F464267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 565 | 340 | 1130 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300024227|Ga0228598_1014508|Ga0228598_10145083 |
| Length | 264 |
| Sequence | MSTRIETIQEHVSSPGHLAGRIVAFFYGIAAYGVFFVTFLFAVGFVEDLVVPKTIDGGSGAPAAPLLQTLMLNVVLMSIFAVQHSVMARPQFKRRWTKFVPTSIERTTYVLLASLALALLIWQWRPMPAIVWRIADPRLAAALIGLSFLGWLIVLTSTFLINHFELFGLHQVTNNLAGRPMPAPRFRSPLLYRFVRHPIYLGFIIAFWAAPTMTQGHLLFAAVTTSYILVGIYLEERDLVAVFGEEYRRYRERVSMLVPWRRSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 248 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 249 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 250 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 251 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 252 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 262 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 263 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 264 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 267 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 276 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 277 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 278 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 279 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 280 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 281 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 284 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 289 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 290 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 291 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 292 | 2791355199 | |||
| 293 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 294 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 295 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 296 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 297 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 298 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 299 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 300 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 301 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 302 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 303 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 304 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 305 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 306 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 307 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 308 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 309 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 310 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 311 | 2922368715 | |||
| 312 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 313 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 314 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 315 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 316 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 317 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 318 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 319 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 320 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 321 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 322 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 323 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 324 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 325 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 326 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 327 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 328 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 329 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 330 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 331 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 332 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 333 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 334 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 335 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 336 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 337 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 338 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 339 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 340 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.41 |
| Metatranscriptomes | 0 |
| Isolates | 9.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.73 |
| Nodule | 7.43 |
| Rhizoplane | 8.32 |
| Rhizosphere | 67.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0228598_1014508 | 3300024227 | Bacteria | 1559 |
| 2 | JGI25153J46596_10005767 | 3300003215 | Bacteria | 6450 |
| 3 | rootH2_10086155 | 3300003320 | Bacteria | 2280 |
| 4 | JGI25404J52841_10005883 | 3300003659 | Bacteria | 2544 |
| 5 | Ga0070658_10266411 | 3300005327 | Bacteria | 1456 |
| 6 | Ga0070670_100000007 | 3300005331 | Bacteria | 318672 |
| 7 | Ga0070670_100105213 | 3300005331 | Bacteria | 2431 |
| 8 | Ga0070666_10181658 | 3300005335 | Bacteria | 1476 |
| 9 | Ga0070680_100006521 | 3300005336 | Bacteria | 8875 |
| 10 | Ga0070680_100552042 | 3300005336 | Unclassified | 987 |
| 11 | Ga0070682_100014439 | 3300005337 | Bacteria | 4564 |
| 12 | Ga0070682_100055989 | 3300005337 | Bacteria | 2479 |
| 13 | Ga0068868_100117289 | 3300005338 | Bacteria | 2169 |
| 14 | Ga0070660_100228212 | 3300005339 | Bacteria | 1515 |
| 15 | Ga0070668_100000272 | 3300005347 | Bacteria | 34235 |
| 16 | Ga0070668_100015445 | 3300005347 | Bacteria | 5707 |
| 17 | Ga0070668_100266956 | 3300005347 | Bacteria | 1425 |
| 18 | Ga0070669_100300752 | 3300005353 | Bacteria | 1290 |
| 19 | Ga0070675_100216666 | 3300005354 | Bacteria | 1666 |
| 20 | Ga0070671_100345203 | 3300005355 | Bacteria | 1270 |
| 21 | Ga0070671_100376081 | 3300005355 | Bacteria | 1214 |
| 22 | Ga0070673_100506009 | 3300005364 | Bacteria | 1093 |
| 23 | Ga0070688_100095622 | 3300005365 | Bacteria | 1950 |
| 24 | Ga0070688_100306263 | 3300005365 | Bacteria | 1150 |
| 25 | Ga0070667_100000291 | 3300005367 | Bacteria | 56512 |
| 26 | Ga0070667_100079987 | 3300005367 | Bacteria | 2795 |
| 27 | Ga0070709_10005766 | 3300005434 | Bacteria | 6717 |
| 28 | Ga0070709_10009329 | 3300005434 | Bacteria | 5407 |
| 29 | Ga0070714_100654529 | 3300005435 | Bacteria | 1011 |
| 30 | Ga0070713_100071130 | 3300005436 | Bacteria | 2939 |
| 31 | Ga0070710_10008177 | 3300005437 | Bacteria | 5087 |
| 32 | Ga0070711_100124084 | 3300005439 | Bacteria | 1914 |
| 33 | Ga0070711_100131934 | 3300005439 | Bacteria | 1862 |
| 34 | Ga0070711_100301909 | 3300005439 | Bacteria | 1273 |
| 35 | Ga0070711_100365957 | 3300005439 | Bacteria | 1162 |
| 36 | Ga0070708_100055036 | 3300005445 | Bacteria | 3537 |
| 37 | Ga0070663_100003582 | 3300005455 | Bacteria | 8971 |
| 38 | Ga0070678_100026340 | 3300005456 | Bacteria | 3929 |
| 39 | Ga0070678_100104752 | 3300005456 | Bacteria | 2200 |
| 40 | Ga0070678_100473470 | 3300005456 | Bacteria | 1101 |
| 41 | Ga0070662_100378751 | 3300005457 | Bacteria | 1164 |
| 42 | Ga0070681_10008020 | 3300005458 | Bacteria | 10339 |
| 43 | Ga0070681_10241075 | 3300005458 | Bacteria | 1722 |
| 44 | Ga0068867_100227185 | 3300005459 | Unclassified | 1507 |
