F464265

General Info

Members Datasets Scaffolds Average Seq Length
565 182 565 424

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10013765|Ga0157377_100137653
Length 480
Sequence LNAAIGAAGTCARPDKVAASRRFIVETHSYEVSETMLGFGRGLLVSALGVVLAISSASAQLLPSLGGPAPTAPIADPLSQLPVAXXAVTNLLSEPGAAQAIQPTLDGTGLPAGLADLGAPSLLDLRRLRLREIIRQNPNTLDRDGNGQPVRRGVLLVLDPDPNSLRLAMQAGFRVIADTSGAELGMRSVELAVPSRTNVRDALKLLRKVAPLIQADFDHLFEPAGASLAPMSGAVAVSAGTGRGRIVGMIDGGVASHPSLANAAIEQHGFAGAARPTGHGTAVASLLVGRLGAFQGAATGAQLLVADVYGANPAAGSASQIVNALDWLAAKRAQVINISLAGPPNKLVQGAIRAVQARGIELVAAVGNDGPAAPPQYPASYPGVVAVTAVDARGRALPEAGRPIHLDFAAPGADMAAALPGQGYSRVRGTSFATPLVAARLLIAGSPQRLIAEARPGSGRVGRGVVCGGCRIDPRAVGVR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
152 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.07
Rhizosphere 95.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000347 3300001904 Bacteria 8686
2 JGI24740J21852_10009398 3300001979 Bacteria 3830
3 JGI24739J22299_10008279 3300001989 Bacteria 3880
4 JGI24735J21928_10007456 3300002067 Bacteria 3568
5 JGI24744J21845_10007541 3300002077 Bacteria 2248
6 Ga0070658_10001117 3300005327 Bacteria 22909
7 Ga0070658_10010526 3300005327 Bacteria 7412
8 Ga0070658_10014865 3300005327 Bacteria 6237
9 Ga0070658_10019153 3300005327 Bacteria 5483
10 Ga0070658_10024827 3300005327 Bacteria 4807
11 Ga0070658_10068950 3300005327 Bacteria 2892
12 Ga0070658_10110358 3300005327 Bacteria 2278
13 Ga0070676_10014066 3300005328 Bacteria 4391
14 Ga0070676_10035913 3300005328 Bacteria 2853
15 Ga0070676_10083884 3300005328 Bacteria 1939
16 Ga0070676_10117563 3300005328 Unclassified 1664
17 Ga0070683_100017549 3300005329 Bacteria 6327
18 Ga0070683_100048152 3300005329 Bacteria 3940
19 Ga0070690_100014404 3300005330 Bacteria 4692
20 Ga0070690_100053579 3300005330 Bacteria 2581
21 Ga0070670_100084361 3300005331 Bacteria 2729
22 Ga0070670_100097922 3300005331 Bacteria 2523
23 Ga0070670_100101494 3300005331 Unclassified 2477
24 Ga0070677_10003086 3300005333 Bacteria 5349
25 Ga0068869_100222893 3300005334 Bacteria 1495
26 Ga0070666_10050412 3300005335 Bacteria 2799
27 Ga0070680_100000197 3300005336 Bacteria 39326
28 Ga0070680_100005937 3300005336 Bacteria 9267
29 Ga0070680_100026216 3300005336 Bacteria 4661
30 Ga0070680_100045237 3300005336 Bacteria 3579
31 Ga0070680_100047805 3300005336 Unclassified 3485
32 Ga0070680_100049342 3300005336 Bacteria 3431
33 Ga0070682_100006247 3300005337 Bacteria 6682
34 Ga0068868_100000792 3300005338 Bacteria 21402
35 Ga0068868_100004343 3300005338 Bacteria 9938
36 Ga0068868_100039234 3300005338 Bacteria 3679
37 Ga0068868_100054967 3300005338 Bacteria 3140
38 Ga0070660_100004413 3300005339 Bacteria 9718
39 Ga0070660_100005433 3300005339 Bacteria 8826
40 Ga0070660_100037277 3300005339 Bacteria 3686
41 Ga0070660_100065997 3300005339 Bacteria 2817
42 Ga0070660_100081311 3300005339 Bacteria 2543
43 Ga0070691_10010016 3300005341 Bacteria 4318
44 Ga0070687_100081063 3300005343 Unclassified 1771
45 Ga0070661_100012334 3300005344 Bacteria 5979
46 Ga0070661_100026136 3300005344 Bacteria 4196
47 Ga0070661_100060375 3300005344 Bacteria 2783
48 Ga0070661_100076565 3300005344 Bacteria 2465
49 Ga0070661_100094670 3300005344 Bacteria 2214
50 Ga0070661_100108605 3300005344 Bacteria 2070
51 Ga0070692_10010806 3300005345 Bacteria 4173
52 Ga0070668_100061643 3300005347 Bacteria 2905
53 Ga0070669_100002167 3300005353 Bacteria 14197
54 Ga0070669_100010464 3300005353 Bacteria 6587
55 Ga0070669_100222274 3300005353 Bacteria 1493
56 Ga0070675_100008840 3300005354 Bacteria 7829
57 Ga0070675_100056025 3300005354 Bacteria 3247
58 Ga0070675_100069855 3300005354 Bacteria 2910
59 Ga0070671_100035482 3300005355 Bacteria 4131
60 Ga0070671_100060696 3300005355 Plasmid 3148
61 Ga0070671_100078706 3300005355 Bacteria 2755
62 Ga0070671_100171097 3300005355 Bacteria 1837
63 Ga0070674_100015214 3300005356 Bacteria 4800
64 Ga0070674_100043599 3300005356 Bacteria 3053
65 Ga0070674_100096777 3300005356 Bacteria 2143
66 Ga0070673_100000793 3300005364 Bacteria 17577
