F464267

General Info

Members Datasets Scaffolds Average Seq Length
565 340 1130 258

Family's Representative Sequence

Representative Sequence 3300024227|Ga0228598_1014508|Ga0228598_10145083
Length 264
Sequence MSTRIETIQEHVSSPGHLAGRIVAFFYGIAAYGVFFVTFLFAVGFVEDLVVPKTIDGGSGAPAAPLLQTLMLNVVLMSIFAVQHSVMARPQFKRRWTKFVPTSIERTTYVLLASLALALLIWQWRPMPAIVWRIADPRLAAALIGLSFLGWLIVLTSTFLINHFELFGLHQVTNNLAGRPMPAPRFRSPLLYRFVRHPIYLGFIIAFWAAPTMTQGHLLFAAVTTSYILVGIYLEERDLVAVFGEEYRRYRERVSMLVPWRRSA

Samples

Sample ID Description Type Environment
1 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
275 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
276 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
279 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
289 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
290 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
291 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
292 2791355199
293 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
294 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
295 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
296 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
297 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
298 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
299 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
300 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
301 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
302 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
303 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
304 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
305 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
306 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
307 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
308 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
309 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
310 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
311 2922368715
312 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
313 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
314 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
315 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
316 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
317 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
318 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
319 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
320 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
321 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
322 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
323 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
324 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
325 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
326 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
327 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
328 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
329 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
330 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
331 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
332 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
333 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
334 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
335 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
336 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
337 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
338 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
339 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
340 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.41
Metatranscriptomes 0
Isolates 9.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.73
Nodule 7.43
Rhizoplane 8.32
Rhizosphere 67.96
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0228598_1014508 3300024227 Bacteria 1559
2 JGI25153J46596_10005767 3300003215 Bacteria 6450
3 rootH2_10086155 3300003320 Bacteria 2280
4 JGI25404J52841_10005883 3300003659 Bacteria 2544
5 Ga0070658_10266411 3300005327 Bacteria 1456
6 Ga0070670_100000007 3300005331 Bacteria 318672
7 Ga0070670_100105213 3300005331 Bacteria 2431
8 Ga0070666_10181658 3300005335 Bacteria 1476
9 Ga0070680_100006521 3300005336 Bacteria 8875
10 Ga0070680_100552042 3300005336 Unclassified 987
11 Ga0070682_100014439 3300005337 Bacteria 4564
12 Ga0070682_100055989 3300005337 Bacteria 2479
13 Ga0068868_100117289 3300005338 Bacteria 2169
14 Ga0070660_100228212 3300005339 Bacteria 1515
15 Ga0070668_100000272 3300005347 Bacteria 34235
16 Ga0070668_100015445 3300005347 Bacteria 5707
17 Ga0070668_100266956 3300005347 Bacteria 1425
18 Ga0070669_100300752 3300005353 Bacteria 1290
19 Ga0070675_100216666 3300005354 Bacteria 1666
20 Ga0070671_100345203 3300005355 Bacteria 1270
21 Ga0070671_100376081 3300005355 Bacteria 1214
22 Ga0070673_100506009 3300005364 Bacteria 1093
23 Ga0070688_100095622 3300005365 Bacteria 1950
24 Ga0070688_100306263 3300005365 Bacteria 1150
25 Ga0070667_100000291 3300005367 Bacteria 56512
26 Ga0070667_100079987 3300005367 Bacteria 2795
27 Ga0070709_10005766 3300005434 Bacteria 6717
28 Ga0070709_10009329 3300005434 Bacteria 5407
29 Ga0070714_100654529 3300005435 Bacteria 1011
30 Ga0070713_100071130 3300005436 Bacteria 2939
31 Ga0070710_10008177 3300005437 Bacteria 5087
32 Ga0070711_100124084 3300005439 Bacteria 1914
33 Ga0070711_100131934 3300005439 Bacteria 1862
34 Ga0070711_100301909 3300005439 Bacteria 1273
35 Ga0070711_100365957 3300005439 Bacteria 1162
36 Ga0070708_100055036 3300005445 Bacteria 3537