| 45 | Ga0070707_100042523 | 3300005468 | Bacteria | 4350 |
| 46 | Ga0070679_100384868 | 3300005530 | Bacteria | 1349 |
| 47 | Ga0068853_100132345 | 3300005539 | Bacteria | 2234 |
| 48 | Ga0068853_100171794 | 3300005539 | Bacteria | 1961 |
| 49 | Ga0068853_100438863 | 3300005539 | Bacteria | 1226 |
| 50 | Ga0070672_100150473 | 3300005543 | Bacteria | 1925 |
| 51 | Ga0070686_100555156 | 3300005544 | Bacteria | 899 |
| 52 | Ga0070693_100055025 | 3300005547 | Bacteria | 2291 |
| 53 | Ga0070665_100003234 | 3300005548 | Bacteria | 17509 |
| 54 | Ga0070665_100010298 | 3300005548 | Bacteria | 9459 |
| 55 | Ga0070665_100016020 | 3300005548 | Bacteria | 7525 |
| 56 | Ga0070665_100187191 | 3300005548 | Bacteria | 2071 |
| 57 | Ga0070665_100455978 | 3300005548 | Bacteria | 1288 |
| 58 | Ga0070704_100057507 | 3300005549 | Bacteria | 2766 |
| 59 | Ga0068855_100163429 | 3300005563 | Bacteria | 2525 |
| 60 | Ga0068855_100329170 | 3300005563 | Bacteria | 1687 |
| 61 | Ga0070664_100060359 | 3300005564 | Bacteria | 3229 |
| 62 | Ga0068857_100160833 | 3300005577 | Bacteria | 2038 |
| 63 | Ga0068854_100044610 | 3300005578 | Bacteria | 3148 |
| 64 | Ga0068854_100146121 | 3300005578 | Bacteria | 1819 |
| 65 | Ga0068854_100542925 | 3300005578 | Bacteria | 985 |
| 66 | Ga0068856_100007962 | 3300005614 | Bacteria | 10350 |
| 67 | Ga0068856_100167307 | 3300005614 | Bacteria | 2210 |
| 68 | Ga0068856_100398453 | 3300005614 | Bacteria | 1396 |
| 69 | Ga0070702_100190904 | 3300005615 | Bacteria | 1348 |
| 70 | Ga0068852_100073621 | 3300005616 | Bacteria | 3006 |
| 71 | Ga0068852_100268747 | 3300005616 | Bacteria | 1640 |
| 72 | Ga0068859_100020603 | 3300005617 | Bacteria | 6616 |
| 73 | Ga0068859_100115233 | 3300005617 | Bacteria | 2752 |
| 74 | Ga0068859_100310837 | 3300005617 | Bacteria | 1669 |
| 75 | Ga0068864_100000602 | 3300005618 | Bacteria | 30531 |
| 76 | Ga0068864_100184050 | 3300005618 | Bacteria | 1911 |
| 77 | Ga0068851_10031799 | 3300005834 | Bacteria | 2623 |
| 78 | Ga0068863_100002394 | 3300005841 | Bacteria | 18650 |
| 79 | Ga0068863_100003290 | 3300005841 | Bacteria | 15951 |
| 80 | Ga0068858_100007017 | 3300005842 | Bacteria | 10945 |
| 81 | Ga0068858_100038829 | 3300005842 | Bacteria | 4416 |
| 82 | Ga0068858_100590713 | 3300005842 | Bacteria | 1077 |
| 83 | Ga0068858_100610961 | 3300005842 | Bacteria | 1058 |
| 84 | Ga0068860_100000047 | 3300005843 | Bacteria | 213287 |
| 85 | Ga0068860_100158620 | 3300005843 | Bacteria | 2181 |
| 86 | Ga0068860_100920864 | 3300005843 | Bacteria | 891 |
| 87 | Ga0068862_100004658 | 3300005844 | Bacteria | 11555 |
| 88 | Ga0068862_100126419 | 3300005844 | Bacteria | 2257 |
| 89 | Ga0081455_10164781 | 3300005937 | Bacteria | 1695 |
| 90 | Ga0081540_1004421 | 3300005983 | Bacteria | 10725 |
| 91 | Ga0081540_1009221 | 3300005983 | Bacteria | 6805 |
| 92 | Ga0081540_1016872 | 3300005983 | Bacteria | 4547 |
| 93 | Ga0081540_1019984 | 3300005983 | Bacteria | 4046 |
| 94 | Ga0081539_10056696 | 3300005985 | Bacteria | 2173 |
| 95 | Ga0070717_10562982 | 3300006028 | Bacteria | 1032 |
| 96 | Ga0075365_10011931 | 3300006038 | Bacteria | 5133 |
| 97 | Ga0075365_10065447 | 3300006038 | Bacteria | 2436 |
| 98 | Ga0075365_10405701 | 3300006038 | Bacteria | 962 |
| 99 | Ga0075365_10435302 | 3300006038 | Bacteria | 926 |
| 100 | Ga0075368_10011351 | 3300006042 | Bacteria | 3240 |
| 101 | Ga0075363_100015694 | 3300006048 | Bacteria | 3728 |
| 102 | Ga0075363_100073289 | 3300006048 | Bacteria | 1863 |
| 103 | Ga0075363_100111925 | 3300006048 | Bacteria | 1518 |
| 104 | Ga0075364_10051887 | 3300006051 | Bacteria | 2679 |
| 105 | Ga0070715_10001142 | 3300006163 | Bacteria | 7591 |
| 106 | Ga0070716_100012226 | 3300006173 | Bacteria | 4346 |
| 107 | Ga0070716_100045261 | 3300006173 | Bacteria | 2470 |
| 108 | Ga0070712_100032267 | 3300006175 | Bacteria | 3535 |
| 109 | Ga0070712_100153243 | 3300006175 | Bacteria | 1772 |
| 110 | Ga0070712_100215504 | 3300006175 | Bacteria | 1517 |
| 111 | Ga0075367_10009022 | 3300006178 | Bacteria | 5194 |
| 112 | Ga0075367_10024731 | 3300006178 | Bacteria | 3388 |
| 113 | Ga0075367_10109196 | 3300006178 | Bacteria | 1697 |
| 114 | Ga0075367_10135113 | 3300006178 | Bacteria | 1525 |
| 115 | Ga0075367_10141687 | 3300006178 | Bacteria | 1489 |
| 116 | Ga0075366_10081008 | 3300006195 | Bacteria | 1939 |
| 117 | Ga0097621_100025798 | 3300006237 | Bacteria | 4601 |
| 118 | Ga0097621_100145456 | 3300006237 | Bacteria | 2029 |
| 119 | Ga0075370_10006007 | 3300006353 | Bacteria | 6081 |
| 120 | Ga0075370_10076082 | 3300006353 | Bacteria | 1925 |
| 121 | Ga0075370_10078522 | 3300006353 | Bacteria | 1895 |
| 122 | Ga0075428_100105629 | 3300006844 | Bacteria | 3070 |
| 123 | Ga0075434_100115043 | 3300006871 | Bacteria | 2702 |
| 124 | Ga0068865_100031677 | 3300006881 | Bacteria | 3527 |
| 125 | Ga0068865_100035084 | 3300006881 | Bacteria | 3371 |
| 126 | Ga0068865_100057174 | 3300006881 | Bacteria | 2720 |
| 127 | Ga0075436_100009604 | 3300006914 | Bacteria | 6622 |
| 128 | Ga0097620_100020603 | 3300006931 | Bacteria | 6616 |
| 129 | Ga0097620_100115234 | 3300006931 | Bacteria | 2752 |
| 130 | Ga0097620_100310853 | 3300006931 | Bacteria | 1669 |
| 131 | Ga0105250_10010684 | 3300009092 | Bacteria | 3823 |
| 132 | Ga0105240_10247050 | 3300009093 | Bacteria | 2065 |
| 133 | Ga0105240_10285898 | 3300009093 | Bacteria | 1893 |
| 134 | Ga0105240_10875195 | 3300009093 | Bacteria | 968 |
| 135 | Ga0111539_10700715 | 3300009094 | Bacteria | 1179 |
| 136 | Ga0105247_10008386 | 3300009101 | Bacteria | 6300 |
| 137 | Ga0105247_10086275 | 3300009101 | Bacteria | 1986 |
| 138 | Ga0105247_10216945 | 3300009101 | Bacteria | 1293 |
| 139 | Ga0105241_10015022 | 3300009174 | Bacteria | 5671 |
| 140 | Ga0105241_10021256 | 3300009174 | Bacteria | 4796 |
| 141 | Ga0105241_10068374 | 3300009174 | Bacteria | 2752 |
| 142 | Ga0105241_10305493 | 3300009174 | Bacteria | 1367 |
| 143 | Ga0105242_10045521 | 3300009176 | Bacteria | 3556 |
| 144 | Ga0105242_10072239 | 3300009176 | Bacteria | 2865 |
| 145 | Ga0105248_10020021 | 3300009177 | Bacteria | 7409 |
| 146 | Ga0105248_10064445 | 3300009177 | Bacteria | 4114 |
| 147 | Ga0105248_10121315 | 3300009177 | Bacteria | 2949 |
| 148 | Ga0105237_10037442 | 3300009545 | Bacteria | 4904 |
| 149 | Ga0105237_10063110 | 3300009545 | Bacteria | 3703 |
| 150 | Ga0105237_10376234 | 3300009545 | Bacteria | 1425 |
| 151 | Ga0105238_10014119 | 3300009551 | Bacteria | 8076 |
| 152 | Ga0105238_10069504 | 3300009551 | Bacteria | 3522 |
| 153 | Ga0105238_10121756 | 3300009551 | Bacteria | 2588 |
| 154 | Ga0105249_10035579 | 3300009553 | Bacteria | 4516 |
| 155 | Ga0105249_10036033 | 3300009553 | Unclassified | 4488 |
| 156 | Ga0105249_10942970 | 3300009553 | Bacteria | 931 |
| 157 | Ga0105239_10042593 | 3300010375 | Bacteria | 4974 |
| 158 | Ga0105239_10052568 | 3300010375 | Bacteria | 4468 |
| 159 | Ga0105239_10085045 | 3300010375 | Bacteria | 3485 |
| 160 | Ga0105239_10163130 | 3300010375 | Bacteria | 2491 |
| 161 | Ga0105246_10024427 | 3300011119 | Bacteria | 3927 |
| 162 | Ga0105246_10124930 | 3300011119 | Bacteria | 1913 |
| 163 | Ga0105246_10143365 | 3300011119 | Bacteria | 1799 |
| 164 | Ga0105246_10304214 | 3300011119 | Bacteria | 1289 |
| 165 | Ga0157370_10018226 | 3300013104 | Bacteria | 7064 |