67 Ga0070673_100013681 3300005364 Bacteria 5624
68 Ga0070659_100014154 3300005366 Bacteria 5953
69 Ga0070659_100021394 3300005366 Bacteria 4925
70 Ga0070659_100027357 3300005366 Bacteria 4394
71 Ga0070659_100033630 3300005366 Bacteria 3983
72 Ga0070659_100043039 3300005366 Bacteria 3531
73 Ga0070659_100049074 3300005366 Bacteria 3318
74 Ga0070659_100086808 3300005366 Bacteria 2504
75 Ga0070659_100117013 3300005366 Unclassified 2155
76 Ga0070659_100286484 3300005366 Unclassified 1371
77 Ga0070667_100015694 3300005367 Bacteria 6262
78 Ga0070667_100021116 3300005367 Bacteria 5409
79 Ga0070714_100006015 3300005435 Bacteria 9318
80 Ga0070714_100161756 3300005435 Unclassified 2026
81 Ga0070714_100226927 3300005435 Bacteria 1719
82 Ga0070713_100033018 3300005436 Bacteria 4142
83 Ga0070663_100003383 3300005455 Bacteria 9209
84 Ga0070662_100010701 3300005457 Bacteria 6037
85 Ga0070662_100012230 3300005457 Bacteria 5684
86 Ga0070662_100036627 3300005457 Bacteria 3472
87 Ga0070662_100039557 3300005457 Bacteria 3354
88 Ga0070662_100054873 3300005457 Bacteria 2889
89 Ga0070662_100056790 3300005457 Bacteria 2842
90 Ga0070681_10093236 3300005458 Bacteria 2960
91 Ga0068867_100015377 3300005459 Bacteria 5427
92 Ga0070679_100034281 3300005530 Bacteria 5030
93 Ga0070679_100034374 3300005530 Bacteria 5024
94 Ga0070679_100037917 3300005530 Bacteria 4789
95 Ga0070679_100090490 3300005530 Bacteria 3048
96 Ga0070679_100115169 3300005530 Unclassified 2674
97 Ga0070679_100171517 3300005530 Bacteria 2142
98 Ga0070684_100012270 3300005535 Bacteria 6863
99 Ga0068853_100023544 3300005539 Bacteria 5157
100 Ga0068853_100065407 3300005539 Bacteria 3155
101 Ga0068853_100091770 3300005539 Bacteria 2671
102 Ga0068853_100096765 3300005539 Unclassified 2605
103 Ga0068853_100123431 3300005539 Bacteria 2313
104 Ga0070672_100002865 3300005543 Bacteria 11079
105 Ga0070672_100102076 3300005543 Unclassified 2328
106 Ga0070672_100200184 3300005543 Bacteria 1670
107 Ga0070696_100018776 3300005546 Bacteria 4678
108 Ga0070693_100027992 3300005547 Bacteria 3060
109 Ga0068855_100010898 3300005563 Bacteria 10973
110 Ga0068855_100084543 3300005563 Bacteria 3673
111 Ga0068855_100093764 3300005563 Bacteria 3462
112 Ga0068855_100107079 3300005563 Bacteria 3212
113 Ga0070664_100006623 3300005564 Bacteria 9342
114 Ga0070664_100015327 3300005564 Bacteria 6268
115 Ga0070664_100044908 3300005564 Bacteria 3731
116 Ga0070664_100045863 3300005564 Bacteria 3691
117 Ga0070664_100046358 3300005564 Bacteria 3671
118 Ga0070664_100067816 3300005564 Bacteria 3049
119 Ga0070664_100169875 3300005564 Bacteria 1934
120 Ga0068857_100025569 3300005577 Bacteria 5198
121 Ga0068854_100001320 3300005578 Bacteria 14976
122 Ga0068854_100004723 3300005578 Bacteria 8586
123 Ga0068856_100009025 3300005614 Bacteria 9701
124 Ga0068856_100040797 3300005614 Unclassified 4560
125 Ga0068856_100055783 3300005614 Bacteria 3899
126 Ga0068856_100110139 3300005614 Bacteria 2750
127 Ga0068856_100119701 3300005614 Bacteria 2634
128 Ga0068856_100162884 3300005614 Bacteria 2242
129 Ga0068856_100196516 3300005614 Unclassified 2031
130 Ga0068852_100000433 3300005616 Bacteria 27783
131 Ga0068852_100004740 3300005616 Bacteria 9653
132 Ga0068852_100022509 3300005616 Bacteria 5055
133 Ga0068852_100029166 3300005616 Bacteria 4528
134 Ga0068852_100030974 3300005616 Bacteria 4409
135 Ga0068852_100091170 3300005616 Bacteria 2727
136 Ga0068852_100121267 3300005616 Bacteria 2394
137 Ga0068859_100040235 3300005617 Bacteria 4692
138 Ga0068859_100054051 3300005617 Bacteria 4039
139 Ga0068859_100056179 3300005617 Bacteria 3961
140 Ga0068859_100062393 3300005617 Bacteria 3757
141 Ga0068864_100007063 3300005618 Bacteria 9218
142 Ga0068864_100019593 3300005618 Bacteria 5659
143 Ga0068864_100021302 3300005618 Bacteria 5431
144 Ga0068864_100031398 3300005618 Bacteria 4507
145 Ga0068864_100066856 3300005618 Bacteria 3121
146 Ga0068851_10016667 3300005834 Bacteria 3520
147 Ga0068851_10026145 3300005834 Bacteria 2866