37 Ga0070663_100003582 3300005455 Bacteria 8971
38 Ga0070678_100026340 3300005456 Bacteria 3929
39 Ga0070678_100104752 3300005456 Bacteria 2200
40 Ga0070678_100473470 3300005456 Bacteria 1101
41 Ga0070662_100378751 3300005457 Bacteria 1164
42 Ga0070681_10008020 3300005458 Bacteria 10339
43 Ga0070681_10241075 3300005458 Bacteria 1722
44 Ga0068867_100227185 3300005459 Unclassified 1507
45 Ga0070707_100042523 3300005468 Bacteria 4350
46 Ga0070679_100384868 3300005530 Bacteria 1349
47 Ga0068853_100132345 3300005539 Bacteria 2234
48 Ga0068853_100171794 3300005539 Bacteria 1961
49 Ga0068853_100438863 3300005539 Bacteria 1226
50 Ga0070672_100150473 3300005543 Bacteria 1925
51 Ga0070686_100555156 3300005544 Bacteria 899
52 Ga0070693_100055025 3300005547 Bacteria 2291
53 Ga0070665_100003234 3300005548 Bacteria 17509
54 Ga0070665_100010298 3300005548 Bacteria 9459
55 Ga0070665_100016020 3300005548 Bacteria 7525
56 Ga0070665_100187191 3300005548 Bacteria 2071
57 Ga0070665_100455978 3300005548 Bacteria 1288
58 Ga0070704_100057507 3300005549 Bacteria 2766
59 Ga0068855_100163429 3300005563 Bacteria 2525
60 Ga0068855_100329170 3300005563 Bacteria 1687
61 Ga0070664_100060359 3300005564 Bacteria 3229
62 Ga0068857_100160833 3300005577 Bacteria 2038
63 Ga0068854_100044610 3300005578 Bacteria 3148
64 Ga0068854_100146121 3300005578 Bacteria 1819
65 Ga0068854_100542925 3300005578 Bacteria 985
66 Ga0068856_100007962 3300005614 Bacteria 10350
67 Ga0068856_100167307 3300005614 Bacteria 2210
68 Ga0068856_100398453 3300005614 Bacteria 1396
69 Ga0070702_100190904 3300005615 Bacteria 1348
70 Ga0068852_100073621 3300005616 Bacteria 3006
71 Ga0068852_100268747 3300005616 Bacteria 1640
72 Ga0068859_100020603 3300005617 Bacteria 6616
73 Ga0068859_100115233 3300005617 Bacteria 2752
74 Ga0068859_100310837 3300005617 Bacteria 1669
75 Ga0068864_100000602 3300005618 Bacteria 30531
76 Ga0068864_100184050 3300005618 Bacteria 1911
77 Ga0068851_10031799 3300005834 Bacteria 2623
78 Ga0068863_100002394 3300005841 Bacteria 18650
79 Ga0068863_100003290 3300005841 Bacteria 15951
80 Ga0068858_100007017 3300005842 Bacteria 10945
81 Ga0068858_100038829 3300005842 Bacteria 4416
82 Ga0068858_100590713 3300005842 Bacteria 1077
83 Ga0068858_100610961 3300005842 Bacteria 1058
84 Ga0068860_100000047 3300005843 Bacteria 213287
85 Ga0068860_100158620 3300005843 Bacteria 2181
86 Ga0068860_100920864 3300005843 Bacteria 891
87 Ga0068862_100004658 3300005844 Bacteria 11555
88 Ga0068862_100126419 3300005844 Bacteria 2257
89 Ga0081455_10164781 3300005937 Bacteria 1695
90 Ga0081540_1004421 3300005983 Bacteria 10725
91 Ga0081540_1009221 3300005983 Bacteria 6805
92 Ga0081540_1016872 3300005983 Bacteria 4547
93 Ga0081540_1019984 3300005983 Bacteria 4046
94 Ga0081539_10056696 3300005985 Bacteria 2173
95 Ga0070717_10562982 3300006028 Bacteria 1032
96 Ga0075365_10011931 3300006038 Bacteria 5133
97 Ga0075365_10065447 3300006038 Bacteria 2436
98 Ga0075365_10405701 3300006038 Bacteria 962
99 Ga0075365_10435302 3300006038 Bacteria 926
100 Ga0075368_10011351 3300006042 Bacteria 3240
101 Ga0075363_100015694 3300006048 Bacteria 3728
102 Ga0075363_100073289 3300006048 Bacteria 1863
103 Ga0075363_100111925 3300006048 Bacteria 1518
104 Ga0075364_10051887 3300006051 Bacteria 2679
105 Ga0070715_10001142 3300006163 Bacteria 7591
106 Ga0070716_100012226 3300006173 Bacteria 4346
107 Ga0070716_100045261 3300006173 Bacteria 2470
108 Ga0070712_100032267 3300006175 Bacteria 3535
109 Ga0070712_100153243 3300006175 Bacteria 1772
110 Ga0070712_100215504 3300006175 Bacteria 1517
111 Ga0075367_10009022 3300006178 Bacteria 5194
112 Ga0075367_10024731 3300006178 Bacteria 3388
113 Ga0075367_10109196 3300006178 Bacteria 1697
114 Ga0075367_10135113 3300006178 Bacteria 1525
115 Ga0075367_10141687 3300006178 Bacteria 1489
116 Ga0075366_10081008 3300006195 Bacteria 1939
117 Ga0097621_100025798 3300006237 Bacteria 4601
118 Ga0097621_100145456 3300006237 Bacteria 2029
119 Ga0075370_10006007 3300006353 Bacteria 6081
120 Ga0075370_10076082 3300006353 Bacteria 1925
121 Ga0075370_10078522 3300006353 Bacteria 1895
122 Ga0075428_100105629 3300006844 Bacteria 3070
123 Ga0075434_100115043 3300006871 Bacteria 2702
124 Ga0068865_100031677 3300006881 Bacteria 3527
125 Ga0068865_100035084 3300006881 Bacteria 3371
126 Ga0068865_100057174 3300006881 Bacteria 2720
127 Ga0075436_100009604 3300006914 Bacteria 6622
128 Ga0097620_100020603 3300006931 Bacteria 6616
129 Ga0097620_100115234 3300006931 Bacteria 2752
130 Ga0097620_100310853 3300006931 Bacteria 1669
131 Ga0105250_10010684 3300009092 Bacteria 3823
132 Ga0105240_10247050 3300009093 Bacteria 2065
133 Ga0105240_10285898 3300009093 Bacteria 1893
134 Ga0105240_10875195 3300009093 Bacteria 968
135 Ga0111539_10700715 3300009094 Bacteria 1179
136 Ga0105247_10008386 3300009101 Bacteria 6300
137 Ga0105247_10086275 3300009101 Bacteria 1986
138 Ga0105247_10216945 3300009101 Bacteria 1293
139 Ga0105241_10015022 3300009174 Bacteria 5671
140 Ga0105241_10021256 3300009174 Bacteria 4796
141 Ga0105241_10068374 3300009174 Bacteria 2752
142 Ga0105241_10305493 3300009174 Bacteria 1367
143 Ga0105242_10045521 3300009176 Bacteria 3556
144 Ga0105242_10072239 3300009176 Bacteria 2865
145 Ga0105248_10020021 3300009177 Bacteria 7409
146 Ga0105248_10064445 3300009177 Bacteria 4114
147 Ga0105248_10121315 3300009177 Bacteria 2949
148 Ga0105237_10037442 3300009545 Bacteria 4904
149 Ga0105237_10063110 3300009545 Bacteria 3703
150 Ga0105237_10376234 3300009545 Bacteria 1425
151 Ga0105238_10014119 3300009551 Bacteria 8076
152 Ga0105238_10069504 3300009551 Bacteria 3522