| 166 | Ga0157369_10112023 | 3300013105 | Bacteria | 2899 |
| 167 | Ga0157374_10251054 | 3300013296 | Bacteria | 1741 |
| 168 | Ga0157378_10163185 | 3300013297 | Bacteria | 2085 |
| 169 | Ga0157378_11051713 | 3300013297 | Bacteria | 850 |
| 170 | Ga0163162_10017064 | 3300013306 | Bacteria | 7103 |
| 171 | Ga0163162_10056854 | 3300013306 | Bacteria | 3940 |
| 172 | Ga0163162_10368895 | 3300013306 | Bacteria | 1569 |
| 173 | Ga0163162_10510094 | 3300013306 | Bacteria | 1333 |
| 174 | Ga0157372_10039160 | 3300013307 | Bacteria | 5233 |
| 175 | Ga0157372_10196432 | 3300013307 | Bacteria | 2337 |
| 176 | Ga0157372_10355607 | 3300013307 | Bacteria | 1706 |
| 177 | Ga0157375_10123158 | 3300013308 | Bacteria | 2705 |
| 178 | Ga0157375_10232115 | 3300013308 | Bacteria | 2004 |
| 179 | Ga0157375_10343820 | 3300013308 | Bacteria | 1657 |
| 180 | Ga0163163_10019480 | 3300014325 | Bacteria | 6373 |
| 181 | Ga0163163_10060930 | 3300014325 | Bacteria | 3738 |
| 182 | Ga0163163_10089963 | 3300014325 | Bacteria | 3083 |
| 183 | Ga0163163_10539984 | 3300014325 | Bacteria | 1228 |
| 184 | Ga0163163_10569636 | 3300014325 | Unclassified | 1195 |
| 185 | Ga0163163_10741898 | 3300014325 | Bacteria | 1045 |
| 186 | Ga0157380_10063301 | 3300014326 | Bacteria | 2965 |
| 187 | Ga0157380_10086406 | 3300014326 | Bacteria | 2577 |
| 188 | Ga0157379_10076576 | 3300014968 | Bacteria | 2995 |
| 189 | Ga0157379_10104367 | 3300014968 | Bacteria | 2544 |
| 190 | Ga0157379_10320461 | 3300014968 | Bacteria | 1415 |
| 191 | Ga0157376_10012548 | 3300014969 | Bacteria | 6293 |
| 192 | Ga0157376_10029471 | 3300014969 | Bacteria | 4371 |
| 193 | Ga0157376_10053374 | 3300014969 | Bacteria | 3365 |
| 194 | Ga0163161_10534481 | 3300017792 | Bacteria | 959 |
| 195 | Ga0209758_1001959 | 3300025297 | Bacteria | 22262 |
| 196 | Ga0209758_1003253 | 3300025297 | Bacteria | 15067 |
| 197 | Ga0209051_1004879 | 3300025303 | Bacteria | 8046 |
| 198 | Ga0207692_10028158 | 3300025898 | Bacteria | 2654 |
| 199 | Ga0207692_10280989 | 3300025898 | Bacteria | 1007 |
| 200 | Ga0207642_10235482 | 3300025899 | Bacteria | 1031 |
| 201 | Ga0207710_10018369 | 3300025900 | Bacteria | 2974 |
| 202 | Ga0207680_10164617 | 3300025903 | Bacteria | 1490 |
| 203 | Ga0207699_10174802 | 3300025906 | Bacteria | 1439 |
| 204 | Ga0207699_10193644 | 3300025906 | Bacteria | 1373 |
| 205 | Ga0207684_10333009 | 3300025910 | Bacteria | 1308 |
| 206 | Ga0207654_10001534 | 3300025911 | Bacteria | 12159 |
| 207 | Ga0207654_10016365 | 3300025911 | Bacteria | 3861 |
| 208 | Ga0207654_10022763 | 3300025911 | Bacteria | 3347 |
| 209 | Ga0207654_10110818 | 3300025911 | Bacteria | 1707 |
| 210 | Ga0207707_10004831 | 3300025912 | Bacteria | 11819 |
| 211 | Ga0207695_10000883 | 3300025913 | Bacteria | 54495 |
| 212 | Ga0207695_10044279 | 3300025913 | Bacteria | 4735 |
| 213 | Ga0207671_10478325 | 3300025914 | Bacteria | 993 |
| 214 | Ga0207693_10025517 | 3300025915 | Bacteria | 4686 |
| 215 | Ga0207693_10076675 | 3300025915 | Bacteria | 2618 |
| 216 | Ga0207693_10212602 | 3300025915 | Bacteria | 1520 |
| 217 | Ga0207663_10151934 | 3300025916 | Bacteria | 1625 |
| 218 | Ga0207663_10163987 | 3300025916 | Bacteria | 1572 |
| 219 | Ga0207660_10074189 | 3300025917 | Bacteria | 2482 |
| 220 | Ga0207660_10470291 | 3300025917 | Unclassified | 1018 |
| 221 | Ga0207657_10169746 | 3300025919 | Bacteria | 1768 |
| 222 | Ga0207652_10003656 | 3300025921 | Bacteria | 12658 |
| 223 | Ga0207681_10279429 | 3300025923 | Bacteria | 1314 |
| 224 | Ga0207694_10006086 | 3300025924 | Bacteria | 9223 |
| 225 | Ga0207694_10049365 | 3300025924 | Bacteria | 3258 |
| 226 | Ga0207694_10144981 | 3300025924 | Bacteria | 1911 |
| 227 | Ga0207650_10000033 | 3300025925 | Bacteria | 226809 |
| 228 | Ga0207650_10134790 | 3300025925 | Bacteria | 1936 |
| 229 | Ga0207700_10049120 | 3300025928 | Bacteria | 3137 |
| 230 | Ga0207700_10131409 | 3300025928 | Bacteria | 2044 |
| 231 | Ga0207644_10146018 | 3300025931 | Bacteria | 1826 |
| 232 | Ga0207644_10259209 | 3300025931 | Bacteria | 1390 |
| 233 | Ga0207706_10050502 | 3300025933 | Bacteria | 3675 |
| 234 | Ga0207706_10094732 | 3300025933 | Bacteria | 2627 |
| 235 | Ga0207706_10529126 | 3300025933 | Bacteria | 1016 |
| 236 | Ga0207709_10015308 | 3300025935 | Bacteria | 4253 |
| 237 | Ga0207709_10338902 | 3300025935 | Bacteria | 1131 |
| 238 | Ga0207669_10271894 | 3300025937 | Bacteria | 1273 |
| 239 | Ga0207704_10022494 | 3300025938 | Bacteria | 3379 |
| 240 | Ga0207704_10111386 | 3300025938 | Bacteria | 1851 |
| 241 | Ga0207665_10008742 | 3300025939 | Bacteria | 6662 |
| 242 | Ga0207665_10080294 | 3300025939 | Bacteria | 2243 |
| 243 | Ga0207691_10058156 | 3300025940 | Bacteria | 3517 |
| 244 | Ga0207711_10064556 | 3300025941 | Bacteria | 3163 |
| 245 | Ga0207689_10044978 | 3300025942 | Bacteria | 3651 |
| 246 | Ga0207689_10107352 | 3300025942 | Bacteria | 2294 |
| 247 | Ga0207661_10180607 | 3300025944 | Bacteria | 1843 |
| 248 | Ga0207679_10006975 | 3300025945 | Bacteria | 7159 |
| 249 | Ga0207679_10039760 | 3300025945 | Bacteria | 3361 |
| 250 | Ga0207679_10681738 | 3300025945 | Bacteria | 931 |
| 251 | Ga0207667_10286511 | 3300025949 | Bacteria | 1683 |
| 252 | Ga0207651_10507146 | 3300025960 | Bacteria | 1044 |
| 253 | Ga0207712_10013494 | 3300025961 | Bacteria | 5239 |
| 254 | Ga0207668_10000874 | 3300025972 | Bacteria | 18178 |
| 255 | Ga0207668_10040566 | 3300025972 | Bacteria | 3142 |
| 256 | Ga0207668_10078244 | 3300025972 | Bacteria | 2387 |
| 257 | Ga0207668_10293735 | 3300025972 | Bacteria | 1338 |
| 258 | Ga0207640_10173040 | 3300025981 | Bacteria | 1611 |
| 259 | Ga0207658_10000323 | 3300025986 | Bacteria | 48151 |
| 260 | Ga0207677_10058426 | 3300026023 | Bacteria | 2655 |
| 261 | Ga0207677_10126954 | 3300026023 | Bacteria | 1929 |
| 262 | Ga0207677_10269123 | 3300026023 | Bacteria | 1393 |
| 263 | Ga0207703_10000065 | 3300026035 | Bacteria | 126087 |
| 264 | Ga0207703_10023981 | 3300026035 | Bacteria | 4799 |
| 265 | Ga0207639_10190919 | 3300026041 | Bacteria | 1750 |
| 266 | Ga0207639_10359205 | 3300026041 | Bacteria | 1303 |
| 267 | Ga0207678_10004639 | 3300026067 | Bacteria | 12341 |
| 268 | Ga0207678_10013383 | 3300026067 | Bacteria | 7200 |
| 269 | Ga0207678_10030358 | 3300026067 | Bacteria | 4719 |
| 270 | Ga0207678_10067010 | 3300026067 | Bacteria | 3082 |
| 271 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 272 | Ga0207702_10052014 | 3300026078 | Bacteria | 3464 |
| 273 | Ga0207641_10001956 | 3300026088 | Bacteria | 19735 |
| 274 | Ga0207641_10014543 | 3300026088 | Bacteria | 6449 |
| 275 | Ga0207648_10034362 | 3300026089 | Bacteria | 4469 |
| 276 | Ga0207676_10000135 | 3300026095 | Bacteria | 64914 |
| 277 | Ga0207676_10205114 | 3300026095 | Bacteria | 1745 |
| 278 | Ga0207674_10053514 | 3300026116 | Bacteria | 4114 |
| 279 | Ga0207674_10104724 | 3300026116 | Bacteria | 2807 |
| 280 | Ga0207683_10052351 | 3300026121 | Bacteria | 3577 |
| 281 | Ga0207683_10360216 | 3300026121 | Bacteria | 1336 |
| 282 | Ga0207698_10191263 | 3300026142 | Bacteria | 1823 |
| 283 | Ga0207698_10615445 | 3300026142 | Bacteria | 1072 |
| 284 | Ga0268266_10002693 | 3300028379 | Bacteria | 18642 |
| 285 | Ga0268266_10010918 | 3300028379 | Bacteria | 7906 |
| 286 | Ga0268266_10053456 | 3300028379 | Bacteria | 3470 |