148 Ga0068851_10056093 3300005834 Bacteria 2009
149 Ga0068863_100001264 3300005841 Bacteria 25207
150 Ga0068863_100006869 3300005841 Bacteria 11153
151 Ga0068863_100104560 3300005841 Bacteria 2694
152 Ga0068858_100001147 3300005842 Bacteria 27422
153 Ga0068858_100005425 3300005842 Bacteria 12494
154 Ga0068862_100002977 3300005844 Bacteria 14796
155 Ga0068862_100038601 3300005844 Bacteria 4051
156 Ga0068862_100101845 3300005844 Bacteria 2513
157 Ga0081539_10025333 3300005985 Bacteria 3824
158 Ga0068865_100022065 3300006881 Bacteria 4146
159 Ga0068865_100026058 3300006881 Bacteria 3851
160 Ga0068865_100067537 3300006881 Bacteria 2526
161 Ga0097620_100040239 3300006931 Bacteria 4692
162 Ga0097620_100054051 3300006931 Bacteria 4039
163 Ga0097620_100056178 3300006931 Bacteria 3961
164 Ga0097620_100062384 3300006931 Bacteria 3757
165 Ga0105240_10008382 3300009093 Bacteria 14794
166 Ga0105240_10081161 3300009093 Bacteria 3986
167 Ga0105240_10104782 3300009093 Bacteria 3434
168 Ga0105240_10291990 3300009093 Bacteria 1868
169 Ga0105245_10047670 3300009098 Bacteria 3830
170 Ga0105245_10192216 3300009098 Bacteria 1956
171 Ga0105247_10011543 3300009101 Bacteria 5320
172 Ga0105241_10065447 3300009174 Bacteria 2809
173 Ga0105248_10000308 3300009177 Bacteria 58132
174 Ga0105248_10002368 3300009177 Bacteria 20929
175 Ga0105248_10036329 3300009177 Bacteria 5509
176 Ga0105248_10061888 3300009177 Bacteria 4203
177 Ga0105248_10089423 3300009177 Bacteria 3466
178 Ga0105248_10153817 3300009177 Unclassified 2595
179 Ga0105238_10020295 3300009551 Bacteria 6766
180 Ga0105238_10046711 3300009551 Bacteria 4367
181 Ga0105249_10176060 3300009553 Bacteria 2078
182 Ga0105239_10163816 3300010375 Bacteria 2486
183 Ga0105246_10069222 3300011119 Unclassified 2478
184 Ga0157373_10012180 3300013100 Bacteria 6322
185 Ga0157373_10039867 3300013100 Bacteria 3361
186 Ga0157373_10130635 3300013100 Bacteria 1766
187 Ga0157371_10003353 3300013102 Bacteria 14588
188 Ga0157371_10023246 3300013102 Bacteria 4532
189 Ga0157370_10046492 3300013104 Bacteria 4161
190 Ga0157370_10082118 3300013104 Bacteria 3032
191 Ga0157370_10088516 3300013104 Bacteria 2908
192 Ga0157369_10000407 3300013105 Bacteria 57129
193 Ga0157369_10028264 3300013105 Bacteria 6208
194 Ga0157369_10060403 3300013105 Bacteria 4088
195 Ga0157369_10099810 3300013105 Bacteria 3094
196 Ga0157369_10217548 3300013105 Unclassified 2000
197 Ga0157374_10016292 3300013296 Bacteria 6529
198 Ga0157378_10046578 3300013297 Bacteria 3854
199 Ga0157378_10108682 3300013297 Bacteria 2540
200 Ga0163162_10044360 3300013306 Unclassified 4453
201 Ga0163162_10051321 3300013306 Bacteria 4138
202 Ga0157372_10074204 3300013307 Bacteria 3835
203 Ga0157372_10098752 3300013307 Bacteria 3331
204 Ga0157372_10103614 3300013307 Bacteria 3251
205 Ga0157372_10123098 3300013307 Bacteria 2981
206 Ga0157375_10123217 3300013308 Bacteria 2704
207 Ga0163163_10000139 3300014325 Bacteria 75197
208 Ga0163163_10069531 3300014325 Bacteria 3505
209 Ga0157380_10019469 3300014326 Bacteria 5058
210 Ga0182008_10022417 3300014497 Bacteria 3234
211 Ga0157377_10013765 3300014745 Bacteria 4100
212 Ga0157379_10017387 3300014968 Bacteria 6336
213 Ga0157379_10046223 3300014968 Bacteria 3885
214 Ga0206354_11075063 3300020081 Bacteria 2587
215 Ga0206354_11338315 3300020081 Bacteria 3793
216 Ga0207697_10000921 3300025315 Bacteria 16594
217 Ga0207697_10016117 3300025315 Bacteria 3082
218 Ga0207656_10016448 3300025321 Bacteria 2880
219 Ga0207656_10045770 3300025321 Bacteria 1874
220 Ga0207682_10005735 3300025893 Bacteria 5037
221 Ga0207682_10007913 3300025893 Bacteria 4219
222 Ga0207710_10006603 3300025900 Bacteria 4946
223 Ga0207688_10001651 3300025901 Bacteria 11793
224 Ga0207688_10046166 3300025901 Bacteria 2431
225 Ga0207680_10002648 3300025903 Bacteria 8368
226 Ga0207647_10000107 3300025904 Bacteria 63716
227 Ga0207647_10017762 3300025904 Bacteria 4828
228 Ga0207647_10018427 3300025904 Plasmid 4721
229 Ga0207647_10026668 3300025904 Bacteria 3777
230 Ga0207647_10042929 3300025904 Unclassified 2833