153 Ga0105238_10121756 3300009551 Bacteria 2588
154 Ga0105249_10035579 3300009553 Bacteria 4516
155 Ga0105249_10036033 3300009553 Unclassified 4488
156 Ga0105249_10942970 3300009553 Bacteria 931
157 Ga0105239_10042593 3300010375 Bacteria 4974
158 Ga0105239_10052568 3300010375 Bacteria 4468
159 Ga0105239_10085045 3300010375 Bacteria 3485
160 Ga0105239_10163130 3300010375 Bacteria 2491
161 Ga0105246_10024427 3300011119 Bacteria 3927
162 Ga0105246_10124930 3300011119 Bacteria 1913
163 Ga0105246_10143365 3300011119 Bacteria 1799
164 Ga0105246_10304214 3300011119 Bacteria 1289
165 Ga0157370_10018226 3300013104 Bacteria 7064
166 Ga0157369_10112023 3300013105 Bacteria 2899
167 Ga0157374_10251054 3300013296 Bacteria 1741
168 Ga0157378_10163185 3300013297 Bacteria 2085
169 Ga0157378_11051713 3300013297 Bacteria 850
170 Ga0163162_10017064 3300013306 Bacteria 7103
171 Ga0163162_10056854 3300013306 Bacteria 3940
172 Ga0163162_10368895 3300013306 Bacteria 1569
173 Ga0163162_10510094 3300013306 Bacteria 1333
174 Ga0157372_10039160 3300013307 Bacteria 5233
175 Ga0157372_10196432 3300013307 Bacteria 2337
176 Ga0157372_10355607 3300013307 Bacteria 1706
177 Ga0157375_10123158 3300013308 Bacteria 2705
178 Ga0157375_10232115 3300013308 Bacteria 2004
179 Ga0157375_10343820 3300013308 Bacteria 1657
180 Ga0163163_10019480 3300014325 Bacteria 6373
181 Ga0163163_10060930 3300014325 Bacteria 3738
182 Ga0163163_10089963 3300014325 Bacteria 3083
183 Ga0163163_10539984 3300014325 Bacteria 1228
184 Ga0163163_10569636 3300014325 Unclassified 1195
185 Ga0163163_10741898 3300014325 Bacteria 1045
186 Ga0157380_10063301 3300014326 Bacteria 2965
187 Ga0157380_10086406 3300014326 Bacteria 2577
188 Ga0157379_10076576 3300014968 Bacteria 2995
189 Ga0157379_10104367 3300014968 Bacteria 2544
190 Ga0157379_10320461 3300014968 Bacteria 1415
191 Ga0157376_10012548 3300014969 Bacteria 6293
192 Ga0157376_10029471 3300014969 Bacteria 4371
193 Ga0157376_10053374 3300014969 Bacteria 3365
194 Ga0163161_10534481 3300017792 Bacteria 959
195 Ga0209758_1001959 3300025297 Bacteria 22262
196 Ga0209758_1003253 3300025297 Bacteria 15067
197 Ga0209051_1004879 3300025303 Bacteria 8046
198 Ga0207692_10028158 3300025898 Bacteria 2654
199 Ga0207692_10280989 3300025898 Bacteria 1007
200 Ga0207642_10235482 3300025899 Bacteria 1031
201 Ga0207710_10018369 3300025900 Bacteria 2974
202 Ga0207680_10164617 3300025903 Bacteria 1490
203 Ga0207699_10174802 3300025906 Bacteria 1439
204 Ga0207699_10193644 3300025906 Bacteria 1373
205 Ga0207684_10333009 3300025910 Bacteria 1308
206 Ga0207654_10001534 3300025911 Bacteria 12159
207 Ga0207654_10016365 3300025911 Bacteria 3861
208 Ga0207654_10022763 3300025911 Bacteria 3347
209 Ga0207654_10110818 3300025911 Bacteria 1707
210 Ga0207707_10004831 3300025912 Bacteria 11819
211 Ga0207695_10000883 3300025913 Bacteria 54495
212 Ga0207695_10044279 3300025913 Bacteria 4735
213 Ga0207671_10478325 3300025914 Bacteria 993
214 Ga0207693_10025517 3300025915 Bacteria 4686
215 Ga0207693_10076675 3300025915 Bacteria 2618
216 Ga0207693_10212602 3300025915 Bacteria 1520
217 Ga0207663_10151934 3300025916 Bacteria 1625
218 Ga0207663_10163987 3300025916 Bacteria 1572
219 Ga0207660_10074189 3300025917 Bacteria 2482
220 Ga0207660_10470291 3300025917 Unclassified 1018
221 Ga0207657_10169746 3300025919 Bacteria 1768
222 Ga0207652_10003656 3300025921 Bacteria 12658
223 Ga0207681_10279429 3300025923 Bacteria 1314
224 Ga0207694_10006086 3300025924 Bacteria 9223
225 Ga0207694_10049365 3300025924 Bacteria 3258
226 Ga0207694_10144981 3300025924 Bacteria 1911
227 Ga0207650_10000033 3300025925 Bacteria 226809
228 Ga0207650_10134790 3300025925 Bacteria 1936
229 Ga0207700_10049120 3300025928 Bacteria 3137
230 Ga0207700_10131409 3300025928 Bacteria 2044
231 Ga0207644_10146018 3300025931 Bacteria 1826
232 Ga0207644_10259209 3300025931 Bacteria 1390
233 Ga0207706_10050502 3300025933 Bacteria 3675
234 Ga0207706_10094732 3300025933 Bacteria 2627
235 Ga0207706_10529126 3300025933 Bacteria 1016
236 Ga0207709_10015308 3300025935 Bacteria 4253
237 Ga0207709_10338902 3300025935 Bacteria 1131
238 Ga0207669_10271894 3300025937 Bacteria 1273
239 Ga0207704_10022494 3300025938 Bacteria 3379
240 Ga0207704_10111386 3300025938 Bacteria 1851
241 Ga0207665_10008742 3300025939 Bacteria 6662
242 Ga0207665_10080294 3300025939 Bacteria 2243
243 Ga0207691_10058156 3300025940 Bacteria 3517
244 Ga0207711_10064556 3300025941 Bacteria 3163
245 Ga0207689_10044978 3300025942 Bacteria 3651
246 Ga0207689_10107352 3300025942 Bacteria 2294
247 Ga0207661_10180607 3300025944 Bacteria 1843
248 Ga0207679_10006975 3300025945 Bacteria 7159
249 Ga0207679_10039760 3300025945 Bacteria 3361
250 Ga0207679_10681738 3300025945 Bacteria 931
251 Ga0207667_10286511 3300025949 Bacteria 1683
252 Ga0207651_10507146 3300025960 Bacteria 1044
253 Ga0207712_10013494 3300025961 Bacteria 5239
254 Ga0207668_10000874 3300025972 Bacteria 18178
255 Ga0207668_10040566 3300025972 Bacteria 3142
256 Ga0207668_10078244 3300025972 Bacteria 2387
257 Ga0207668_10293735 3300025972 Bacteria 1338
258 Ga0207640_10173040 3300025981 Bacteria 1611
259 Ga0207658_10000323 3300025986 Bacteria 48151
260 Ga0207677_10058426 3300026023 Bacteria 2655
261 Ga0207677_10126954 3300026023 Bacteria 1929
262 Ga0207677_10269123 3300026023 Bacteria 1393
263 Ga0207703_10000065 3300026035 Bacteria 126087
264 Ga0207703_10023981 3300026035 Bacteria 4799
265 Ga0207639_10190919 3300026041 Bacteria 1750
266 Ga0207639_10359205 3300026041 Bacteria 1303
267 Ga0207678_10004639 3300026067 Bacteria 12341
268 Ga0207678_10013383 3300026067 Bacteria 7200
269 Ga0207678_10030358 3300026067 Bacteria 4719
