ga0495681_0058409_913_1761 277
320 3300048924 Ga0496121_0227343 Ga0496121_0227343_414_1259 277
321 3300053125 Ga0500618_001398 Ga0500618_001398_6744_7613 277
322 iso_pu_bacteria 2582581283 2585165694 277
323 iso_pu_bacteria 2643221636 2644200779 277
324 iso_pu_bacteria 2643221689 2644502271 277
325 iso_pu_bacteria 2945961074 2945965259 277
326 2162886007 SwRhRL2b_contig_1753856 SwRhRL2b_0915.00004170 278
327 2162886007 SwRhRL2b_contig_663477 SwRhRL2b_0384.00001390 278
328 2162886012 MBSR1b_contig_11807390 MBSR1b_0938.00006240 278
329 3300002705 JGI25156J39149_1000358 JGI25156J39149_10003589 278
330 3300003322 rootL2_10113107 rootL2_101131078 278
331 3300003322 rootL2_10128370 rootL2_101283702 278
332 3300003322 rootL2_10133946 rootL2_101339462 278
333 3300003323 rootH1_10004142 rootH1_100041425 278
334 3300003323 rootH1_10006645 rootH1_1000664541 278
335 3300003323 rootH1_10034883 rootH1_100348834 278
336 3300003323 rootH1_10120515 rootH1_101205154 278
337 3300003323 rootH1_10130918 rootH1_101309183 278
338 3300005262 Ga0065165_1001039 Ga0065165_100103915 278
339 3300005288 Ga0065714_10002453 Ga0065714_1000245324 278
340 3300005288 Ga0065714_10064538 Ga0065714_1006453837 278
341 3300005289 Ga0065704_10070224 Ga0065704_1007022457 278
342 3300005289 Ga0065704_10077043 Ga0065704_100770437 278
343 3300005289 Ga0065704_10215827 Ga0065704_102158271 278
344 3300005293 Ga0065715_10089350 Ga0065715_100893502 278
345 3300005293 Ga0065715_10307505 Ga0065715_103075051 278
346 3300005327 Ga0070658_10158150 Ga0070658_101581502 278
347 3300005329 Ga0070683_100020380 Ga0070683_1000203802 278
348 3300005331 Ga0070670_100000803 Ga0070670_10000080310 278
349 3300005331 Ga0070670_100419676 Ga0070670_1004196761 278
350 3300005334 Ga0068869_100003673 Ga0068869_1000036736 278
351 3300005338 Ga0068868_100002227 Ga0068868_10000222711 278
352 3300005338 Ga0068868_100007167 Ga0068868_1000071678 278
353 3300005338 Ga0068868_100015149 Ga0068868_1000151495 278
354 3300005340 Ga0070689_100373571 Ga0070689_1003735711 278
355 3300005344 Ga0070661_100124096 Ga0070661_1001240962 278
356 3300005347 Ga0070668_100005572 Ga0070668_1000055723 278
357 3300005353 Ga0070669_100016950 Ga0070669_1000169505 278
358 3300005355 Ga0070671_100033053 Ga0070671_1000330534 278
359 3300005355 Ga0070671_100423620 Ga0070671_1004236201 278
360 3300005356 Ga0070674_100050097 Ga0070674_1000500973 278
361 3300005364 Ga0070673_100150389 Ga0070673_1001503891 278
362 3300005364 Ga0070673_100233531 Ga0070673_1002335312 278
363 3300005365 Ga0070688_100134284 Ga0070688_1001342841 278
364 3300005367 Ga0070667_100023576 Ga0070667_1000235762 278
365 3300005434 Ga0070709_10006746 Ga0070709_100067467 278
366 3300005437 Ga0070710_10211802 Ga0070710_102118021 278
367 3300005439 Ga0070711_100221825 Ga0070711_1002218251 278
368 3300005440 Ga0070705_100077960 Ga0070705_1000779602 278
369 3300005456 Ga0070678_100351017 Ga0070678_1003510172 278
370 3300005459 Ga0068867_100005632 Ga0068867_1000056327 278
371 3300005459 Ga0068867_100035345 Ga0068867_1000353452 278
372 3300005466 Ga0070685_10019576 Ga0070685_100195763 278
373 3300005468 Ga0070707_100259161 Ga0070707_1002591612 278
374 3300005530 Ga0070679_100243399 Ga0070679_1002433992 278
375 3300005535 Ga0070684_100147237 Ga0070684_1001472372 278