231 Ga0207699_10049831 3300025906 Bacteria 2466
232 Ga0207645_10010181 3300025907 Bacteria 6463
233 Ga0207645_10078379 3300025907 Bacteria 2117
234 Ga0207645_10123169 3300025907 Bacteria 1684
235 Ga0207705_10000033 3300025909 Bacteria 223997
236 Ga0207705_10000701 3300025909 Bacteria 27662
237 Ga0207705_10006617 3300025909 Bacteria 8576
238 Ga0207705_10010979 3300025909 Bacteria 6577
239 Ga0207705_10012309 3300025909 Bacteria 6180
240 Ga0207705_10014531 3300025909 Bacteria 5664
241 Ga0207705_10017137 3300025909 Bacteria 5190
242 Ga0207705_10018898 3300025909 Bacteria 4927
243 Ga0207705_10022551 3300025909 Bacteria 4490
244 Ga0207705_10097186 3300025909 Bacteria 2162
245 Ga0207705_10100399 3300025909 Bacteria 2128
246 Ga0207707_10181718 3300025912 Unclassified 1836
247 Ga0207695_10016905 3300025913 Bacteria 8513
248 Ga0207695_10077216 3300025913 Bacteria 3384
249 Ga0207660_10034269 3300025917 Bacteria 3518
250 Ga0207660_10037204 3300025917 Bacteria 3389
251 Ga0207660_10041997 3300025917 Unclassified 3208
252 Ga0207660_10043271 3300025917 Bacteria 3164
253 Ga0207657_10000267 3300025919 Bacteria 55426
254 Ga0207657_10003866 3300025919 Bacteria 15899
255 Ga0207657_10006028 3300025919 Bacteria 12603
256 Ga0207657_10006922 3300025919 Bacteria 11688
257 Ga0207657_10008727 3300025919 Bacteria 10258
258 Ga0207657_10008934 3300025919 Bacteria 10125
259 Ga0207657_10022450 3300025919 Bacteria 5901
260 Ga0207657_10022951 3300025919 Bacteria 5822
261 Ga0207657_10031157 3300025919 Bacteria 4834
262 Ga0207657_10051394 3300025919 Bacteria 3582
263 Ga0207657_10052607 3300025919 Bacteria 3533
264 Ga0207657_10065195 3300025919 Bacteria 3106
265 Ga0207657_10126809 3300025919 Bacteria 2096
266 Ga0207657_10157530 3300025919 Unclassified 1846
267 Ga0207649_10000827 3300025920 Bacteria 19901
268 Ga0207649_10028197 3300025920 Bacteria 3304
269 Ga0207649_10030244 3300025920 Bacteria 3206
270 Ga0207649_10111240 3300025920 Bacteria 1830
271 Ga0207649_10137145 3300025920 Unclassified 1669
272 Ga0207652_10021765 3300025921 Bacteria 5295
273 Ga0207652_10024259 3300025921 Bacteria 5030
274 Ga0207652_10074466 3300025921 Unclassified 2956
275 Ga0207652_10087414 3300025921 Unclassified 2733
276 Ga0207652_10149888 3300025921 Bacteria 2088
277 Ga0207681_10040931 3300025923 Bacteria 3086
278 Ga0207681_10066678 3300025923 Bacteria 2492
279 Ga0207694_10013944 3300025924 Bacteria 6060
280 Ga0207694_10064740 3300025924 Bacteria 2849
281 Ga0207650_10069830 3300025925 Bacteria 2639
282 Ga0207650_10075679 3300025925 Bacteria 2541
283 Ga0207650_10077484 3300025925 Plasmid 2513
284 Ga0207659_10016216 3300025926 Bacteria 4844
285 Ga0207687_10046913 3300025927 Bacteria 2993
286 Ga0207700_10040884 3300025928 Bacteria 3387
287 Ga0207700_10041419 3300025928 Bacteria 3369
288 Ga0207664_10163897 3300025929 Unclassified 1898
289 Ga0207644_10024557 3300025931 Bacteria 4139
290 Ga0207644_10048509 3300025931 Bacteria 3036
291 Ga0207644_10052840 3300025931 Bacteria 2921
292 Ga0207644_10055692 3300025931 Bacteria 2851
293 Ga0207644_10135454 3300025931 Bacteria 1890
294 Ga0207690_10012174 3300025932 Bacteria 5148
295 Ga0207690_10017923 3300025932 Bacteria 4334
296 Ga0207690_10026477 3300025932 Bacteria 3651
297 Ga0207690_10069033 3300025932 Bacteria 2430
298 Ga0207690_10127876 3300025932 Bacteria 1855
299 Ga0207706_10002331 3300025933 Bacteria 18539
300 Ga0207706_10018600 3300025933 Bacteria 6251
301 Ga0207706_10026353 3300025933 Bacteria 5204
302 Ga0207706_10035896 3300025933 Bacteria 4405
303 Ga0207706_10058344 3300025933 Bacteria 3399
304 Ga0207706_10074822 3300025933 Bacteria 2978
305 Ga0207706_10191416 3300025933 Unclassified 1795
306 Ga0207706_10193325 3300025933 Bacteria 1785
307 Ga0207706_10195253 3300025933 Unclassified 1776
308 Ga0207704_10078003 3300025938 Bacteria 2129
309 Ga0207665_10033570 3300025939 Bacteria 3403
310 Ga0207691_10019892 3300025940 Bacteria 6351
311 Ga0207711_10000673 3300025941 Bacteria 33946
312 Ga0207711_10000760 3300025941 Bacteria 31645