| 287 | Ga0268266_10125342 | 3300028379 | Bacteria | 2291 |
| 288 | Ga0268266_10221988 | 3300028379 | Bacteria | 1737 |
| 289 | Ga0268266_10465545 | 3300028379 | Bacteria | 1203 |
| 290 | Ga0268265_10002613 | 3300028380 | Bacteria | 13402 |
| 291 | Ga0268265_10005223 | 3300028380 | Bacteria | 8892 |
| 292 | Ga0268265_10668714 | 3300028380 | Bacteria | 1000 |
| 293 | Ga0268264_10000205 | 3300028381 | Bacteria | 120743 |
| 294 | Ga0307408_100422836 | 3300031548 | Bacteria | 1149 |
| 295 | Ga0307409_100227201 | 3300031995 | Bacteria | 1689 |
| 296 | Ga0307510_10032760 | 3300033180 | Bacteria | 5850 |
| 297 | Ga0373934_0002999 | 3300035086 | Bacteria | 6168 |
| 298 | Ga0373940_0045965 | 3300035088 | Bacteria | 1214 |
| 299 | Ga0373944_0033791 | 3300035089 | Bacteria | 1551 |
| 300 | Ga0373952_0002709 | 3300035092 | Bacteria | 3198 |
| 301 | Ga0373923_0000787 | 3300035111 | Bacteria | 8263 |
| 302 | Ga0373932_0108671 | 3300035112 | Bacteria | 911 |
| 303 | Ga0373936_0034982 | 3300035113 | Bacteria | 1998 |
| 304 | Ga0373953_0002598 | 3300035117 | Bacteria | 5464 |
| 305 | Ga0373956_0002577 | 3300035119 | Bacteria | 7362 |
| 306 | Ga0373955_0014397 | 3300035172 | Bacteria | 3846 |
| 307 | Ga0373955_0135019 | 3300035172 | Bacteria | 1443 |
| 308 | Ga0373961_0050125 | 3300035241 | Unclassified | 1236 |
| 309 | Ga0373931_0003411 | 3300035691 | Bacteria | 7131 |
| 310 | Ga0373935_0010235 | 3300035692 | Bacteria | 5620 |
| 311 | Ga0373927_0000330 | 3300035695 | Bacteria | 37192 |
| 312 | Ga0373927_0016510 | 3300035695 | Bacteria | 4869 |
| 313 | Ga0373927_0088277 | 3300035695 | Bacteria | 2013 |
| 314 | Ga0373927_0263283 | 3300035695 | Bacteria | 1134 |
| 315 | Ga0373933_0102306 | 3300035724 | Bacteria | 1778 |
| 316 | Ga0373933_0130365 | 3300035724 | Bacteria | 1581 |
| 317 | Ga0373947_0159772 | 3300035725 | Bacteria | 1457 |
| 318 | Ga0373937_0019713 | 3300036401 | Bacteria | 6040 |
| 319 | Ga0373937_0025873 | 3300036401 | Bacteria | 5299 |
| 320 | Ga0373925_0000189 | 3300037068 | Bacteria | 67044 |
| 321 | Ga0373925_0003748 | 3300037068 | Bacteria | 11674 |
| 322 | Ga0373925_0106074 | 3300037068 | Bacteria | 2166 |
| 323 | Ga0395898_0005504 | 3300037466 | Bacteria | 13670 |
| 324 | Ga0395901_0305787 | 3300038443 | Bacteria | 1648 |
| 325 | Ga0436360_0071803 | 3300039438 | Bacteria | 10618 |
| 326 | Ga0466963_0145824 | 3300044694 | Bacteria | 1642 |
| 327 | Ga0466968_0177882 | 3300044735 | Bacteria | 988 |
| 328 | Ga0466959_0204902 | 3300045049 | Bacteria | 1372 |
| 329 | Ga0466959_0279325 | 3300045049 | Bacteria | 1146 |
| 330 | Ga0451576_0238954 | 3300045051 | Bacteria | 1898 |
| 331 | Ga0466967_0480894 | 3300045976 | Bacteria | 1217 |
| 332 | Ga0495592_0000440 | 3300046454 | Bacteria | 31213 |
| 333 | Ga0495592_0011779 | 3300046454 | Bacteria | 6625 |
| 334 | Ga0495590_0030546 | 3300046457 | Bacteria | 1888 |
| 335 | Ga0495641_0091431 | 3300046461 | Bacteria | 1360 |
| 336 | Ga0495651_0001974 | 3300046462 | Bacteria | 15891 |
| 337 | Ga0495653_0041205 | 3300046463 | Bacteria | 3605 |
| 338 | Ga0495580_0033754 | 3300046472 | Bacteria | 3685 |
| 339 | Ga0495582_0004751 | 3300046473 | Bacteria | 7638 |
| 340 | Ga0495605_0056077 | 3300046474 | Bacteria | 1901 |
| 341 | Ga0495605_0084130 | 3300046474 | Bacteria | 1484 |
| 342 | Ga0495662_0054807 | 3300046476 | Bacteria | 1926 |
| 343 | Ga0495664_0269279 | 3300046477 | Bacteria | 1029 |
| 344 | Ga0495584_0028917 | 3300046491 | Bacteria | 2809 |
| 345 | Ga0495584_0134615 | 3300046491 | Bacteria | 1254 |
| 346 | Ga0495585_0037608 | 3300046492 | Bacteria | 2725 |
| 347 | Ga0495585_0045574 | 3300046492 | Bacteria | 2447 |
| 348 | Ga0495594_0110631 | 3300046499 | Bacteria | 1549 |
| 349 | Ga0495606_0143477 | 3300046507 | Bacteria | 1408 |
| 350 | Ga0495608_0007439 | 3300046511 | Bacteria | 7737 |
| 351 | Ga0495610_0045805 | 3300046512 | Bacteria | 2162 |
| 352 | Ga0495618_0010345 | 3300046514 | Bacteria | 5645 |
| 353 | Ga0495628_0001182 | 3300046516 | Bacteria | 23838 |
| 354 | Ga0495630_0002384 | 3300046517 | Bacteria | 13057 |
| 355 | Ga0495631_0018925 | 3300046518 | Bacteria | 3236 |
| 356 | Ga0495643_0053714 | 3300046522 | Bacteria | 2159 |
| 357 | Ga0495644_0062067 | 3300046523 | Bacteria | 1404 |
| 358 | Ga0495666_0007700 | 3300046526 | Bacteria | 5387 |
| 359 | Ga0495652_0000852 | 3300046529 | Bacteria | 35119 |
| 360 | Ga0495652_0049980 | 3300046529 | Bacteria | 3577 |
| 361 | Ga0495665_0014336 | 3300046531 | Bacteria | 4275 |
| 362 | Ga0495586_0006398 | 3300046535 | Bacteria | 6291 |
| 363 | Ga0495587_0002215 | 3300046536 | Bacteria | 13002 |
| 364 | Ga0495609_0061852 | 3300046538 | Bacteria | 1654 |
| 365 | Ga0495609_0088899 | 3300046538 | Bacteria | 1344 |
| 366 | Ga0495645_0000523 | 3300046543 | Bacteria | 26523 |
| 367 | Ga0495645_0065411 | 3300046543 | Bacteria | 2630 |
| 368 | Ga0495622_0064476 | 3300046557 | Bacteria | 1694 |
| 369 | Ga0495622_0095376 | 3300046557 | Bacteria | 1365 |
| 370 | Ga0495633_0075553 | 3300046558 | Bacteria | 1569 |
| 371 | Ga0495667_0023692 | 3300046559 | Bacteria | 4134 |
| 372 | Ga0495656_0010986 | 3300046615 | Bacteria | 3311 |
| 373 | Ga0495668_0129018 | 3300046616 | Bacteria | 1384 |
| 374 | Ga0495634_0178358 | 3300046642 | Bacteria | 1331 |
| 375 | Ga0495625_0087742 | 3300046660 | Bacteria | 2156 |
| 376 | Ga0495635_0034909 | 3300046663 | Bacteria | 3488 |
| 377 | Ga0495659_0026766 | 3300046664 | Bacteria | 1985 |
| 378 | Ga0495657_0004303 | 3300046675 | Bacteria | 11367 |
| 379 | Ga0495657_0161794 | 3300046675 | Bacteria | 1385 |
| 380 | Ga0495599_0003877 | 3300046678 | Bacteria | 8797 |
| 381 | Ga0495599_0004742 | 3300046678 | Bacteria | 8078 |
| 382 | Ga0495647_0000817 | 3300046681 | Bacteria | 9291 |
| 383 | Ga0495658_0010206 | 3300046683 | Bacteria | 4694 |
| 384 | Ga0495669_0062168 | 3300046684 | Bacteria | 1691 |
| 385 | Ga0495613_0011074 | 3300046689 | Bacteria | 6696 |
| 386 | Ga0495624_0029620 | 3300046690 | Bacteria | 3570 |
| 387 | Ga0495624_0324757 | 3300046690 | Bacteria | 927 |
| 388 | Ga0495649_0055872 | 3300046694 | Bacteria | 2132 |
| 389 | Ga0495600_0010860 | 3300046809 | Bacteria | 5663 |
| 390 | Ga0495674_0003704 | 3300047319 | Bacteria | 14856 |
| 391 | Ga0495680_0004918 | 3300047322 | Bacteria | 12651 |
| 392 | Ga0495675_0017080 | 3300047444 | Bacteria | 4595 |
| 393 | Ga0495685_017938 | 3300047447 | Bacteria | 2426 |
| 394 | Ga0495673_0166671 | 3300047469 | Bacteria | 842 |
| 395 | Ga0495684_0097173 | 3300047471 | Bacteria | 2228 |
| 396 | Ga0495686_0048504 | 3300047472 | Bacteria | 2677 |
| 397 | Ga0496100_0021621 | 3300048903 | Bacteria | 3879 |
| 398 | Ga0496100_0167852 | 3300048903 | Bacteria | 1578 |
| 399 | Ga0496101_0070409 | 3300048904 | Bacteria | 2561 |
| 400 | Ga0496101_0116957 | 3300048904 | Bacteria | 2012 |
| 401 | Ga0496101_0176128 | 3300048904 | Bacteria | 1645 |
| 402 | Ga0496101_0265036 | 3300048904 | Bacteria | 1341 |
| 403 | Ga0496102_0008179 | 3300048905 | Bacteria | 8951 |
| 404 | Ga0496102_0035287 | 3300048905 | Bacteria | 4501 |
| 405 | Ga0496102_0050458 | 3300048905 | Bacteria | 3788 |
| 406 | Ga0496102_0146924 | 3300048905 | Bacteria | 2213 |
| 407 | Ga0496103_0021743 | 3300048906 | Bacteria | 3861 |
| 408 | Ga0496103_0157950 | 3300048906 | Bacteria | 1454 |
| 409 | Ga0496104_0029379 | 3300048907 | Bacteria | 5098 |