270 Ga0207678_10067010 3300026067 Bacteria 3082
271 Ga0207702_10000005 3300026078 Bacteria 420296
272 Ga0207702_10052014 3300026078 Bacteria 3464
273 Ga0207641_10001956 3300026088 Bacteria 19735
274 Ga0207641_10014543 3300026088 Bacteria 6449
275 Ga0207648_10034362 3300026089 Bacteria 4469
276 Ga0207676_10000135 3300026095 Bacteria 64914
277 Ga0207676_10205114 3300026095 Bacteria 1745
278 Ga0207674_10053514 3300026116 Bacteria 4114
279 Ga0207674_10104724 3300026116 Bacteria 2807
280 Ga0207683_10052351 3300026121 Bacteria 3577
281 Ga0207683_10360216 3300026121 Bacteria 1336
282 Ga0207698_10191263 3300026142 Bacteria 1823
283 Ga0207698_10615445 3300026142 Bacteria 1072
284 Ga0268266_10002693 3300028379 Bacteria 18642
285 Ga0268266_10010918 3300028379 Bacteria 7906
286 Ga0268266_10053456 3300028379 Bacteria 3470
287 Ga0268266_10125342 3300028379 Bacteria 2291
288 Ga0268266_10221988 3300028379 Bacteria 1737
289 Ga0268266_10465545 3300028379 Bacteria 1203
290 Ga0268265_10002613 3300028380 Bacteria 13402
291 Ga0268265_10005223 3300028380 Bacteria 8892
292 Ga0268265_10668714 3300028380 Bacteria 1000
293 Ga0268264_10000205 3300028381 Bacteria 120743
294 Ga0307408_100422836 3300031548 Bacteria 1149
295 Ga0307409_100227201 3300031995 Bacteria 1689
296 Ga0307510_10032760 3300033180 Bacteria 5850
297 Ga0373934_0002999 3300035086 Bacteria 6168
298 Ga0373940_0045965 3300035088 Bacteria 1214
299 Ga0373944_0033791 3300035089 Bacteria 1551
300 Ga0373952_0002709 3300035092 Bacteria 3198
301 Ga0373923_0000787 3300035111 Bacteria 8263
302 Ga0373932_0108671 3300035112 Bacteria 911
303 Ga0373936_0034982 3300035113 Bacteria 1998
304 Ga0373953_0002598 3300035117 Bacteria 5464
305 Ga0373956_0002577 3300035119 Bacteria 7362
306 Ga0373955_0014397 3300035172 Bacteria 3846
307 Ga0373955_0135019 3300035172 Bacteria 1443
308 Ga0373961_0050125 3300035241 Unclassified 1236
309 Ga0373931_0003411 3300035691 Bacteria 7131
310 Ga0373935_0010235 3300035692 Bacteria 5620
311 Ga0373927_0000330 3300035695 Bacteria 37192
312 Ga0373927_0016510 3300035695 Bacteria 4869
313 Ga0373927_0088277 3300035695 Bacteria 2013
314 Ga0373927_0263283 3300035695 Bacteria 1134
315 Ga0373933_0102306 3300035724 Bacteria 1778
316 Ga0373933_0130365 3300035724 Bacteria 1581
317 Ga0373947_0159772 3300035725 Bacteria 1457
318 Ga0373937_0019713 3300036401 Bacteria 6040
319 Ga0373937_0025873 3300036401 Bacteria 5299
320 Ga0373925_0000189 3300037068 Bacteria 67044
321 Ga0373925_0003748 3300037068 Bacteria 11674
322 Ga0373925_0106074 3300037068 Bacteria 2166
323 Ga0395898_0005504 3300037466 Bacteria 13670
324 Ga0395901_0305787 3300038443 Bacteria 1648
325 Ga0436360_0071803 3300039438 Bacteria 10618
326 Ga0466963_0145824 3300044694 Bacteria 1642
327 Ga0466968_0177882 3300044735 Bacteria 988
328 Ga0466959_0204902 3300045049 Bacteria 1372
329 Ga0466959_0279325 3300045049 Bacteria 1146
330 Ga0451576_0238954 3300045051 Bacteria 1898
331 Ga0466967_0480894 3300045976 Bacteria 1217
332 Ga0495592_0000440 3300046454 Bacteria 31213
333 Ga0495592_0011779 3300046454 Bacteria 6625
334 Ga0495590_0030546 3300046457 Bacteria 1888
335 Ga0495641_0091431 3300046461 Bacteria 1360
336 Ga0495651_0001974 3300046462 Bacteria 15891
337 Ga0495653_0041205 3300046463 Bacteria 3605
338 Ga0495580_0033754 3300046472 Bacteria 3685
339 Ga0495582_0004751 3300046473 Bacteria 7638
340 Ga0495605_0056077 3300046474 Bacteria 1901
341 Ga0495605_0084130 3300046474 Bacteria 1484
342 Ga0495662_0054807 3300046476 Bacteria 1926
343 Ga0495664_0269279 3300046477 Bacteria 1029
344 Ga0495584_0028917 3300046491 Bacteria 2809
345 Ga0495584_0134615 3300046491 Bacteria 1254
346 Ga0495585_0037608 3300046492 Bacteria 2725
347 Ga0495585_0045574 3300046492 Bacteria 2447
348 Ga0495594_0110631 3300046499 Bacteria 1549
349 Ga0495606_0143477 3300046507 Bacteria 1408
350 Ga0495608_0007439 3300046511 Bacteria 7737
351 Ga0495610_0045805 3300046512 Bacteria 2162
352 Ga0495618_0010345 3300046514 Bacteria 5645
353 Ga0495628_0001182 3300046516 Bacteria 23838
354 Ga0495630_0002384 3300046517 Bacteria 13057
355 Ga0495631_0018925 3300046518 Bacteria 3236
356 Ga0495643_0053714 3300046522 Bacteria 2159
357 Ga0495644_0062067 3300046523 Bacteria 1404
358 Ga0495666_0007700 3300046526 Bacteria 5387
359 Ga0495652_0000852 3300046529 Bacteria 35119
360 Ga0495652_0049980 3300046529 Bacteria 3577
361 Ga0495665_0014336 3300046531 Bacteria 4275
362 Ga0495586_0006398 3300046535 Bacteria 6291
363 Ga0495587_0002215 3300046536 Bacteria 13002
364 Ga0495609_0061852 3300046538 Bacteria 1654
365 Ga0495609_0088899 3300046538 Bacteria 1344
366 Ga0495645_0000523 3300046543 Bacteria 26523
367 Ga0495645_0065411 3300046543 Bacteria 2630
368 Ga0495622_0064476 3300046557 Bacteria 1694
369 Ga0495622_0095376 3300046557 Bacteria 1365
370 Ga0495633_0075553 3300046558 Bacteria 1569
371 Ga0495667_0023692 3300046559 Bacteria 4134
372 Ga0495656_0010986 3300046615 Bacteria 3311
373 Ga0495668_0129018 3300046616 Bacteria 1384
374 Ga0495634_0178358 3300046642 Bacteria 1331
375 Ga0495625_0087742 3300046660 Bacteria 2156
376 Ga0495635_0034909 3300046663 Bacteria 3488
377 Ga0495659_0026766 3300046664 Bacteria 1985
378 Ga0495657_0004303 3300046675 Bacteria 11367
379 Ga0495657_0161794 3300046675 Bacteria 1385
380 Ga0495599_0003877 3300046678 Bacteria 8797
381 Ga0495599_0004742 3300046678 Bacteria 8078
382 Ga0495647_0000817 3300046681 Bacteria 9291
383 Ga0495658_0010206 3300046683 Bacteria 4694
384 Ga0495669_0062168 3300046684 Bacteria 1691
385 Ga0495613_0011074 3300046689 Bacteria 6696
386 Ga0495624_0029620 3300046690 Bacteria 3570