313 Ga0207711_10019474 3300025941 Bacteria 5649
314 Ga0207711_10056388 3300025941 Bacteria 3376
315 Ga0207711_10207349 3300025941 Bacteria 1790
316 Ga0207689_10002883 3300025942 Bacteria 15860
317 Ga0207689_10153919 3300025942 Bacteria 1895
318 Ga0207661_10020834 3300025944 Bacteria 4907
319 Ga0207661_10030713 3300025944 Bacteria 4141
320 Ga0207679_10036492 3300025945 Bacteria 3487
321 Ga0207679_10065625 3300025945 Bacteria 2717
322 Ga0207679_10094966 3300025945 Bacteria 2316
323 Ga0207667_10002247 3300025949 Bacteria 24260
324 Ga0207667_10021357 3300025949 Bacteria 7174
325 Ga0207667_10058244 3300025949 Bacteria 4053
326 Ga0207667_10065091 3300025949 Bacteria 3803
327 Ga0207667_10072029 3300025949 Bacteria 3592
328 Ga0207651_10000620 3300025960 Bacteria 14946
329 Ga0207651_10005055 3300025960 Bacteria 6728
330 Ga0207651_10008766 3300025960 Bacteria 5487
331 Ga0207651_10072693 3300025960 Bacteria 2442
332 Ga0207712_10043314 3300025961 Bacteria 3104
333 Ga0207640_10001486 3300025981 Bacteria 12645
334 Ga0207640_10013244 3300025981 Bacteria 4722
335 Ga0207640_10031371 3300025981 Bacteria 3283
336 Ga0207677_10010374 3300026023 Bacteria 5268
337 Ga0207677_10049942 3300026023 Bacteria 2826
338 Ga0207703_10003144 3300026035 Bacteria 13928
339 Ga0207639_10029316 3300026041 Bacteria 4027
340 Ga0207639_10055632 3300026041 Bacteria 3029
341 Ga0207678_10015193 3300026067 Bacteria 6772
342 Ga0207678_10020762 3300026067 Bacteria 5758
343 Ga0207678_10042942 3300026067 Bacteria 3914
344 Ga0207678_10083845 3300026067 Bacteria 2726
345 Ga0207678_10087195 3300026067 Unclassified 2667
346 Ga0207702_10021213 3300026078 Bacteria 5376
347 Ga0207702_10070816 3300026078 Bacteria 3000
348 Ga0207702_10111801 3300026078 Unclassified 2430
349 Ga0207641_10006496 3300026088 Bacteria 9846
350 Ga0207641_10016806 3300026088 Bacteria 5992
351 Ga0207641_10098225 3300026088 Bacteria 2574
352 Ga0207641_10135998 3300026088 Bacteria 2212
353 Ga0207648_10002604 3300026089 Bacteria 19339
354 Ga0207648_10009898 3300026089 Bacteria 9087
355 Ga0207648_10178526 3300026089 Bacteria 1879
356 Ga0207676_10001441 3300026095 Bacteria 17694
357 Ga0207676_10014881 3300026095 Bacteria 5604
358 Ga0207676_10072836 3300026095 Bacteria 2763
359 Ga0207676_10112001 3300026095 Unclassified 2285
360 Ga0207676_10197730 3300026095 Bacteria 1774
361 Ga0207674_10000859 3300026116 Bacteria 39717
362 Ga0207674_10036692 3300026116 Bacteria 5103
363 Ga0207674_10041064 3300026116 Bacteria 4786
364 Ga0207674_10047460 3300026116 Bacteria 4402
365 Ga0207674_10096286 3300026116 Bacteria 2945
366 Ga0207674_10125737 3300026116 Bacteria 2530
367 Ga0207675_100084712 3300026118 Bacteria 2974
368 Ga0207683_10026311 3300026121 Bacteria 5022
369 Ga0207698_10000421 3300026142 Bacteria 24394
370 Ga0207698_10009497 3300026142 Bacteria 6205
371 Ga0207698_10012429 3300026142 Bacteria 5570
372 Ga0207698_10100696 3300026142 Bacteria 2394
373 Ga0268265_10003983 3300028380 Bacteria 10402
374 Ga0268265_10055794 3300028380 Bacteria 3003
375 Ga0268264_10020235 3300028381 Bacteria 5439
376 Ga0307408_100065568 3300031548 Plasmid 2663
377 Ga0307405_10015739 3300031731 Bacteria 4104
378 Ga0307405_10026804 3300031731 Bacteria 3331
379 Ga0307413_10000460 3300031824 Bacteria 13289
380 Ga0307413_10157173 3300031824 Unclassified 1592
381 Ga0307410_10001814 3300031852 Bacteria 9908
382 Ga0307410_10018102 3300031852 Bacteria 4249
383 Ga0307410_10038018 3300031852 Bacteria 3149
384 Ga0307410_10059823 3300031852 Bacteria 2601
385 Ga0307410_10066095 3300031852 Bacteria 2489
386 Ga0307410_10093363 3300031852 Bacteria 2141
387 Ga0307410_10193418 3300031852 Bacteria 1548
388 Ga0307406_10033398 3300031901 Unclassified 3149
389 Ga0307406_10098781 3300031901 Bacteria 1983
390 Ga0307407_10002214 3300031903 Bacteria 7506
391 Ga0307407_10002575 3300031903 Bacteria 7144
392 Ga0307407_10007374 3300031903 Bacteria 4976
393 Ga0307407_10008755 3300031903 Bacteria 4667
394 Ga0307407_10096889 3300031903 Bacteria 1822
395 Ga0307412_10009923 3300031911 Bacteria 5477