376 3300005539 Ga0068853_100032190 Ga0068853_1000321904 278
377 3300005539 Ga0068853_100101278 Ga0068853_1001012783 278
378 3300005539 Ga0068853_100412004 Ga0068853_1004120042 278
379 3300005543 Ga0070672_100312039 Ga0070672_1003120392 278
380 3300005544 Ga0070686_100049160 Ga0070686_1000491603 278
381 3300005545 Ga0070695_100082867 Ga0070695_1000828671 278
382 3300005548 Ga0070665_100459185 Ga0070665_1004591852 278
383 3300005563 Ga0068855_100242320 Ga0068855_1002423202 278
384 3300005577 Ga0068857_100002340 Ga0068857_1000023408 278
385 3300005614 Ga0068856_100013759 Ga0068856_1000137598 278
386 3300005614 Ga0068856_100425255 Ga0068856_1004252552 278
387 3300005615 Ga0070702_100151436 Ga0070702_1001514362 278
388 3300005617 Ga0068859_100017642 Ga0068859_1000176426 278
389 3300005617 Ga0068859_100038682 Ga0068859_1000386825 278
390 3300005617 Ga0068859_100118652 Ga0068859_1001186524 278
391 3300005618 Ga0068864_100001905 Ga0068864_10000190511 278
392 3300005834 Ga0068851_10025300 Ga0068851_100253002 278
393 3300005840 Ga0068870_10009916 Ga0068870_100099162 278
394 3300005841 Ga0068863_100011110 Ga0068863_1000111104 278
395 3300005841 Ga0068863_100077255 Ga0068863_1000772552 278
396 3300005841 Ga0068863_100090690 Ga0068863_1000906903 278
397 3300005841 Ga0068863_100131692 Ga0068863_1001316923 278
398 3300005842 Ga0068858_100010823 Ga0068858_1000108232 278
399 3300005842 Ga0068858_100065885 Ga0068858_1000658853 278
400 3300005843 Ga0068860_100008883 Ga0068860_1000088839 278
401 3300005843 Ga0068860_100016505 Ga0068860_1000165052 278
402 3300005843 Ga0068860_100029432 Ga0068860_1000294324 278
403 3300005844 Ga0068862_100031008 Ga0068862_1000310082 278
404 3300006173 Ga0070716_100003254 Ga0070716_1000032544 278
405 3300006175 Ga0070712_100389337 Ga0070712_1003893371 278
406 3300006358 Ga0068871_100021427 Ga0068871_1000214275 278
407 3300006871 Ga0075434_100037978 Ga0075434_1000379786 278
408 3300006881 Ga0068865_100081392 Ga0068865_1000813922 278
409 3300006914 Ga0075436_100096673 Ga0075436_1000966733 278
410 3300006931 Ga0097620_100017642 Ga0097620_1000176423 278
411 3300006931 Ga0097620_100038682 Ga0097620_1000386825 278
412 3300006931 Ga0097620_100118641 Ga0097620_1001186414 278
413 3300009093 Ga0105240_10000126 Ga0105240_100001267 278
414 3300009093 Ga0105240_10127465 Ga0105240_101274652 278
415 3300009098 Ga0105245_10070061 Ga0105245_100700612 278
416 3300009101 Ga0105247_10011845 Ga0105247_100118452 278
417 3300009101 Ga0105247_10026726 Ga0105247_100267264 278
418 3300009148 Ga0105243_10764806 Ga0105243_107648061 278
419 3300009174 Ga0105241_10013819 Ga0105241_100138196 278
420 3300009177 Ga0105248_10015510 Ga0105248_100155105 278
421 3300009545 Ga0105237_10000233 Ga0105237_1000023370 278
422 3300009553 Ga0105249_10044658 Ga0105249_100446584 278
423 3300010375 Ga0105239_10000162 Ga0105239_1000016255 278
424 3300010375 Ga0105239_10015327 Ga0105239_100153274 278
425 3300011119 Ga0105246_10112741 Ga0105246_101127412 278
426 3300013100 Ga0157373_10000188 Ga0157373_100001888 278
427 3300013100 Ga0157373_10000354 Ga0157373_1000035413 278
428 3300013102 Ga0157371_10003045 Ga0157371_1000304511 278
429 3300013102 Ga0157371_10004764 Ga0157371_1000476410 278
430 3300013104 Ga0157370_10066063 Ga0157370_100660632 278