| 410 | Ga0496104_0034728 | 3300048907 | Bacteria | 4703 |
| 411 | Ga0496104_0177238 | 3300048907 | Bacteria | 2042 |
| 412 | Ga0496104_0474442 | 3300048907 | Bacteria | 1162 |
| 413 | Ga0496105_0008328 | 3300048908 | Bacteria | 8058 |
| 414 | Ga0496105_0028606 | 3300048908 | Bacteria | 4558 |
| 415 | Ga0496105_0076839 | 3300048908 | Bacteria | 2757 |
| 416 | Ga0496106_0010473 | 3300048909 | Bacteria | 6847 |
| 417 | Ga0496106_0010853 | 3300048909 | Bacteria | 6731 |
| 418 | Ga0496106_0262869 | 3300048909 | Unclassified | 1381 |
| 419 | Ga0496107_0009111 | 3300048910 | Bacteria | 6882 |
| 420 | Ga0496107_0021982 | 3300048910 | Bacteria | 4506 |
| 421 | Ga0496107_0024979 | 3300048910 | Bacteria | 4229 |
| 422 | Ga0496108_0072369 | 3300048911 | Bacteria | 2909 |
| 423 | Ga0496108_0137587 | 3300048911 | Bacteria | 2103 |
| 424 | Ga0496109_0039004 | 3300048912 | Bacteria | 4298 |
| 425 | Ga0496109_0133061 | 3300048912 | Bacteria | 2322 |
| 426 | Ga0496110_0044291 | 3300048913 | Bacteria | 3886 |
| 427 | Ga0496111_0086562 | 3300048914 | Bacteria | 2293 |
| 428 | Ga0496111_0405343 | 3300048914 | Bacteria | 1007 |
| 429 | Ga0496112_0040347 | 3300048915 | Bacteria | 4564 |
| 430 | Ga0496112_0316058 | 3300048915 | Bacteria | 1506 |
| 431 | Ga0496112_0452534 | 3300048915 | Bacteria | 1221 |
| 432 | Ga0496113_0013831 | 3300048916 | Bacteria | 5483 |
| 433 | Ga0496113_0130198 | 3300048916 | Bacteria | 1974 |
| 434 | Ga0496113_0483072 | 3300048916 | Bacteria | 995 |
| 435 | Ga0496114_0083707 | 3300048917 | Bacteria | 2699 |
| 436 | Ga0496114_0140852 | 3300048917 | Bacteria | 2088 |
| 437 | Ga0496114_0495586 | 3300048917 | Bacteria | 1081 |
| 438 | Ga0496115_0001003 | 3300048918 | Bacteria | 20483 |
| 439 | Ga0496115_0024369 | 3300048918 | Bacteria | 4702 |
| 440 | Ga0496115_0030075 | 3300048918 | Bacteria | 4270 |
| 441 | Ga0496115_0037215 | 3300048918 | Bacteria | 3856 |
| 442 | Ga0496115_0061677 | 3300048918 | Bacteria | 3023 |
| 443 | Ga0496115_0133846 | 3300048918 | Bacteria | 2044 |
| 444 | Ga0496116_0010567 | 3300048919 | Bacteria | 7721 |
| 445 | Ga0496117_0078928 | 3300048920 | Bacteria | 2171 |
| 446 | Ga0496118_0078106 | 3300048921 | Bacteria | 2344 |
| 447 | Ga0496118_0124990 | 3300048921 | Bacteria | 1667 |
| 448 | Ga0496118_0261676 | 3300048921 | Bacteria | 976 |
| 449 | Ga0496119_0001434 | 3300048922 | Bacteria | 28747 |
| 450 | Ga0496119_0091383 | 3300048922 | Bacteria | 1729 |
| 451 | Ga0496120_0000191 | 3300048923 | Bacteria | 105146 |
| 452 | Ga0496121_0000194 | 3300048924 | Bacteria | 136324 |
| 453 | Ga0496121_0014106 | 3300048924 | Bacteria | 8518 |
| 454 | Ga0496121_0016456 | 3300048924 | Bacteria | 7634 |
| 455 | Ga0496121_0021187 | 3300048924 | Bacteria | 6381 |
| 456 | Ga0496121_0338521 | 3300048924 | Bacteria | 1006 |
| 457 | Ga0496124_0337087 | 3300048927 | Bacteria | 1073 |
| 458 | Ga0496125_0116191 | 3300048928 | Bacteria | 1922 |
| 459 | Ga0496125_0257622 | 3300048928 | Bacteria | 1096 |
| 460 | Ga0496126_0018183 | 3300048929 | Bacteria | 6973 |
| 461 | Ga0496126_0087032 | 3300048929 | Bacteria | 2753 |
| 462 | Ga0496126_0171680 | 3300048929 | Bacteria | 1847 |
| 463 | Ga0496126_0204665 | 3300048929 | Bacteria | 1664 |
| 464 | Ga0496126_0205138 | 3300048929 | Bacteria | 1662 |
| 465 | Ga0501076_0336323 | 3300049592 | Bacteria | 1239 |
| 466 | Ga0501080_0113909 | 3300049742 | Bacteria | 2507 |
| 467 | Ga0501083_0065690 | 3300049744 | Bacteria | 2417 |
| 468 | nmdc:mga03683_139961_c1 | 3300050489 | Bacteria | 1087 |
| 469 | nmdc:mga03683_203672_c1 | 3300050489 | Bacteria | 909 |
| 470 | nmdc:mga03n38_179_c1 | 3300050490 | Bacteria | 14281 |
| 471 | nmdc:mga03n38_25670_c1 | 3300050490 | Bacteria | 1887 |
| 472 | nmdc:mga03n38_27040_c1 | 3300050490 | Bacteria | 2375 |
| 473 | nmdc:mga00v17_1307_c1 | 3300050491 | Bacteria | 13048 |
| 474 | nmdc:mga00v17_39953_c1 | 3300050491 | Bacteria | 2812 |
| 475 | nmdc:mga00v17_8568_c1 | 3300050491 | Bacteria | 5504 |
| 476 | nmdc:mga0yw44_11712_c1 | 3300050492 | Bacteria | 4542 |
| 477 | nmdc:mga0yw44_93576_c1 | 3300050492 | Bacteria | 1903 |
| 478 | nmdc:mga0k408_88614_c1 | 3300050493 | Bacteria | 1817 |
| 479 | nmdc:mga06z11_136937_c1 | 3300050494 | Bacteria | 1380 |
| 480 | nmdc:mga06z11_5694_c1 | 3300050494 | Bacteria | 5019 |
| 481 | nmdc:mga06z11_7234_c1 | 3300050494 | Bacteria | 4558 |
| 482 | nmdc:mga06z11_73244_c1 | 3300050494 | Bacteria | 1818 |
| 483 | nmdc:mga04h51_128395_c1 | 3300050495 | Bacteria | 951 |
| 484 | nmdc:mga07m45_45737_c1 | 3300050496 | Bacteria | 2458 |
| 485 | nmdc:mga07m45_6880_c1 | 3300050496 | Bacteria | 5783 |
| 486 | nmdc:mga0rr50_336000_c1 | 3300050513 | Bacteria | 1269 |
| 487 | nmdc:mga08x19_3584_c1 | 3300050514 | Bacteria | 9236 |
| 488 | Ga0495601_0002852 | 3300053077 | Bacteria | 9818 |
| 489 | Ga0495601_0033755 | 3300053077 | Bacteria | 3189 |
| 490 | Ga0495612_0151647 | 3300053078 | Bacteria | 1009 |
| 491 | Ga0495595_0012489 | 3300053084 | Bacteria | 3572 |
| 492 | Ga0495619_0013254 | 3300053085 | Bacteria | 5196 |
| 493 | Ga0500641_0036209 | 3300053096 | Bacteria | 1973 |
| 494 | Ga0500555_002222 | 3300053103 | Bacteria | 5666 |
| 495 | Ga0500562_018021 | 3300053108 | Bacteria | 1822 |
| 496 | Ga0500592_010640 | 3300053116 | Bacteria | 1468 |
| 497 | Ga0500595_001029 | 3300053119 | Bacteria | 15582 |
| 498 | Ga0500595_033417 | 3300053119 | Bacteria | 1707 |
| 499 | Ga0500642_0015212 | 3300053130 | Bacteria | 2886 |
| 500 | Ga0500652_000011 | 3300053131 | Bacteria | 160704 |
| 501 | Ga0500616_0034676 | 3300053153 | Bacteria | 2747 |
| 502 | Ga0500616_0048552 | 3300053153 | Bacteria | 2250 |
| 503 | Ga0500627_0091499 | 3300053158 | Bacteria | 1362 |
| 504 | Ga0500636_0060075 | 3300053177 | Bacteria | 2220 |
| 505 | Ga0500637_0019587 | 3300053178 | Bacteria | 3651 |
| 506 | Ga0500645_057809 | 3300053730 | Bacteria | 1124 |
| 507 | Ga0500656_017363 | 3300053732 | Bacteria | 861 |
| 508 | Ga0501084_0450911 | 3300054114 | Bacteria | 1087 |
| 509 | Ga0501082_0197848 | 3300060353 | Bacteria | 1748 |
| 510 | 2507510512 | 2507262055 | Bacteria | 8048963 |
| 511 | 2513878765 | 2513237139 | Bacteria | 8737671 |
| 512 | 2528853031 | 2528768022 | Bacteria | 10457665 |
| 513 | 2723846977 | 2721755755 | Bacteria | 8322773 |
| 514 | 2793084226 | |||
| 515 | 2805921414 | 2802429603 | Bacteria | 8777136 |
| 516 | 2824613703 | 2824609381 | Bacteria | 8672835 |
| 517 | 2824664886 | 2824661429 | Bacteria | 9877870 |
| 518 | 2824672226 | 2824671348 | Bacteria | 8369588 |
| 519 | 2824682171 | 2824679649 | Bacteria | 8248951 |
| 520 | 2824688891 | 2824687955 | Bacteria | 8360029 |
| 521 | 2824697728 | 2824696289 | Bacteria | 8335049 |
| 522 | 2841947682 | 2841941048 | Bacteria | 8688029 |
| 523 | 2841947999 | 2841941048 | Bacteria | 8688029 |
| 524 | 2841973081 | 2841966195 | Bacteria | 8673214 |
| 525 | 2841978330 | 2841974524 | Bacteria | 8931498 |
| 526 | 2842040768 | 2842038055 | Bacteria | 8002051 |
| 527 | 2842042994 | 2842038055 | Bacteria | 8002051 |
| 528 | 2842046286 | 2842045827 | Bacteria | 8006841 |
| 529 | 2842051035 | 2842045827 | Bacteria | 8006841 |
| 530 | 2847947868 | 2847939898 | Bacteria | 8606328 |
| 531 | 2876811047 | 2876808645 | Bacteria | 8824342 |
| 532 | 2879109143 | 2879099564 | Bacteria | 10442239 |
| 533 | 2879114551 | 2879110137 | Bacteria | 8907982 |