396 Ga0307412_10012790 3300031911 Bacteria 4899
397 Ga0307412_10037135 3300031911 Bacteria 3127
398 Ga0307412_10048459 3300031911 Bacteria 2794
399 Ga0307412_10062626 3300031911 Bacteria 2506
400 Ga0307412_10117466 3300031911 Bacteria 1910
401 Ga0307409_100001956 3300031995 Bacteria 10535
402 Ga0307409_100005191 3300031995 Bacteria 7451
403 Ga0307409_100018547 3300031995 Bacteria 4682
404 Ga0307409_100023817 3300031995 Bacteria 4252
405 Ga0307409_100043043 3300031995 Plasmid 3386
406 Ga0307409_100129384 3300031995 Bacteria 2154
407 Ga0307409_100252989 3300031995 Bacteria 1612
408 Ga0307416_100007788 3300032002 Bacteria 6848
409 Ga0307416_100065282 3300032002 Bacteria 2990
410 Ga0307416_100070990 3300032002 Plasmid 2890
411 Ga0307416_100097290 3300032002 Bacteria 2548
412 Ga0307416_100299035 3300032002 Unclassified 1598
413 Ga0307414_10002382 3300032004 Bacteria 9831
414 Ga0307414_10005096 3300032004 Bacteria 7204
415 Ga0307414_10166348 3300032004 Bacteria 1758
416 Ga0307411_10003034 3300032005 Bacteria 7662
417 Ga0307411_10003049 3300032005 Bacteria 7653
418 Ga0307411_10009800 3300032005 Bacteria 5064
419 Ga0307411_10023834 3300032005 Bacteria 3635
420 Ga0307411_10060227 3300032005 Bacteria 2520
421 Ga0307411_10061724 3300032005 Bacteria 2496
422 Ga0307411_10110669 3300032005 Bacteria 1964
423 Ga0307415_100000189 3300032126 Bacteria 27332
424 Ga0307415_100008878 3300032126 Bacteria 5599
425 Ga0307415_100020086 3300032126 Bacteria 4071
426 Ga0307415_100029854 3300032126 Bacteria 3490
427 Ga0395899_0003009 3300037312 Bacteria 13459
428 Ga0395899_0006461 3300037312 Bacteria 9081
429 Ga0395899_0019846 3300037312 Bacteria 5100
430 Ga0395899_0022606 3300037312 Bacteria 4764
431 Ga0395899_0032669 3300037312 Bacteria 3911
432 Ga0395899_0034932 3300037312 Bacteria 3774
433 Ga0395899_0038230 3300037312 Bacteria 3595
434 Ga0395899_0057013 3300037312 Bacteria 2885
435 Ga0395899_0078093 3300037312 Bacteria 2413
436 Ga0395899_0123602 3300037312 Bacteria 1852
437 Ga0395899_0174450 3300037312 Unclassified 1512
438 Ga0395900_0000294 3300037418 Bacteria 75260
439 Ga0395900_0000447 3300037418 Bacteria 59069
440 Ga0395900_0001367 3300037418 Bacteria 29340
441 Ga0395900_0017609 3300037418 Bacteria 7291
442 Ga0395900_0019740 3300037418 Bacteria 6869
443 Ga0395900_0064132 3300037418 Bacteria 3776
444 Ga0395900_0076828 3300037418 Unclassified 3432
445 Ga0395900_0076975 3300037418 Bacteria 3427
446 Ga0395900_0101616 3300037418 Bacteria 2953
447 Ga0395900_0106111 3300037418 Bacteria 2885
448 Ga0395900_0152455 3300037418 Bacteria 2361
449 Ga0395900_0179681 3300037418 Bacteria 2151
450 Ga0395900_0189075 3300037418 Bacteria 2089
451 Ga0395900_0281451 3300037418 Unclassified 1655
452 Ga0395898_0001857 3300037466 Bacteria 27083
453 Ga0395898_0009865 3300037466 Bacteria 10010
454 Ga0395898_0010289 3300037466 Bacteria 9790
455 Ga0395898_0030645 3300037466 Bacteria 5381
456 Ga0395898_0030773 3300037466 Bacteria 5369
457 Ga0395898_0040930 3300037466 Bacteria 4579
458 Ga0395898_0047082 3300037466 Bacteria 4233
459 Ga0395898_0048970 3300037466 Bacteria 4142
460 Ga0395898_0050902 3300037466 Bacteria 4052
461 Ga0395898_0053892 3300037466 Bacteria 3926
462 Ga0395898_0061291 3300037466 Bacteria 3654
463 Ga0395898_0103456 3300037466 Bacteria 2732
464 Ga0395898_0137629 3300037466 Unclassified 2338
465 Ga0395898_0295864 3300037466 Bacteria 1544
466 Ga0395905_0000066 3300037471 Bacteria 183121
467 Ga0395905_0000187 3300037471 Bacteria 98895
468 Ga0395905_0000215 3300037471 Bacteria 89274
469 Ga0395905_0001138 3300037471 Bacteria 33269
470 Ga0395905_0005031 3300037471 Bacteria 13615
471 Ga0395905_0009384 3300037471 Bacteria 9569
472 Ga0395905_0010773 3300037471 Bacteria 8860
473 Ga0395905_0015781 3300037471 Bacteria 7175
474 Ga0395905_0016465 3300037471 Bacteria 7028
475 Ga0395905_0018831 3300037471 Bacteria 6549
476 Ga0395905_0023962 3300037471 Bacteria 5763
477 Ga0395905_0024923 3300037471 Bacteria 5644
478 Ga0395905_0033644 3300037471 Bacteria 4813