431 3300013104 Ga0157370_10213645 Ga0157370_102136451 278
432 3300013297 Ga0157378_10060685 Ga0157378_100606853 278
433 3300013306 Ga0163162_10017567 Ga0163162_100175677 278
434 3300013306 Ga0163162_10044672 Ga0163162_100446724 278
435 3300013306 Ga0163162_10079525 Ga0163162_100795252 278
436 3300013307 Ga0157372_10000458 Ga0157372_100004584 278
437 3300013308 Ga0157375_10311447 Ga0157375_103114472 278
438 3300014325 Ga0163163_10028458 Ga0163163_100284585 278
439 3300014325 Ga0163163_10036904 Ga0163163_100369044 278
440 3300014325 Ga0163163_10045349 Ga0163163_100453492 278
441 3300014497 Ga0182008_10000010 Ga0182008_10000010248 278
442 3300014968 Ga0157379_10010749 Ga0157379_100107492 278
443 3300014968 Ga0157379_10055520 Ga0157379_100555203 278
444 3300014969 Ga0157376_10036393 Ga0157376_100363933 278
445 3300015261 Ga0182006_1039114 Ga0182006_10391143 278
446 3300017792 Ga0163161_10012905 Ga0163161_100129054 278
447 3300025250 Ga0209026_1000704 Ga0209026_100070417 278
448 3300025250 Ga0209026_1000847 Ga0209026_10008472 278
449 3300025256 Ga0209759_1000626 Ga0209759_100062623 278
450 3300025900 Ga0207710_10008119 Ga0207710_100081196 278
451 3300025900 Ga0207710_10153900 Ga0207710_101539001 278
452 3300025903 Ga0207680_10041920 Ga0207680_100419203 278
453 3300025905 Ga0207685_10090085 Ga0207685_100900852 278
454 3300025906 Ga0207699_10115902 Ga0207699_101159022 278
455 3300025907 Ga0207645_10018440 Ga0207645_100184404 278
456 3300025909 Ga0207705_10178227 Ga0207705_101782271 278
457 3300025913 Ga0207695_10000013 Ga0207695_10000013330 278
458 3300025913 Ga0207695_10195887 Ga0207695_101958872 278
459 3300025914 Ga0207671_10001284 Ga0207671_1000128416 278
460 3300025916 Ga0207663_10234846 Ga0207663_102348462 278
461 3300025922 Ga0207646_10183652 Ga0207646_101836522 278
462 3300025923 Ga0207681_10017562 Ga0207681_100175622 278
463 3300025925 Ga0207650_10005238 Ga0207650_100052386 278
464 3300025931 Ga0207644_10051890 Ga0207644_100518903 278
465 3300025931 Ga0207644_10464244 Ga0207644_104642442 278
466 3300025933 Ga0207706_10035855 Ga0207706_100358556 278
467 3300025936 Ga0207670_10086287 Ga0207670_100862871 278
468 3300025937 Ga0207669_10027806 Ga0207669_100278062 278
469 3300025938 Ga0207704_10074734 Ga0207704_100747342 278
470 3300025938 Ga0207704_10154143 Ga0207704_101541432 278
471 3300025939 Ga0207665_10015274 Ga0207665_100152742 278
472 3300025941 Ga0207711_10009789 Ga0207711_100097897 278
473 3300025941 Ga0207711_10032570 Ga0207711_100325703 278
474 3300025942 Ga0207689_10000998 Ga0207689_1000099817 278
475 3300025944 Ga0207661_10004762 Ga0207661_100047622 278
476 3300025949 Ga0207667_10209955 Ga0207667_102099552 278
477 3300025960 Ga0207651_10058664 Ga0207651_100586644 278
478 3300025960 Ga0207651_10179596 Ga0207651_101795962 278
479 3300025961 Ga0207712_10001734 Ga0207712_1000173414 278
480 3300025961 Ga0207712_10010764 Ga0207712_100107642 278
481 3300025961 Ga0207712_10070216 Ga0207712_100702162 278
482 3300025972 Ga0207668_10006768 Ga0207668_100067682 278
483 3300026023 Ga0207677_10037406 Ga0207677_100374062 278
484 3300026035 Ga0207703_10000460 Ga0207703_1000046040 278
485 3300026035 Ga0207703_10075447 Ga0207703_100754472 278
486 3300026041 Ga0207639_10105458 Ga0207639_101054582 278