387 Ga0495624_0324757 3300046690 Bacteria 927
388 Ga0495649_0055872 3300046694 Bacteria 2132
389 Ga0495600_0010860 3300046809 Bacteria 5663
390 Ga0495674_0003704 3300047319 Bacteria 14856
391 Ga0495680_0004918 3300047322 Bacteria 12651
392 Ga0495675_0017080 3300047444 Bacteria 4595
393 Ga0495685_017938 3300047447 Bacteria 2426
394 Ga0495673_0166671 3300047469 Bacteria 842
395 Ga0495684_0097173 3300047471 Bacteria 2228
396 Ga0495686_0048504 3300047472 Bacteria 2677
397 Ga0496100_0021621 3300048903 Bacteria 3879
398 Ga0496100_0167852 3300048903 Bacteria 1578
399 Ga0496101_0070409 3300048904 Bacteria 2561
400 Ga0496101_0116957 3300048904 Bacteria 2012
401 Ga0496101_0176128 3300048904 Bacteria 1645
402 Ga0496101_0265036 3300048904 Bacteria 1341
403 Ga0496102_0008179 3300048905 Bacteria 8951
404 Ga0496102_0035287 3300048905 Bacteria 4501
405 Ga0496102_0050458 3300048905 Bacteria 3788
406 Ga0496102_0146924 3300048905 Bacteria 2213
407 Ga0496103_0021743 3300048906 Bacteria 3861
408 Ga0496103_0157950 3300048906 Bacteria 1454
409 Ga0496104_0029379 3300048907 Bacteria 5098
410 Ga0496104_0034728 3300048907 Bacteria 4703
411 Ga0496104_0177238 3300048907 Bacteria 2042
412 Ga0496104_0474442 3300048907 Bacteria 1162
413 Ga0496105_0008328 3300048908 Bacteria 8058
414 Ga0496105_0028606 3300048908 Bacteria 4558
415 Ga0496105_0076839 3300048908 Bacteria 2757
416 Ga0496106_0010473 3300048909 Bacteria 6847
417 Ga0496106_0010853 3300048909 Bacteria 6731
418 Ga0496106_0262869 3300048909 Unclassified 1381
419 Ga0496107_0009111 3300048910 Bacteria 6882
420 Ga0496107_0021982 3300048910 Bacteria 4506
421 Ga0496107_0024979 3300048910 Bacteria 4229
422 Ga0496108_0072369 3300048911 Bacteria 2909
423 Ga0496108_0137587 3300048911 Bacteria 2103
424 Ga0496109_0039004 3300048912 Bacteria 4298
425 Ga0496109_0133061 3300048912 Bacteria 2322
426 Ga0496110_0044291 3300048913 Bacteria 3886
427 Ga0496111_0086562 3300048914 Bacteria 2293
428 Ga0496111_0405343 3300048914 Bacteria 1007
429 Ga0496112_0040347 3300048915 Bacteria 4564
430 Ga0496112_0316058 3300048915 Bacteria 1506
431 Ga0496112_0452534 3300048915 Bacteria 1221
432 Ga0496113_0013831 3300048916 Bacteria 5483
433 Ga0496113_0130198 3300048916 Bacteria 1974
434 Ga0496113_0483072 3300048916 Bacteria 995
435 Ga0496114_0083707 3300048917 Bacteria 2699
436 Ga0496114_0140852 3300048917 Bacteria 2088
437 Ga0496114_0495586 3300048917 Bacteria 1081
438 Ga0496115_0001003 3300048918 Bacteria 20483
439 Ga0496115_0024369 3300048918 Bacteria 4702
440 Ga0496115_0030075 3300048918 Bacteria 4270
441 Ga0496115_0037215 3300048918 Bacteria 3856
442 Ga0496115_0061677 3300048918 Bacteria 3023
443 Ga0496115_0133846 3300048918 Bacteria 2044
444 Ga0496116_0010567 3300048919 Bacteria 7721
445 Ga0496117_0078928 3300048920 Bacteria 2171
446 Ga0496118_0078106 3300048921 Bacteria 2344
447 Ga0496118_0124990 3300048921 Bacteria 1667
448 Ga0496118_0261676 3300048921 Bacteria 976
449 Ga0496119_0001434 3300048922 Bacteria 28747
450 Ga0496119_0091383 3300048922 Bacteria 1729
451 Ga0496120_0000191 3300048923 Bacteria 105146
452 Ga0496121_0000194 3300048924 Bacteria 136324
453 Ga0496121_0014106 3300048924 Bacteria 8518
454 Ga0496121_0016456 3300048924 Bacteria 7634
455 Ga0496121_0021187 3300048924 Bacteria 6381
456 Ga0496121_0338521 3300048924 Bacteria 1006
457 Ga0496124_0337087 3300048927 Bacteria 1073
458 Ga0496125_0116191 3300048928 Bacteria 1922
459 Ga0496125_0257622 3300048928 Bacteria 1096
460 Ga0496126_0018183 3300048929 Bacteria 6973
461 Ga0496126_0087032 3300048929 Bacteria 2753
462 Ga0496126_0171680 3300048929 Bacteria 1847
463 Ga0496126_0204665 3300048929 Bacteria 1664
464 Ga0496126_0205138 3300048929 Bacteria 1662
465 Ga0501076_0336323 3300049592 Bacteria 1239
466 Ga0501080_0113909 3300049742 Bacteria 2507
467 Ga0501083_0065690 3300049744 Bacteria 2417
468 nmdc:mga03683_139961_c1 3300050489 Bacteria 1087
469 nmdc:mga03683_203672_c1 3300050489 Bacteria 909
470 nmdc:mga03n38_179_c1 3300050490 Bacteria 14281
471 nmdc:mga03n38_25670_c1 3300050490 Bacteria 1887
472 nmdc:mga03n38_27040_c1 3300050490 Bacteria 2375
473 nmdc:mga00v17_1307_c1 3300050491 Bacteria 13048
474 nmdc:mga00v17_39953_c1 3300050491 Bacteria 2812
475 nmdc:mga00v17_8568_c1 3300050491 Bacteria 5504
476 nmdc:mga0yw44_11712_c1 3300050492 Bacteria 4542
477 nmdc:mga0yw44_93576_c1 3300050492 Bacteria 1903
478 nmdc:mga0k408_88614_c1 3300050493 Bacteria 1817
479 nmdc:mga06z11_136937_c1 3300050494 Bacteria 1380
480 nmdc:mga06z11_5694_c1 3300050494 Bacteria 5019
481 nmdc:mga06z11_7234_c1 3300050494 Bacteria 4558
482 nmdc:mga06z11_73244_c1 3300050494 Bacteria 1818
483 nmdc:mga04h51_128395_c1 3300050495 Bacteria 951
484 nmdc:mga07m45_45737_c1 3300050496 Bacteria 2458
485 nmdc:mga07m45_6880_c1 3300050496 Bacteria 5783
486 nmdc:mga0rr50_336000_c1 3300050513 Bacteria 1269
487 nmdc:mga08x19_3584_c1 3300050514 Bacteria 9236
488 Ga0495601_0002852 3300053077 Bacteria 9818
489 Ga0495601_0033755 3300053077 Bacteria 3189
490 Ga0495612_0151647 3300053078 Bacteria 1009
491 Ga0495595_0012489 3300053084 Bacteria 3572
492 Ga0495619_0013254 3300053085 Bacteria 5196
493 Ga0500641_0036209 3300053096 Bacteria 1973
494 Ga0500555_002222 3300053103 Bacteria 5666
495 Ga0500562_018021 3300053108 Bacteria 1822
496 Ga0500592_010640 3300053116 Bacteria 1468
497 Ga0500595_001029 3300053119 Bacteria 15582
498 Ga0500595_033417 3300053119 Bacteria 1707
499 Ga0500642_0015212 3300053130 Bacteria 2886
500 Ga0500652_000011 3300053131 Bacteria 160704
501 Ga0500616_0034676 3300053153 Bacteria 2747
502 Ga0500616_0048552 3300053153 Bacteria 2250
503 Ga0500627_0091499 3300053158 Bacteria 1362