479 Ga0395905_0052176 3300037471 Bacteria 3829
480 Ga0395905_0056316 3300037471 Bacteria 3678
481 Ga0395905_0078909 3300037471 Bacteria 3085
482 Ga0395905_0082259 3300037471 Bacteria 3017
483 Ga0395905_0095690 3300037471 Bacteria 2787
484 Ga0395905_0099491 3300037471 Bacteria 2731
485 Ga0395905_0103537 3300037471 Bacteria 2672
486 Ga0395905_0104515 3300037471 Bacteria 2659
487 Ga0395905_0112975 3300037471 Bacteria 2552
488 Ga0395905_0131039 3300037471 Bacteria 2358
489 Ga0395905_0144543 3300037471 Unclassified 2238
490 Ga0395905_0247919 3300037471 Unclassified 1664
491 Ga0395905_0249514 3300037471 Bacteria 1658
492 Ga0395901_0000324 3300038443 Bacteria 59134
493 Ga0395901_0002914 3300038443 Bacteria 17271
494 Ga0395901_0016739 3300038443 Bacteria 7470
495 Ga0395901_0022456 3300038443 Bacteria 6467
496 Ga0395901_0029385 3300038443 Bacteria 5659
497 Ga0395901_0029627 3300038443 Bacteria 5636
498 Ga0395901_0038534 3300038443 Bacteria 4945
499 Ga0395901_0042195 3300038443 Bacteria 4729
500 Ga0395901_0062124 3300038443 Bacteria 3887
501 Ga0395901_0066394 3300038443 Bacteria 3757
502 Ga0395901_0078975 3300038443 Plasmid 3436
503 Ga0395901_0112607 3300038443 Bacteria 2857
504 Ga0395901_0121605 3300038443 Bacteria 2743
505 Ga0395901_0212443 3300038443 Bacteria 2024
506 Ga0395901_0237783 3300038443 Unclassified 1900
507 Ga0395901_0385680 3300038443 Bacteria 1441
508 Ga0439448_0005536 3300042005 Bacteria 3603
509 Ga0439432_020548 3300042006 Bacteria 2194
510 Ga0439432_030908 3300042006 Unclassified 1734
511 Ga0450890_000758 3300042127 Bacteria 4674
512 Ga0450889_000506 3300042144 Bacteria 4344
513 Ga0466966_0001810 3300044684 Bacteria 13866
514 Ga0466966_0016216 3300044684 Plasmid 4926
515 Ga0466966_0030884 3300044684 Bacteria 3475
516 Ga0466961_0081680 3300044693 Bacteria 2045
517 Ga0466961_0105259 3300044693 Bacteria 1776
518 Ga0466963_0007958 3300044694 Bacteria 6346
519 Ga0466963_0016100 3300044694 Bacteria 4644
520 Ga0466963_0102133 3300044694 Bacteria 1964
521 Ga0466971_0025166 3300044719 Bacteria 2658
522 Ga0466970_0016480 3300044765 Bacteria 3812
523 Ga0466970_0044254 3300044765 Bacteria 2370
524 Ga0466959_0021449 3300045049 Plasmid 4764
525 Ga0466959_0041289 3300045049 Bacteria 3405
526 Ga0466958_0052570 3300045836 Bacteria 2470
527 Ga0466958_0058600 3300045836 Bacteria 2341
528 Ga0466967_0070831 3300045976 Bacteria 3120
529 Ga0466967_0147745 3300045976 Bacteria 2194
530 Ga0466967_0155413 3300045976 Bacteria 2142
531 Ga0495585_0014323 3300046492 Bacteria 4622
532 Ga0495663_0000545 3300046525 Bacteria 13290
533 Ga0495598_0000255 3300046537 Bacteria 9580
534 Ga0495621_0000513 3300046539 Bacteria 9601
535 Ga0495633_0002280 3300046558 Bacteria 13720
536 Ga0495669_0001278 3300046684 Bacteria 10427
537 Ga0495669_0018484 3300046684 Bacteria 2997
538 Ga0495670_0002513 3300046691 Bacteria 9060
539 Ga0495677_0002975 3300047445 Bacteria 6593
540 Ga0496101_0064742 3300048904 Bacteria 2664
541 Ga0496103_0024689 3300048906 Bacteria 3627
542 Ga0496104_0076909 3300048907 Bacteria 3179
543 Ga0496106_0052564 3300048909 Bacteria 3074
544 Ga0496106_0113895 3300048909 Bacteria 2109
545 Ga0496107_0060103 3300048910 Bacteria 2750
546 Ga0496107_0090475 3300048910 Unclassified 2236
547 Ga0496108_0019090 3300048911 Bacteria 5625
548 Ga0496108_0019846 3300048911 Bacteria 5521
549 Ga0496108_0129591 3300048911 Bacteria 2168
550 Ga0496109_0030214 3300048912 Bacteria 4857
551 Ga0496109_0078529 3300048912 Bacteria 3040
552 Ga0496109_0106609 3300048912 Bacteria 2603
553 Ga0496110_0014792 3300048913 Bacteria 6484
554 Ga0496110_0026694 3300048913 Bacteria 4945
555 Ga0496111_0049519 3300048914 Bacteria 3029
556 Ga0496112_0020378 3300048915 Bacteria 6285
557 Ga0496112_0067956 3300048915 Bacteria 3518
558 Ga0496112_0068242 3300048915 Bacteria 3511
559 Ga0496112_0079645 3300048915 Plasmid 3240
560 Ga0496113_0063519 3300048916 Bacteria 2790
561 Ga0496113_0089046 3300048916 Bacteria 2375
562 Ga0496114_0000029 3300048917 Bacteria 175132
563 Ga0501067_0016871 3300049583 Bacteria 4034