| 534 | 2885370085 | 2885366525 | Bacteria | 8326213 |
| 535 | 2889038200 | 2889033259 | Bacteria | 9099371 |
| 536 | 2922375357 | |||
| 537 | 2922391650 | 2922386360 | Bacteria | 7017218 |
| 538 | 2922396952 | 2922393267 | Bacteria | 8285685 |
| 539 | 2932811522 | 2932809354 | Bacteria | 9135765 |
| 540 | 2932819678 | 2932818245 | Bacteria | 9955613 |
| 541 | 2935618887 | 2935616580 | Bacteria | 9032984 |
| 542 | 2935643297 | 2935638405 | Bacteria | 10015038 |
| 543 | 2935669922 | 2935665750 | Bacteria | 9571747 |
| 544 | 2935676936 | 2935675223 | Bacteria | 9928132 |
| 545 | 2935692976 | 2935684952 | Bacteria | 9590419 |
| 546 | 2935695532 | 2935694250 | Bacteria | 9291695 |
| 547 | 2935719584 | 2935713505 | Bacteria | 9608509 |
| 548 | 2935729649 | 2935722832 | Bacteria | 9608746 |
| 549 | 2935739467 | 2935732158 | Bacteria | 9706831 |
| 550 | 2935748505 | 2935741537 | Bacteria | 9707219 |
| 551 | 2935756908 | 2935750917 | Bacteria | 9590372 |
| 552 | 2935761104 | 2935760218 | Bacteria | 9817913 |
| 553 | 2935807439 | 2935801545 | Bacteria | 9301974 |
| 554 | 2935812579 | 2935810662 | Bacteria | 9401221 |
| 555 | 2935832560 | 2935827899 | Bacteria | 10038562 |
| 556 | 2935839362 | 2935837841 | Bacteria | 9454360 |
| 557 | 2935857252 | 2935855204 | Bacteria | 9035059 |
| 558 | 2935864780 | 2935864058 | Bacteria | 9784707 |
| 559 | 2935876558 | 2935873716 | Bacteria | 9632195 |
| 560 | 2936039172 | 2936037263 | Bacteria | 9446081 |
| 561 | 2940562822 | 2940556831 | Bacteria | 9590747 |
| 562 | 2941540051 | 2941538514 | Bacteria | 9402094 |
| 563 | 3005511295 | 3005506211 | Bacteria | 6943378 |
| 564 | 8006927543 | 8006926726 | Bacteria | 6749210 |
| 565 | 8056679458 | 8056673599 | Bacteria | 7871253 |
| 566 | Ga0228598_1014508 | |||
| 567 | JGI25153J46596_10005767 | |||
| 568 | rootH2_10086155 | |||
| 569 | JGI25404J52841_10005883 | |||
| 570 | Ga0070658_10266411 | |||
| 571 | Ga0070670_100000007 | |||
| 572 | Ga0070670_100105213 | |||
| 573 | Ga0070666_10181658 | |||
| 574 | Ga0070680_100006521 | |||
| 575 | Ga0070680_100552042 | |||
| 576 | Ga0070682_100014439 | |||
| 577 | Ga0070682_100055989 | |||
| 578 | Ga0068868_100117289 | |||
| 579 | Ga0070660_100228212 | |||
| 580 | Ga0070668_100000272 | |||
| 581 | Ga0070668_100015445 | |||
| 582 | Ga0070668_100266956 | |||
| 583 | Ga0070669_100300752 | |||
| 584 | Ga0070675_100216666 | |||
| 585 | Ga0070671_100345203 | |||
| 586 | Ga0070671_100376081 | |||
| 587 | Ga0070673_100506009 | |||
| 588 | Ga0070688_100095622 | |||
| 589 | Ga0070688_100306263 | |||
| 590 | Ga0070667_100000291 | |||
| 591 | Ga0070667_100079987 | |||
| 592 | Ga0070709_10005766 | |||
| 593 | Ga0070709_10009329 | |||
| 594 | Ga0070714_100654529 | |||
| 595 | Ga0070713_100071130 | |||
| 596 | Ga0070710_10008177 | |||
| 597 | Ga0070711_100124084 | |||
| 598 | Ga0070711_100131934 | |||
| 599 | Ga0070711_100301909 | |||
| 600 | Ga0070711_100365957 | |||
| 601 | Ga0070708_100055036 | |||
| 602 | Ga0070663_100003582 | |||
| 603 | Ga0070678_100026340 | |||
| 604 | Ga0070678_100104752 | |||
| 605 | Ga0070678_100473470 | |||
| 606 | Ga0070662_100378751 | |||
| 607 | Ga0070681_10008020 | |||
| 608 | Ga0070681_10241075 | |||
| 609 | Ga0068867_100227185 | |||
| 610 | Ga0070707_100042523 | |||
| 611 | Ga0070679_100384868 | |||
| 612 | Ga0068853_100132345 | |||
| 613 | Ga0068853_100171794 | |||
| 614 | Ga0068853_100438863 | |||
| 615 | Ga0070672_100150473 | |||
| 616 | Ga0070686_100555156 | |||
| 617 | Ga0070693_100055025 | |||
| 618 | Ga0070665_100003234 | |||
| 619 | Ga0070665_100010298 | |||
| 620 | Ga0070665_100016020 | |||
| 621 | Ga0070665_100187191 | |||
| 622 | Ga0070665_100455978 | |||
| 623 | Ga0070704_100057507 | |||
| 624 | Ga0068855_100163429 | |||
| 625 | Ga0068855_100329170 | |||
| 626 | Ga0070664_100060359 | |||
| 627 | Ga0068857_100160833 | |||
| 628 | Ga0068854_100044610 | |||
| 629 | Ga0068854_100146121 | |||
| 630 | Ga0068854_100542925 | |||
| 631 | Ga0068856_100007962 | |||
| 632 | Ga0068856_100167307 | |||
| 633 | Ga0068856_100398453 | |||
| 634 | Ga0070702_100190904 | |||
| 635 | Ga0068852_100073621 | |||
| 636 | Ga0068852_100268747 | |||
| 637 | Ga0068859_100020603 | |||
| 638 | Ga0068859_100115233 | |||
| 639 | Ga0068859_100310837 | |||
| 640 | Ga0068864_100000602 | |||
| 641 | Ga0068864_100184050 | |||
| 642 | Ga0068851_10031799 | |||
| 643 | Ga0068863_100002394 | |||
| 644 | Ga0068863_100003290 | |||
| 645 | Ga0068858_100007017 | |||
| 646 | Ga0068858_100038829 | |||
| 647 | Ga0068858_100590713 | |||
| 648 | Ga0068858_100610961 | |||
| 649 | Ga0068860_100000047 | |||
| 650 | Ga0068860_100158620 | |||
| 651 | Ga0068860_100920864 | |||
| 652 | Ga0068862_100004658 | |||
| 653 | Ga0068862_100126419 | |||
| 654 | Ga0081455_10164781 | |||
| 655 | Ga0081540_1004421 | |||
| 656 | Ga0081540_1009221 | |||
| 657 | Ga0081540_1016872 | |||
| 658 | Ga0081540_1019984 | |||
| 659 | Ga0081539_10056696 | |||
| 660 | Ga0070717_10562982 | |||
| 661 | Ga0075365_10011931 | |||
| 662 | Ga0075365_10065447 | |||
| 663 | Ga0075365_10405701 | |||
| 664 | Ga0075365_10435302 | |||
| 665 | Ga0075368_10011351 | |||
| 666 | Ga0075363_100015694 | |||
| 667 | Ga0075363_100073289 | |||
| 668 | Ga0075363_100111925 | |||
| 669 | Ga0075364_10051887 | |||
| 670 | Ga0070715_10001142 | |||
| 671 | Ga0070716_100012226 | |||
| 672 | Ga0070716_100045261 | |||
| 673 | Ga0070712_100032267 | |||
| 674 | Ga0070712_100153243 | |||
| 675 | Ga0070712_100215504 | |||
| 676 | Ga0075367_10009022 | |||
| 677 | Ga0075367_10024731 | |||
| 678 | Ga0075367_10109196 | |||
| 679 | Ga0075367_10135113 | |||
| 680 | Ga0075367_10141687 | |||
| 681 | Ga0075366_10081008 | |||
| 682 | Ga0097621_100025798 | |||
| 683 | Ga0097621_100145456 | |||
| 684 | Ga0075370_10006007 | |||
| 685 | Ga0075370_10076082 | |||
| 686 | Ga0075370_10078522 | |||
| 687 | Ga0075428_100105629 | |||
| 688 | Ga0075434_100115043 | |||
| 689 | Ga0068865_100031677 | |||
| 690 | Ga0068865_100035084 | |||
| 691 | Ga0068865_100057174 | |||
| 692 | Ga0075436_100009604 | |||
| 693 | Ga0097620_100020603 | |||
| 694 | Ga0097620_100115234 | |||
| 695 | Ga0097620_100310853 | |||
| 696 | Ga0105250_10010684 | |||
| 697 | Ga0105240_10247050 | |||
| 698 | Ga0105240_10285898 | |||
| 699 | Ga0105240_10875195 | |||
| 700 | Ga0111539_10700715 | |||
| 701 | Ga0105247_10008386 | |||
| 702 | Ga0105247_10086275 | |||
| 703 | Ga0105247_10216945 | |||
| 704 | Ga0105241_10015022 | |||
| 705 | Ga0105241_10021256 | |||
| 706 | Ga0105241_10068374 | |||
| 707 | Ga0105241_10305493 | |||
| 708 | Ga0105242_10045521 | |||
| 709 | Ga0105242_10072239 | |||
| 710 | Ga0105248_10020021 | |||
| 711 | Ga0105248_10064445 | |||
| 712 | Ga0105248_10121315 | |||
| 713 | Ga0105237_10037442 | |||
| 714 | Ga0105237_10063110 | |||
| 715 | Ga0105237_10376234 | |||
| 716 | Ga0105238_10014119 | |||
| 717 | Ga0105238_10069504 | |||
| 718 | Ga0105238_10121756 | |||
| 719 | Ga0105249_10035579 | |||
| 720 | Ga0105249_10036033 | |||
| 721 | Ga0105249_10942970 | |||
| 722 | Ga0105239_10042593 | |||
| 723 | Ga0105239_10052568 | |||
| 724 | Ga0105239_10085045 | |||
| 725 | Ga0105239_10163130 | |||
| 726 | Ga0105246_10024427 | |||
| 727 | Ga0105246_10124930 | |||
| 728 | Ga0105246_10143365 | |||
| 729 | Ga0105246_10304214 | |||
| 730 | Ga0157370_10018226 | |||