504 Ga0500636_0060075 3300053177 Bacteria 2220
505 Ga0500637_0019587 3300053178 Bacteria 3651
506 Ga0500645_057809 3300053730 Bacteria 1124
507 Ga0500656_017363 3300053732 Bacteria 861
508 Ga0501084_0450911 3300054114 Bacteria 1087
509 Ga0501082_0197848 3300060353 Bacteria 1748
510 2507510512 2507262055 Bacteria 8048963
511 2513878765 2513237139 Bacteria 8737671
512 2528853031 2528768022 Bacteria 10457665
513 2723846977 2721755755 Bacteria 8322773
514 2793084226
515 2805921414 2802429603 Bacteria 8777136
516 2824613703 2824609381 Bacteria 8672835
517 2824664886 2824661429 Bacteria 9877870
518 2824672226 2824671348 Bacteria 8369588
519 2824682171 2824679649 Bacteria 8248951
520 2824688891 2824687955 Bacteria 8360029
521 2824697728 2824696289 Bacteria 8335049
522 2841947682 2841941048 Bacteria 8688029
523 2841947999 2841941048 Bacteria 8688029
524 2841973081 2841966195 Bacteria 8673214
525 2841978330 2841974524 Bacteria 8931498
526 2842040768 2842038055 Bacteria 8002051
527 2842042994 2842038055 Bacteria 8002051
528 2842046286 2842045827 Bacteria 8006841
529 2842051035 2842045827 Bacteria 8006841
530 2847947868 2847939898 Bacteria 8606328
531 2876811047 2876808645 Bacteria 8824342
532 2879109143 2879099564 Bacteria 10442239
533 2879114551 2879110137 Bacteria 8907982
534 2885370085 2885366525 Bacteria 8326213
535 2889038200 2889033259 Bacteria 9099371
536 2922375357
537 2922391650 2922386360 Bacteria 7017218
538 2922396952 2922393267 Bacteria 8285685
539 2932811522 2932809354 Bacteria 9135765
540 2932819678 2932818245 Bacteria 9955613
541 2935618887 2935616580 Bacteria 9032984
542 2935643297 2935638405 Bacteria 10015038
543 2935669922 2935665750 Bacteria 9571747
544 2935676936 2935675223 Bacteria 9928132
545 2935692976 2935684952 Bacteria 9590419
546 2935695532 2935694250 Bacteria 9291695
547 2935719584 2935713505 Bacteria 9608509
548 2935729649 2935722832 Bacteria 9608746
549 2935739467 2935732158 Bacteria 9706831
550 2935748505 2935741537 Bacteria 9707219
551 2935756908 2935750917 Bacteria 9590372
552 2935761104 2935760218 Bacteria 9817913
553 2935807439 2935801545 Bacteria 9301974
554 2935812579 2935810662 Bacteria 9401221
555 2935832560 2935827899 Bacteria 10038562
556 2935839362 2935837841 Bacteria 9454360
557 2935857252 2935855204 Bacteria 9035059
558 2935864780 2935864058 Bacteria 9784707
559 2935876558 2935873716 Bacteria 9632195
560 2936039172 2936037263 Bacteria 9446081
561 2940562822 2940556831 Bacteria 9590747
562 2941540051 2941538514 Bacteria 9402094
563 3005511295 3005506211 Bacteria 6943378
564 8006927543 8006926726 Bacteria 6749210
565 8056679458 8056673599 Bacteria 7871253
566 Ga0228598_1014508
567 JGI25153J46596_10005767
568 rootH2_10086155
569 JGI25404J52841_10005883
570 Ga0070658_10266411
571 Ga0070670_100000007
572 Ga0070670_100105213
573 Ga0070666_10181658
574 Ga0070680_100006521
575 Ga0070680_100552042
576 Ga0070682_100014439
577 Ga0070682_100055989
578 Ga0068868_100117289
579 Ga0070660_100228212
580 Ga0070668_100000272
581 Ga0070668_100015445
582 Ga0070668_100266956
583 Ga0070669_100300752
584 Ga0070675_100216666
585 Ga0070671_100345203
586 Ga0070671_100376081
587 Ga0070673_100506009
588 Ga0070688_100095622
589 Ga0070688_100306263
590 Ga0070667_100000291
591 Ga0070667_100079987
592 Ga0070709_10005766
593 Ga0070709_10009329
594 Ga0070714_100654529
595 Ga0070713_100071130
596 Ga0070710_10008177
597 Ga0070711_100124084
598 Ga0070711_100131934
599 Ga0070711_100301909
600 Ga0070711_100365957
601 Ga0070708_100055036
602 Ga0070663_100003582
603 Ga0070678_100026340
604 Ga0070678_100104752
605 Ga0070678_100473470
606 Ga0070662_100378751
607 Ga0070681_10008020
608 Ga0070681_10241075
609 Ga0068867_100227185
610 Ga0070707_100042523
611 Ga0070679_100384868
612 Ga0068853_100132345
613 Ga0068853_100171794
614 Ga0068853_100438863
615 Ga0070672_100150473
616 Ga0070686_100555156
617 Ga0070693_100055025
618 Ga0070665_100003234
619 Ga0070665_100010298
620 Ga0070665_100016020
621 Ga0070665_100187191
622 Ga0070665_100455978
623 Ga0070704_100057507
624 Ga0068855_100163429
625 Ga0068855_100329170
626 Ga0070664_100060359
627 Ga0068857_100160833
628 Ga0068854_100044610
629 Ga0068854_100146121
630 Ga0068854_100542925
631 Ga0068856_100007962
632 Ga0068856_100167307
633 Ga0068856_100398453
634 Ga0070702_100190904
635 Ga0068852_100073621
636 Ga0068852_100268747
637 Ga0068859_100020603
638 Ga0068859_100115233
639 Ga0068859_100310837
640 Ga0068864_100000602
641 Ga0068864_100184050
642 Ga0068851_10031799
643 Ga0068863_100002394
644 Ga0068863_100003290
645 Ga0068858_100007017
646 Ga0068858_100038829
647 Ga0068858_100590713
648 Ga0068858_100610961
649 Ga0068860_100000047
650 Ga0068860_100158620
651 Ga0068860_100920864
652 Ga0068862_100004658
653 Ga0068862_100126419
654 Ga0081455_10164781
655 Ga0081540_1004421
656 Ga0081540_1009221
657 Ga0081540_1016872
658 Ga0081540_1019984
659 Ga0081539_10056696
660 Ga0070717_10562982
661 Ga0075365_10011931
662 Ga0075365_10065447
663 Ga0075365_10405701
664 Ga0075365_10435302
665 Ga0075368_10011351
666 Ga0075363_100015694
667 Ga0075363_100073289
668 Ga0075363_100111925
669 Ga0075364_10051887
670 Ga0070715_10001142
671 Ga0070716_100012226
672 Ga0070716_100045261
673 Ga0070712_100032267
674 Ga0070712_100153243
675 Ga0070712_100215504
676 Ga0075367_10009022
677 Ga0075367_10024731
678 Ga0075367_10109196
679 Ga0075367_10135113
680 Ga0075367_10141687
681 Ga0075366_10081008
682 Ga0097621_100025798
683 Ga0097621_100145456
684 Ga0075370_10006007
685 Ga0075370_10076082
686 Ga0075370_10078522
687 Ga0075428_100105629
688 Ga0075434_100115043
689 Ga0068865_100031677
690 Ga0068865_100035084