487 3300026041 Ga0207639_10143070 Ga0207639_101430703 278
488 3300026041 Ga0207639_10222004 Ga0207639_102220041 278
489 3300026041 Ga0207639_10442865 Ga0207639_104428651 278
490 3300026078 Ga0207702_10038898 Ga0207702_100388982 278
491 3300026088 Ga0207641_10076137 Ga0207641_100761373 278
492 3300026088 Ga0207641_10282402 Ga0207641_102824022 278
493 3300026088 Ga0207641_10452143 Ga0207641_104521432 278
494 3300026089 Ga0207648_10000298 Ga0207648_100002986 278
495 3300026089 Ga0207648_10062600 Ga0207648_100626003 278
496 3300026089 Ga0207648_10544598 Ga0207648_105445981 278
497 3300026095 Ga0207676_10207260 Ga0207676_102072602 278
498 3300026116 Ga0207674_10005636 Ga0207674_1000563611 278
499 3300026118 Ga0207675_100003275 Ga0207675_1000032752 278
500 3300026121 Ga0207683_10090488 Ga0207683_100904883 278
501 3300026121 Ga0207683_10272893 Ga0207683_102728932 278
502 3300028379 Ga0268266_10243754 Ga0268266_102437542 278
503 3300028380 Ga0268265_10003720 Ga0268265_100037205 278
504 3300028381 Ga0268264_10005582 Ga0268264_1000558211 278
505 3300028381 Ga0268264_10006975 Ga0268264_100069753 278
506 3300028381 Ga0268264_10069671 Ga0268264_100696712 278
507 3300031251 Ga0265327_10000013 Ga0265327_10000013381 278
508 3300031852 Ga0307410_10278836 Ga0307410_102788361 278
509 3300031901 Ga0307406_10191147 Ga0307406_101911472 278
510 3300031901 Ga0307406_10284318 Ga0307406_102843181 278
511 3300031911 Ga0307412_10000018 Ga0307412_10000018280 278
512 3300031995 Ga0307409_100064817 Ga0307409_1000648172 278
513 3300032004 Ga0307414_10001267 Ga0307414_1000126713 278
514 3300032004 Ga0307414_10652546 Ga0307414_106525461 278
515 3300032126 Ga0307415_100705215 Ga0307415_1007052151 278
516 3300033180 Ga0307510_10118659 Ga0307510_101186592 278
517 3300035115 Ga0373941_0073817 Ga0373941_0073817_220_1077 278
518 3300035121 Ga0373960_0007693 Ga0373960_0007693_759_1616 278
519 3300035691 Ga0373931_0253047 Ga0373931_0253047_167_1024 278
520 3300037312 Ga0395899_0055222 Ga0395899_0055222_1657_2499 278
521 3300037418 Ga0395900_0033833 Ga0395900_0033833_3943_4785 278
522 3300037471 Ga0395905_0018850 Ga0395905_0018850_1825_2667 278
523 3300038443 Ga0395901_0095262 Ga0395901_0095262_555_1397 278
524 3300039437 Ga0436365_1488383 Ga0436365_1488383_639_1487 278
525 3300042014 Ga0439457_011980 Ga0439457_011980_324_1160 278
526 3300042131 Ga0450894_004129 Ga0450894_004129_408_1244 278
527 3300046460 Ga0495638_0058090 Ga0495638_0058090_273_1109 278
528 3300046460 Ga0495638_0140060 Ga0495638_0140060_399_1241 278
529 3300046471 Ga0495650_0000447 Ga0495650_0000447_18957_19799 278
530 3300046471 Ga0495650_0109852 Ga0495650_0109852_155_997 278
531 3300046501 Ga0495607_0000003 Ga0495607_0000003_9947_10789 278
532 3300046506 Ga0495583_0019781 Ga0495583_0019781_1741_2583 278
533 3300046507 Ga0495606_0000844 Ga0495606_0000844_6390_7232 278
534 3300046507 Ga0495606_0005006 Ga0495606_0005006_518_1360 278
535 3300046512 Ga0495610_0013691 Ga0495610_0013691_1558_2400 278
536 3300046513 Ga0495616_0000538 Ga0495616_0000538_18880_19722 278
537 3300046519 Ga0495632_0060651 Ga0495632_0060651_543_1385 278
538 3300046538 Ga0495609_0040887 Ga0495609_0040887_1102_1944 278
539 3300046558 Ga0495633_0002987 Ga0495633_0002987_9982_10824 278
540 3300046660 Ga0495625_0000972 Ga0495625_0000972_18341_19183 278