| 731 | Ga0157369_10112023 | |||
| 732 | Ga0157374_10251054 | |||
| 733 | Ga0157378_10163185 | |||
| 734 | Ga0157378_11051713 | |||
| 735 | Ga0163162_10017064 | |||
| 736 | Ga0163162_10056854 | |||
| 737 | Ga0163162_10368895 | |||
| 738 | Ga0163162_10510094 | |||
| 739 | Ga0157372_10039160 | |||
| 740 | Ga0157372_10196432 | |||
| 741 | Ga0157372_10355607 | |||
| 742 | Ga0157375_10123158 | |||
| 743 | Ga0157375_10232115 | |||
| 744 | Ga0157375_10343820 | |||
| 745 | Ga0163163_10019480 | |||
| 746 | Ga0163163_10060930 | |||
| 747 | Ga0163163_10089963 | |||
| 748 | Ga0163163_10539984 | |||
| 749 | Ga0163163_10569636 | |||
| 750 | Ga0163163_10741898 | |||
| 751 | Ga0157380_10063301 | |||
| 752 | Ga0157380_10086406 | |||
| 753 | Ga0157379_10076576 | |||
| 754 | Ga0157379_10104367 | |||
| 755 | Ga0157379_10320461 | |||
| 756 | Ga0157376_10012548 | |||
| 757 | Ga0157376_10029471 | |||
| 758 | Ga0157376_10053374 | |||
| 759 | Ga0163161_10534481 | |||
| 760 | Ga0209758_1001959 | |||
| 761 | Ga0209758_1003253 | |||
| 762 | Ga0209051_1004879 | |||
| 763 | Ga0207692_10028158 | |||
| 764 | Ga0207692_10280989 | |||
| 765 | Ga0207642_10235482 | |||
| 766 | Ga0207710_10018369 | |||
| 767 | Ga0207680_10164617 | |||
| 768 | Ga0207699_10174802 | |||
| 769 | Ga0207699_10193644 | |||
| 770 | Ga0207684_10333009 | |||
| 771 | Ga0207654_10001534 | |||
| 772 | Ga0207654_10016365 | |||
| 773 | Ga0207654_10022763 | |||
| 774 | Ga0207654_10110818 | |||
| 775 | Ga0207707_10004831 | |||
| 776 | Ga0207695_10000883 | |||
| 777 | Ga0207695_10044279 | |||
| 778 | Ga0207671_10478325 | |||
| 779 | Ga0207693_10025517 | |||
| 780 | Ga0207693_10076675 | |||
| 781 | Ga0207693_10212602 | |||
| 782 | Ga0207663_10151934 | |||
| 783 | Ga0207663_10163987 | |||
| 784 | Ga0207660_10074189 | |||
| 785 | Ga0207660_10470291 | |||
| 786 | Ga0207657_10169746 | |||
| 787 | Ga0207652_10003656 | |||
| 788 | Ga0207681_10279429 | |||
| 789 | Ga0207694_10006086 | |||
| 790 | Ga0207694_10049365 | |||
| 791 | Ga0207694_10144981 | |||
| 792 | Ga0207650_10000033 | |||
| 793 | Ga0207650_10134790 | |||
| 794 | Ga0207700_10049120 | |||
| 795 | Ga0207700_10131409 | |||
| 796 | Ga0207644_10146018 | |||
| 797 | Ga0207644_10259209 | |||
| 798 | Ga0207706_10050502 | |||
| 799 | Ga0207706_10094732 | |||
| 800 | Ga0207706_10529126 | |||
| 801 | Ga0207709_10015308 | |||
| 802 | Ga0207709_10338902 | |||
| 803 | Ga0207669_10271894 | |||
| 804 | Ga0207704_10022494 | |||
| 805 | Ga0207704_10111386 | |||
| 806 | Ga0207665_10008742 | |||
| 807 | Ga0207665_10080294 | |||
| 808 | Ga0207691_10058156 | |||
| 809 | Ga0207711_10064556 | |||
| 810 | Ga0207689_10044978 | |||
| 811 | Ga0207689_10107352 | |||
| 812 | Ga0207661_10180607 | |||
| 813 | Ga0207679_10006975 | |||
| 814 | Ga0207679_10039760 | |||
| 815 | Ga0207679_10681738 | |||
| 816 | Ga0207667_10286511 | |||
| 817 | Ga0207651_10507146 | |||
| 818 | Ga0207712_10013494 | |||
| 819 | Ga0207668_10000874 | |||
| 820 | Ga0207668_10040566 | |||
| 821 | Ga0207668_10078244 | |||
| 822 | Ga0207668_10293735 | |||
| 823 | Ga0207640_10173040 | |||
| 824 | Ga0207658_10000323 | |||
| 825 | Ga0207677_10058426 | |||
| 826 | Ga0207677_10126954 | |||
| 827 | Ga0207677_10269123 | |||
| 828 | Ga0207703_10000065 | |||
| 829 | Ga0207703_10023981 | |||
| 830 | Ga0207639_10190919 | |||
| 831 | Ga0207639_10359205 | |||
| 832 | Ga0207678_10004639 | |||
| 833 | Ga0207678_10013383 | |||
| 834 | Ga0207678_10030358 | |||
| 835 | Ga0207678_10067010 | |||
| 836 | Ga0207702_10000005 | |||
| 837 | Ga0207702_10052014 | |||
| 838 | Ga0207641_10001956 | |||
| 839 | Ga0207641_10014543 | |||
| 840 | Ga0207648_10034362 | |||
| 841 | Ga0207676_10000135 | |||
| 842 | Ga0207676_10205114 | |||
| 843 | Ga0207674_10053514 | |||
| 844 | Ga0207674_10104724 | |||
| 845 | Ga0207683_10052351 | |||
| 846 | Ga0207683_10360216 | |||
| 847 | Ga0207698_10191263 | |||
| 848 | Ga0207698_10615445 | |||
| 849 | Ga0268266_10002693 | |||
| 850 | Ga0268266_10010918 | |||
| 851 | Ga0268266_10053456 | |||
| 852 | Ga0268266_10125342 | |||
| 853 | Ga0268266_10221988 | |||
| 854 | Ga0268266_10465545 | |||
| 855 | Ga0268265_10002613 | |||
| 856 | Ga0268265_10005223 | |||
| 857 | Ga0268265_10668714 | |||
| 858 | Ga0268264_10000205 | |||
| 859 | Ga0307408_100422836 | |||
| 860 | Ga0307409_100227201 | |||
| 861 | Ga0307510_10032760 | |||
| 862 | Ga0373934_0002999 | |||
| 863 | Ga0373940_0045965 | |||
| 864 | Ga0373944_0033791 | |||
| 865 | Ga0373952_0002709 | |||
| 866 | Ga0373923_0000787 | |||
| 867 | Ga0373932_0108671 | |||
| 868 | Ga0373936_0034982 | |||
| 869 | Ga0373953_0002598 | |||
| 870 | Ga0373956_0002577 | |||
| 871 | Ga0373955_0014397 | |||
| 872 | Ga0373955_0135019 | |||
| 873 | Ga0373961_0050125 | |||
| 874 | Ga0373931_0003411 | |||
| 875 | Ga0373935_0010235 | |||
| 876 | Ga0373927_0000330 | |||
| 877 | Ga0373927_0016510 | |||
| 878 | Ga0373927_0088277 | |||
| 879 | Ga0373927_0263283 | |||
| 880 | Ga0373933_0102306 | |||
| 881 | Ga0373933_0130365 | |||
| 882 | Ga0373947_0159772 | |||
| 883 | Ga0373937_0019713 | |||
| 884 | Ga0373937_0025873 | |||
| 885 | Ga0373925_0000189 | |||
| 886 | Ga0373925_0003748 | |||
| 887 | Ga0373925_0106074 | |||
| 888 | Ga0395898_0005504 | |||
| 889 | Ga0395901_0305787 | |||
| 890 | Ga0436360_0071803 | |||
| 891 | Ga0466963_0145824 | |||
| 892 | Ga0466968_0177882 | |||
| 893 | Ga0466959_0204902 | |||
| 894 | Ga0466959_0279325 | |||
| 895 | Ga0451576_0238954 | |||
| 896 | Ga0466967_0480894 | |||
| 897 | Ga0495592_0000440 | |||
| 898 | Ga0495592_0011779 | |||
| 899 | Ga0495590_0030546 | |||
| 900 | Ga0495641_0091431 | |||
| 901 | Ga0495651_0001974 | |||
| 902 | Ga0495653_0041205 | |||
| 903 | Ga0495580_0033754 | |||
| 904 | Ga0495582_0004751 | |||
| 905 | Ga0495605_0056077 | |||
| 906 | Ga0495605_0084130 | |||
| 907 | Ga0495662_0054807 | |||
| 908 | Ga0495664_0269279 | |||
| 909 | Ga0495584_0028917 | |||
| 910 | Ga0495584_0134615 | |||
| 911 | Ga0495585_0037608 | |||
| 912 | Ga0495585_0045574 | |||
| 913 | Ga0495594_0110631 | |||
| 914 | Ga0495606_0143477 | |||
| 915 | Ga0495608_0007439 | |||
| 916 | Ga0495610_0045805 | |||
| 917 | Ga0495618_0010345 | |||
| 918 | Ga0495628_0001182 | |||
| 919 | Ga0495630_0002384 | |||
| 920 | Ga0495631_0018925 | |||
| 921 | Ga0495643_0053714 | |||
| 922 | Ga0495644_0062067 | |||
| 923 | Ga0495666_0007700 | |||
| 924 | Ga0495652_0000852 | |||
| 925 | Ga0495652_0049980 | |||
| 926 | Ga0495665_0014336 | |||
| 927 | Ga0495586_0006398 | |||
| 928 | Ga0495587_0002215 | |||
| 929 | Ga0495609_0061852 | |||
| 930 | Ga0495609_0088899 | |||
| 931 | Ga0495645_0000523 | |||
| 932 | Ga0495645_0065411 | |||
| 933 | Ga0495622_0064476 | |||
| 934 | Ga0495622_0095376 | |||
| 935 | Ga0495633_0075553 | |||
| 936 | Ga0495667_0023692 | |||
| 937 | Ga0495656_0010986 | |||
| 938 | Ga0495668_0129018 | |||
| 939 | Ga0495634_0178358 | |||
| 940 | Ga0495625_0087742 | |||
| 941 | Ga0495635_0034909 | |||
| 942 | Ga0495659_0026766 | |||
| 943 | Ga0495657_0004303 | |||
| 944 | Ga0495657_0161794 | |||
| 945 | Ga0495599_0003877 | |||
| 946 | Ga0495599_0004742 | |||
| 947 | Ga0495647_0000817 | |||
| 948 | Ga0495658_0010206 | |||
| 949 | Ga0495669_0062168 | |||
| 950 | Ga0495613_0011074 | |||
| 951 | Ga0495624_0029620 | |||
| 952 | Ga0495624_0324757 | |||
| 953 | Ga0495649_0055872 | |||