691 Ga0068865_100057174
692 Ga0075436_100009604
693 Ga0097620_100020603
694 Ga0097620_100115234
695 Ga0097620_100310853
696 Ga0105250_10010684
697 Ga0105240_10247050
698 Ga0105240_10285898
699 Ga0105240_10875195
700 Ga0111539_10700715
701 Ga0105247_10008386
702 Ga0105247_10086275
703 Ga0105247_10216945
704 Ga0105241_10015022
705 Ga0105241_10021256
706 Ga0105241_10068374
707 Ga0105241_10305493
708 Ga0105242_10045521
709 Ga0105242_10072239
710 Ga0105248_10020021
711 Ga0105248_10064445
712 Ga0105248_10121315
713 Ga0105237_10037442
714 Ga0105237_10063110
715 Ga0105237_10376234
716 Ga0105238_10014119
717 Ga0105238_10069504
718 Ga0105238_10121756
719 Ga0105249_10035579
720 Ga0105249_10036033
721 Ga0105249_10942970
722 Ga0105239_10042593
723 Ga0105239_10052568
724 Ga0105239_10085045
725 Ga0105239_10163130
726 Ga0105246_10024427
727 Ga0105246_10124930
728 Ga0105246_10143365
729 Ga0105246_10304214
730 Ga0157370_10018226
731 Ga0157369_10112023
732 Ga0157374_10251054
733 Ga0157378_10163185
734 Ga0157378_11051713
735 Ga0163162_10017064
736 Ga0163162_10056854
737 Ga0163162_10368895
738 Ga0163162_10510094
739 Ga0157372_10039160
740 Ga0157372_10196432
741 Ga0157372_10355607
742 Ga0157375_10123158
743 Ga0157375_10232115
744 Ga0157375_10343820
745 Ga0163163_10019480
746 Ga0163163_10060930
747 Ga0163163_10089963
748 Ga0163163_10539984
749 Ga0163163_10569636
750 Ga0163163_10741898
751 Ga0157380_10063301
752 Ga0157380_10086406
753 Ga0157379_10076576
754 Ga0157379_10104367
755 Ga0157379_10320461
756 Ga0157376_10012548
757 Ga0157376_10029471
758 Ga0157376_10053374
759 Ga0163161_10534481
760 Ga0209758_1001959
761 Ga0209758_1003253
762 Ga0209051_1004879
763 Ga0207692_10028158
764 Ga0207692_10280989
765 Ga0207642_10235482
766 Ga0207710_10018369
767 Ga0207680_10164617
768 Ga0207699_10174802
769 Ga0207699_10193644
770 Ga0207684_10333009
771 Ga0207654_10001534
772 Ga0207654_10016365
773 Ga0207654_10022763
774 Ga0207654_10110818
775 Ga0207707_10004831
776 Ga0207695_10000883
777 Ga0207695_10044279
778 Ga0207671_10478325
779 Ga0207693_10025517
780 Ga0207693_10076675
781 Ga0207693_10212602
782 Ga0207663_10151934
783 Ga0207663_10163987
784 Ga0207660_10074189
785 Ga0207660_10470291
786 Ga0207657_10169746
787 Ga0207652_10003656
788 Ga0207681_10279429
789 Ga0207694_10006086
790 Ga0207694_10049365
791 Ga0207694_10144981
792 Ga0207650_10000033
793 Ga0207650_10134790
794 Ga0207700_10049120
795 Ga0207700_10131409
796 Ga0207644_10146018
797 Ga0207644_10259209
798 Ga0207706_10050502
799 Ga0207706_10094732
800 Ga0207706_10529126
801 Ga0207709_10015308
802 Ga0207709_10338902
803 Ga0207669_10271894
804 Ga0207704_10022494
805 Ga0207704_10111386
806 Ga0207665_10008742
807 Ga0207665_10080294
808 Ga0207691_10058156
809 Ga0207711_10064556
810 Ga0207689_10044978
811 Ga0207689_10107352
812 Ga0207661_10180607
813 Ga0207679_10006975
814 Ga0207679_10039760
815 Ga0207679_10681738
816 Ga0207667_10286511
817 Ga0207651_10507146
818 Ga0207712_10013494
819 Ga0207668_10000874
820 Ga0207668_10040566
821 Ga0207668_10078244
822 Ga0207668_10293735
823 Ga0207640_10173040
824 Ga0207658_10000323
825 Ga0207677_10058426
826 Ga0207677_10126954
827 Ga0207677_10269123
828 Ga0207703_10000065
829 Ga0207703_10023981
830 Ga0207639_10190919
831 Ga0207639_10359205
832 Ga0207678_10004639
833 Ga0207678_10013383
834 Ga0207678_10030358
835 Ga0207678_10067010
836 Ga0207702_10000005
837 Ga0207702_10052014
838 Ga0207641_10001956
839 Ga0207641_10014543
840 Ga0207648_10034362
841 Ga0207676_10000135
842 Ga0207676_10205114
843 Ga0207674_10053514
844 Ga0207674_10104724
845 Ga0207683_10052351
846 Ga0207683_10360216
847 Ga0207698_10191263
848 Ga0207698_10615445
849 Ga0268266_10002693
850 Ga0268266_10010918
851 Ga0268266_10053456
852 Ga0268266_10125342
853 Ga0268266_10221988
854 Ga0268266_10465545
855 Ga0268265_10002613
856 Ga0268265_10005223
857 Ga0268265_10668714
858 Ga0268264_10000205
859 Ga0307408_100422836
860 Ga0307409_100227201
861 Ga0307510_10032760
862 Ga0373934_0002999
863 Ga0373940_0045965
864 Ga0373944_0033791
865 Ga0373952_0002709
866 Ga0373923_0000787
867 Ga0373932_0108671
868 Ga0373936_0034982
869 Ga0373953_0002598
870 Ga0373956_0002577
871 Ga0373955_0014397
872 Ga0373955_0135019
873 Ga0373961_0050125
874 Ga0373931_0003411
875 Ga0373935_0010235
876 Ga0373927_0000330
877 Ga0373927_0016510
878 Ga0373927_0088277
879 Ga0373927_0263283
880 Ga0373933_0102306
881 Ga0373933_0130365
882 Ga0373947_0159772
883 Ga0373937_0019713
884 Ga0373937_0025873
885 Ga0373925_0000189
886 Ga0373925_0003748
887 Ga0373925_0106074
888 Ga0395898_0005504
889 Ga0395901_0305787
890 Ga0436360_0071803
891 Ga0466963_0145824
892 Ga0466968_0177882
893 Ga0466959_0204902
894 Ga0466959_0279325
895 Ga0451576_0238954
896 Ga0466967_0480894
897 Ga0495592_0000440
898 Ga0495592_0011779
899 Ga0495590_0030546
900 Ga0495641_0091431
901 Ga0495651_0001974
902 Ga0495653_0041205
903 Ga0495580_0033754
904 Ga0495582_0004751
905 Ga0495605_0056077
906 Ga0495605_0084130
907 Ga0495662_0054807
908 Ga0495664_0269279
909 Ga0495584_0028917
910 Ga0495584_0134615
911 Ga0495585_0037608
912 Ga0495585_0045574
913 Ga0495594_0110631
914 Ga0495606_0143477
915 Ga0495608_0007439
916 Ga0495610_0045805
917 Ga0495618_0010345
918 Ga0495628_0001182
919 Ga0495630_0002384
920 Ga0495631_0018925
921 Ga0495643_0053714
922 Ga0495644_0062067
923 Ga0495666_0007700
924 Ga0495652_0000852
925 Ga0495652_0049980
926 Ga0495665_0014336
927 Ga0495586_0006398
928 Ga0495587_0002215
929 Ga0495609_0061852
930 Ga0495609_0088899
931 Ga0495645_0000523
932 Ga0495645_0065411
933 Ga0495622_0064476
934 Ga0495622_0095376
935 Ga0495633_0075553
936 Ga0495667_0023692
937 Ga0495656_0010986