541 3300046665 Ga0495661_0006736 Ga0495661_0006736_3516_4358 278
542 3300046674 Ga0495588_0013948 Ga0495588_0013948_1341_2195 278
543 3300046694 Ga0495649_0000014 Ga0495649_0000014_268292_269134 278
544 3300046694 Ga0495649_0000262 Ga0495649_0000262_38688_39542 278
545 3300046810 Ga0495660_0011460 Ga0495660_0011460_3140_3982 278
546 3300047320 Ga0495672_0000666 Ga0495672_0000666_29365_30240 278
547 3300047320 Ga0495672_0106100 Ga0495672_0106100_450_1295 278
548 3300047472 Ga0495686_0000913 Ga0495686_0000913_9599_10441 278
549 3300047472 Ga0495686_0001792 Ga0495686_0001792_893_1732 278
550 3300047472 Ga0495686_0099064 Ga0495686_0099064_822_1661 278
551 3300047472 Ga0495686_0189098 Ga0495686_0189098_225_1061 278
552 3300048904 Ga0496101_0001957 Ga0496101_0001957_7221_8072 278
553 3300048905 Ga0496102_0269569 Ga0496102_0269569_333_1187 278
554 3300048906 Ga0496103_0024336 Ga0496103_0024336_1737_2588 278
555 3300048906 Ga0496103_0025916 Ga0496103_0025916_2052_2906 278
556 3300048917 Ga0496114_0011813 Ga0496114_0011813_4098_5021 278
557 3300048920 Ga0496117_0044637 Ga0496117_0044637_1510_2361 278
558 3300048921 Ga0496118_0020578 Ga0496118_0020578_3199_4050 278
559 3300048921 Ga0496118_0054098 Ga0496118_0054098_1985_2836 278
560 3300048924 Ga0496121_0001262 Ga0496121_0001262_4380_5231 278
561 3300048924 Ga0496121_0018324 Ga0496121_0018324_3045_3899 278
562 3300049580 Ga0501046_0000045 Ga0501046_0000045_116238_117158 278
563 3300053093 Ga0500651_0009724 Ga0500651_0009724_2488_3324 278
564 3300053108 Ga0500562_030128 Ga0500562_030128_437_1273 278
565 3300053140 Ga0500573_0024559 Ga0500573_0024559_2548_3402 278
566 3300053727 Ga0500611_000059 Ga0500611_000059_45309_46145 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

231

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

244

0.93

PF08659

KR

KR domain

42

220

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e6o-assembly1.cif.gz_B crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.971 3 181
7e6o-assembly1.cif.gz_A crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9607 3 179
7e6o-assembly1.cif.gz_C crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9587 3 179
6pej-assembly1.cif.gz_B structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol 0.9585 3 179
8cxa-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound nad 0.9562 3 180
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.984 89 180 3.40.50.720
4e6pC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 3 181 3.40.50.720
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.957 44 180 3.40.50.720
af_Q54HW7_18_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9565 2 278 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9545 2 175 3.40.50.720
ID Description Score Start End GO Terms
AF-B9TNI3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase, putative (EC 1.1.1.62) 0.9962 2 242 GO:0004303
AF-A0A069P3N8-F1-model_v4 Short-chain dehydrogenase 0.9957 2 277 GO:0016491
AF-A0A1J5R4R8-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase FabG (EC 1.1.1.100) 0.9957 3 277 GO:0004316
AF-A0A7Y8VGN1-F1-model_v4 deleted 0.995 3 177
AF-A0A2U0YY65-F1-model_v4 deleted 0.9948 2 276

Feature Viewer

pLDDT pTM Quality
96.76 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map