| 954 | Ga0495600_0010860 | |||
| 955 | Ga0495674_0003704 | |||
| 956 | Ga0495680_0004918 | |||
| 957 | Ga0495675_0017080 | |||
| 958 | Ga0495685_017938 | |||
| 959 | Ga0495673_0166671 | |||
| 960 | Ga0495684_0097173 | |||
| 961 | Ga0495686_0048504 | |||
| 962 | Ga0496100_0021621 | |||
| 963 | Ga0496100_0167852 | |||
| 964 | Ga0496101_0070409 | |||
| 965 | Ga0496101_0116957 | |||
| 966 | Ga0496101_0176128 | |||
| 967 | Ga0496101_0265036 | |||
| 968 | Ga0496102_0008179 | |||
| 969 | Ga0496102_0035287 | |||
| 970 | Ga0496102_0050458 | |||
| 971 | Ga0496102_0146924 | |||
| 972 | Ga0496103_0021743 | |||
| 973 | Ga0496103_0157950 | |||
| 974 | Ga0496104_0029379 | |||
| 975 | Ga0496104_0034728 | |||
| 976 | Ga0496104_0177238 | |||
| 977 | Ga0496104_0474442 | |||
| 978 | Ga0496105_0008328 | |||
| 979 | Ga0496105_0028606 | |||
| 980 | Ga0496105_0076839 | |||
| 981 | Ga0496106_0010473 | |||
| 982 | Ga0496106_0010853 | |||
| 983 | Ga0496106_0262869 | |||
| 984 | Ga0496107_0009111 | |||
| 985 | Ga0496107_0021982 | |||
| 986 | Ga0496107_0024979 | |||
| 987 | Ga0496108_0072369 | |||
| 988 | Ga0496108_0137587 | |||
| 989 | Ga0496109_0039004 | |||
| 990 | Ga0496109_0133061 | |||
| 991 | Ga0496110_0044291 | |||
| 992 | Ga0496111_0086562 | |||
| 993 | Ga0496111_0405343 | |||
| 994 | Ga0496112_0040347 | |||
| 995 | Ga0496112_0316058 | |||
| 996 | Ga0496112_0452534 | |||
| 997 | Ga0496113_0013831 | |||
| 998 | Ga0496113_0130198 | |||
| 999 | Ga0496113_0483072 | |||
| 1000 | Ga0496114_0083707 | |||
| 1001 | Ga0496114_0140852 | |||
| 1002 | Ga0496114_0495586 | |||
| 1003 | Ga0496115_0001003 | |||
| 1004 | Ga0496115_0024369 | |||
| 1005 | Ga0496115_0030075 | |||
| 1006 | Ga0496115_0037215 | |||
| 1007 | Ga0496115_0061677 | |||
| 1008 | Ga0496115_0133846 | |||
| 1009 | Ga0496116_0010567 | |||
| 1010 | Ga0496117_0078928 | |||
| 1011 | Ga0496118_0078106 | |||
| 1012 | Ga0496118_0124990 | |||
| 1013 | Ga0496118_0261676 | |||
| 1014 | Ga0496119_0001434 | |||
| 1015 | Ga0496119_0091383 | |||
| 1016 | Ga0496120_0000191 | |||
| 1017 | Ga0496121_0000194 | |||
| 1018 | Ga0496121_0014106 | |||
| 1019 | Ga0496121_0016456 | |||
| 1020 | Ga0496121_0021187 | |||
| 1021 | Ga0496121_0338521 | |||
| 1022 | Ga0496124_0337087 | |||
| 1023 | Ga0496125_0116191 | |||
| 1024 | Ga0496125_0257622 | |||
| 1025 | Ga0496126_0018183 | |||
| 1026 | Ga0496126_0087032 | |||
| 1027 | Ga0496126_0171680 | |||
| 1028 | Ga0496126_0204665 | |||
| 1029 | Ga0496126_0205138 | |||
| 1030 | Ga0501076_0336323 | |||
| 1031 | Ga0501080_0113909 | |||
| 1032 | Ga0501083_0065690 | |||
| 1033 | nmdc:mga03683_139961_c1 | |||
| 1034 | nmdc:mga03683_203672_c1 | |||
| 1035 | nmdc:mga03n38_179_c1 | |||
| 1036 | nmdc:mga03n38_25670_c1 | |||
| 1037 | nmdc:mga03n38_27040_c1 | |||
| 1038 | nmdc:mga00v17_1307_c1 | |||
| 1039 | nmdc:mga00v17_39953_c1 | |||
| 1040 | nmdc:mga00v17_8568_c1 | |||
| 1041 | nmdc:mga0yw44_11712_c1 | |||
| 1042 | nmdc:mga0yw44_93576_c1 | |||
| 1043 | nmdc:mga0k408_88614_c1 | |||
| 1044 | nmdc:mga06z11_136937_c1 | |||
| 1045 | nmdc:mga06z11_5694_c1 | |||
| 1046 | nmdc:mga06z11_7234_c1 | |||
| 1047 | nmdc:mga06z11_73244_c1 | |||
| 1048 | nmdc:mga04h51_128395_c1 | |||
| 1049 | nmdc:mga07m45_45737_c1 | |||
| 1050 | nmdc:mga07m45_6880_c1 | |||
| 1051 | nmdc:mga0rr50_336000_c1 | |||
| 1052 | nmdc:mga08x19_3584_c1 | |||
| 1053 | Ga0495601_0002852 | |||
| 1054 | Ga0495601_0033755 | |||
| 1055 | Ga0495612_0151647 | |||
| 1056 | Ga0495595_0012489 | |||
| 1057 | Ga0495619_0013254 | |||
| 1058 | Ga0500641_0036209 | |||
| 1059 | Ga0500555_002222 | |||
| 1060 | Ga0500562_018021 | |||
| 1061 | Ga0500592_010640 | |||
| 1062 | Ga0500595_001029 | |||
| 1063 | Ga0500595_033417 | |||
| 1064 | Ga0500642_0015212 | |||
| 1065 | Ga0500652_000011 | |||
| 1066 | Ga0500616_0034676 | |||
| 1067 | Ga0500616_0048552 | |||
| 1068 | Ga0500627_0091499 | |||
| 1069 | Ga0500636_0060075 | |||
| 1070 | Ga0500637_0019587 | |||
| 1071 | Ga0500645_057809 | |||
| 1072 | Ga0500656_017363 | |||
| 1073 | Ga0501084_0450911 | |||
| 1074 | Ga0501082_0197848 | |||
| 1075 | 2507510512 | |||
| 1076 | 2513878765 | |||
| 1077 | 2528853031 | |||
| 1078 | 2723846977 | |||
| 1079 | 2793084226 | |||
| 1080 | 2805921414 | |||
| 1081 | 2824613703 | |||
| 1082 | 2824664886 | |||
| 1083 | 2824672226 | |||
| 1084 | 2824682171 | |||
| 1085 | 2824688891 | |||
| 1086 | 2824697728 | |||
| 1087 | 2841947682 | |||
| 1088 | 2841947999 | |||
| 1089 | 2841973081 | |||
| 1090 | 2841978330 | |||
| 1091 | 2842040768 | |||
| 1092 | 2842042994 | |||
| 1093 | 2842046286 | |||
| 1094 | 2842051035 | |||
| 1095 | 2847947868 | |||
| 1096 | 2876811047 | |||
| 1097 | 2879109143 | |||
| 1098 | 2879114551 | |||
| 1099 | 2885370085 | |||
| 1100 | 2889038200 | |||
| 1101 | 2922375357 | |||
| 1102 | 2922391650 | |||
| 1103 | 2922396952 | |||
| 1104 | 2932811522 | |||
| 1105 | 2932819678 | |||
| 1106 | 2935618887 | |||
| 1107 | 2935643297 | |||
| 1108 | 2935669922 | |||
| 1109 | 2935676936 | |||
| 1110 | 2935692976 | |||
| 1111 | 2935695532 | |||
| 1112 | 2935719584 | |||
| 1113 | 2935729649 | |||
| 1114 | 2935739467 | |||
| 1115 | 2935748505 | |||
| 1116 | 2935756908 | |||
| 1117 | 2935761104 | |||
| 1118 | 2935807439 | |||
| 1119 | 2935812579 | |||
| 1120 | 2935832560 | |||
| 1121 | 2935839362 | |||
| 1122 | 2935857252 | |||
| 1123 | 2935864780 | |||
| 1124 | 2935876558 | |||
| 1125 | 2936039172 | |||
| 1126 | 2940562822 | |||
| 1127 | 2941540051 | |||
| 1128 | 3005511295 | |||
| 1129 | 8006927543 | |||
| 1130 | 8056679458 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ykz-assembly1.cif.gz_A | recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: restrained refinement | 0.424 | 66 | 175 |
| 4f7g-assembly1.cif.gz_B | crystal structure of talin autoinhibition complex | 0.4186 | 24 | 175 |
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.4096 | 14 | 259 |
| 4quv-assembly3.cif.gz_A | structure of an integral membrane delta(14)-sterol reductase | 0.4071 | 36 | 259 |
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.4071 | 14 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05883_47_239_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9795 | 66 | 256 | 1.20.120.1630 |
| af_O05883_47_239_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9646 | 66 | 256 | 1.20.120.1630 |
| af_Q6MG14_62_250_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8464 | 67 | 224 | 1.20.120.1630 |
| af_Q9VEG9_60_228_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8365 | 68 | 227 | 1.20.120.1630 |
| af_Q54JG5_70_234_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8248 | 67 | 226 | 1.20.120.1630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K8P644-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9888 | 18 | 259 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A7I7YX51-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9863 | 21 | 256 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A537T7R4-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9863 | 18 | 256 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A6M1T1B5-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9861 | 21 | 259 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A7C4VBS6-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9852 | 21 | 256 |
GO:0008168
GO:0016020 GO:0032259 |