938 Ga0495668_0129018
939 Ga0495634_0178358
940 Ga0495625_0087742
941 Ga0495635_0034909
942 Ga0495659_0026766
943 Ga0495657_0004303
944 Ga0495657_0161794
945 Ga0495599_0003877
946 Ga0495599_0004742
947 Ga0495647_0000817
948 Ga0495658_0010206
949 Ga0495669_0062168
950 Ga0495613_0011074
951 Ga0495624_0029620
952 Ga0495624_0324757
953 Ga0495649_0055872
954 Ga0495600_0010860
955 Ga0495674_0003704
956 Ga0495680_0004918
957 Ga0495675_0017080
958 Ga0495685_017938
959 Ga0495673_0166671
960 Ga0495684_0097173
961 Ga0495686_0048504
962 Ga0496100_0021621
963 Ga0496100_0167852
964 Ga0496101_0070409
965 Ga0496101_0116957
966 Ga0496101_0176128
967 Ga0496101_0265036
968 Ga0496102_0008179
969 Ga0496102_0035287
970 Ga0496102_0050458
971 Ga0496102_0146924
972 Ga0496103_0021743
973 Ga0496103_0157950
974 Ga0496104_0029379
975 Ga0496104_0034728
976 Ga0496104_0177238
977 Ga0496104_0474442
978 Ga0496105_0008328
979 Ga0496105_0028606
980 Ga0496105_0076839
981 Ga0496106_0010473
982 Ga0496106_0010853
983 Ga0496106_0262869
984 Ga0496107_0009111
985 Ga0496107_0021982
986 Ga0496107_0024979
987 Ga0496108_0072369
988 Ga0496108_0137587
989 Ga0496109_0039004
990 Ga0496109_0133061
991 Ga0496110_0044291
992 Ga0496111_0086562
993 Ga0496111_0405343
994 Ga0496112_0040347
995 Ga0496112_0316058
996 Ga0496112_0452534
997 Ga0496113_0013831
998 Ga0496113_0130198
999 Ga0496113_0483072
1000 Ga0496114_0083707
1001 Ga0496114_0140852
1002 Ga0496114_0495586
1003 Ga0496115_0001003
1004 Ga0496115_0024369
1005 Ga0496115_0030075
1006 Ga0496115_0037215
1007 Ga0496115_0061677
1008 Ga0496115_0133846
1009 Ga0496116_0010567
1010 Ga0496117_0078928
1011 Ga0496118_0078106
1012 Ga0496118_0124990
1013 Ga0496118_0261676
1014 Ga0496119_0001434
1015 Ga0496119_0091383
1016 Ga0496120_0000191
1017 Ga0496121_0000194
1018 Ga0496121_0014106
1019 Ga0496121_0016456
1020 Ga0496121_0021187
1021 Ga0496121_0338521
1022 Ga0496124_0337087
1023 Ga0496125_0116191
1024 Ga0496125_0257622
1025 Ga0496126_0018183
1026 Ga0496126_0087032
1027 Ga0496126_0171680
1028 Ga0496126_0204665
1029 Ga0496126_0205138
1030 Ga0501076_0336323
1031 Ga0501080_0113909
1032 Ga0501083_0065690
1033 nmdc:mga03683_139961_c1
1034 nmdc:mga03683_203672_c1
1035 nmdc:mga03n38_179_c1
1036 nmdc:mga03n38_25670_c1
1037 nmdc:mga03n38_27040_c1
1038 nmdc:mga00v17_1307_c1
1039 nmdc:mga00v17_39953_c1
1040 nmdc:mga00v17_8568_c1
1041 nmdc:mga0yw44_11712_c1
1042 nmdc:mga0yw44_93576_c1
1043 nmdc:mga0k408_88614_c1
1044 nmdc:mga06z11_136937_c1
1045 nmdc:mga06z11_5694_c1
1046 nmdc:mga06z11_7234_c1
1047 nmdc:mga06z11_73244_c1
1048 nmdc:mga04h51_128395_c1
1049 nmdc:mga07m45_45737_c1
1050 nmdc:mga07m45_6880_c1
1051 nmdc:mga0rr50_336000_c1
1052 nmdc:mga08x19_3584_c1
1053 Ga0495601_0002852
1054 Ga0495601_0033755
1055 Ga0495612_0151647
1056 Ga0495595_0012489
1057 Ga0495619_0013254
1058 Ga0500641_0036209
1059 Ga0500555_002222
1060 Ga0500562_018021
1061 Ga0500592_010640
1062 Ga0500595_001029
1063 Ga0500595_033417
1064 Ga0500642_0015212
1065 Ga0500652_000011
1066 Ga0500616_0034676
1067 Ga0500616_0048552
1068 Ga0500627_0091499
1069 Ga0500636_0060075
1070 Ga0500637_0019587
1071 Ga0500645_057809
1072 Ga0500656_017363
1073 Ga0501084_0450911
1074 Ga0501082_0197848
1075 2507510512
1076 2513878765
1077 2528853031
1078 2723846977
1079 2793084226
1080 2805921414
1081 2824613703
1082 2824664886
1083 2824672226
1084 2824682171
1085 2824688891
1086 2824697728
1087 2841947682
1088 2841947999
1089 2841973081
1090 2841978330
1091 2842040768
1092 2842042994
1093 2842046286
1094 2842051035
1095 2847947868
1096 2876811047
1097 2879109143
1098 2879114551
1099 2885370085
1100 2889038200
1101 2922375357
1102 2922391650
1103 2922396952
1104 2932811522
1105 2932819678
1106 2935618887
1107 2935643297
1108 2935669922
1109 2935676936
1110 2935692976
1111 2935695532
1112 2935719584
1113 2935729649
1114 2935739467
1115 2935748505
1116 2935756908
1117 2935761104
1118 2935807439
1119 2935812579
1120 2935832560
1121 2935839362
1122 2935857252
1123 2935864780
1124 2935876558
1125 2936039172
1126 2940562822
1127 2941540051
1128 3005511295
1129 8006927543
1130 8056679458

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07298

NnrU

NnrU protein

71

254

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ykz-assembly1.cif.gz_A recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: restrained refinement 0.424 66 175
4f7g-assembly1.cif.gz_B crystal structure of talin autoinhibition complex 0.4186 24 175
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.4096 14 259
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.4071 36 259
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.4071 14 259
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9795 66 256 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9646 66 256 1.20.120.1630
af_Q6MG14_62_250_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8464 67 224 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8365 68 227 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8248 67 226 1.20.120.1630
ID Description Score Start End GO Terms
AF-K8P644-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9888 18 259 GO:0008168
GO:0016020
GO:0032259
AF-A0A7I7YX51-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9863 21 256 GO:0008168
GO:0016020
GO:0032259
AF-A0A537T7R4-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9863 18 256 GO:0008168
GO:0016020
GO:0032259
AF-A0A6M1T1B5-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9861 21 259 GO:0008168
GO:0016020
GO:0032259
AF-A0A7C4VBS6-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9852 21 256 GO:0008168
GO:0016020
GO:0032259

Map