564 Ga0466962_0016743 3300061719 Bacteria 3533
565 Ga0466962_0074077 3300061719 Bacteria 1627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0076975 Ga0395900_0076975_2219_3406 345
2 3300005366 Ga0070659_100086808 Ga0070659_1000868082 359
3 3300037418 Ga0395900_0152455 Ga0395900_0152455_27_1106 359
4 3300005844 Ga0068862_100101845 Ga0068862_1001018452 360
5 3300028380 Ga0268265_10055794 Ga0268265_100557942 360
6 3300005336 Ga0070680_100045237 Ga0070680_1000452373 361
7 3300005366 Ga0070659_100117013 Ga0070659_1001170132 361
8 3300005457 Ga0070662_100039557 Ga0070662_1000395572 361
9 3300005539 Ga0068853_100123431 Ga0068853_1001234312 361
10 3300005546 Ga0070696_100018776 Ga0070696_1000187763 361
11 3300005547 Ga0070693_100027992 Ga0070693_1000279923 361
12 3300025933 Ga0207706_10058344 Ga0207706_100583443 361
13 3300037471 Ga0395905_0249514 Ga0395905_0249514_513_1640 361
14 3300042127 Ga0450890_000758 Ga0450890_000758_891_2228 361
15 3300042144 Ga0450889_000506 Ga0450889_000506_1370_2707 361
16 3300005339 Ga0070660_100005433 Ga0070660_1000054337 363
17 3300005457 Ga0070662_100010701 Ga0070662_1000107013 363
18 3300025919 Ga0207657_10022951 Ga0207657_100229514 363
19 3300025932 Ga0207690_10012174 Ga0207690_100121746 363
20 3300025933 Ga0207706_10035896 Ga0207706_100358963 363
21 3300037466 Ga0395898_0030645 Ga0395898_0030645_922_2256 363
22 3300037471 Ga0395905_0015781 Ga0395905_0015781_3018_4352 363
23 3300005327 Ga0070658_10014865 Ga0070658_100148654 366
24 3300005344 Ga0070661_100060375 Ga0070661_1000603752 366
25 3300005564 Ga0070664_100006623 Ga0070664_1000066236 366
26 3300025909 Ga0207705_10014531 Ga0207705_100145313 366
27 3300025920 Ga0207649_10030244 Ga0207649_100302445 366
28 3300026067 Ga0207678_10083845 Ga0207678_100838452 366
29 3300037312 Ga0395899_0123602 Ga0395899_0123602_405_1751 366
30 3300005338 Ga0068868_100039234 Ga0068868_1000392341 368
31 3300026023 Ga0207677_10010374 Ga0207677_100103745 368
32 3300048915 Ga0496112_0079645 Ga0496112_0079645_1709_3046 368
33 3300005435 Ga0070714_100006015 Ga0070714_1000060153 369
34 3300025906 Ga0207699_10049831 Ga0207699_100498312 369
35 3300025928 Ga0207700_10041419 Ga0207700_100414194 369
36 3300025939 Ga0207665_10033570 Ga0207665_100335703 369
37 3300005331 Ga0070670_100097922 Ga0070670_1000979222 371
38 3300005354 Ga0070675_100008840 Ga0070675_1000088404 371
39 3300005564 Ga0070664_100046358 Ga0070664_1000463582 371
40 3300025315 Ga0207697_10016117 Ga0207697_100161174 371
41 3300025901 Ga0207688_10046166 Ga0207688_100461662 371
42 3300025925 Ga0207650_10075679 Ga0207650_100756793 371
43 3300025942 Ga0207689_10153919 Ga0207689_101539191 371
44 3300026095 Ga0207676_10197730 Ga0207676_101977302 371
45 3300048915 Ga0496112_0068242 Ga0496112_0068242_1002_2354 371
46 3300013105 Ga0157369_10028264 Ga0157369_100282646 372
47 3300037418 Ga0395900_0076828 Ga0395900_0076828_1425_2822 372
48 3300037471 Ga0395905_0000187 Ga0395905_0000187_53392_54741 373
49 3300009177 Ga0105248_10036329 Ga0105248_100363293 375
50 3300013308 Ga0157375_10123217 Ga0157375_101232172 375
51 3300037466 Ga0395898_0295864 Ga0395898_0295864_144_1349 375
52 3300037471 Ga0395905_0078909 Ga0395905_0078909_146_1351 375
53 3300044684 Ga0466966_0016216 Ga0466966_0016216_1881_3212 378
54 3300044693 Ga0466961_0081680 Ga0466961_0081680_449_1780 378
55 3300045049 Ga0466959_0021449 Ga0466959_0021449_2299_3630 378
56 3300025904 Ga0207647_10018427 Ga0207647_100184274 380
57 3300025920 Ga0207649_10137145 Ga0207649_101371452 380
58 3300037312 Ga0395899_0174450 Ga0395899_0174450_54_1244 380
59 3300037466 Ga0395898_0050902 Ga0395898_0050902_1173_2363 380
60 3300038443 Ga0395901_0062124 Ga0395901_0062124_563_1753 380
61 3300038443 Ga0395901_0121605 Ga0395901_0121605_184_1374 380
62 3300044684 Ga0466966_0001810 Ga0466966_0001810_10078_11421 380
63 3300005355 Ga0070671_100060696 Ga0070671_1000606962 381
64 3300005844 Ga0068862_100038601 Ga0068862_1000386012 381
65 3300025941 Ga0207711_10207349 Ga0207711_102073492 381
66 3300026089 Ga0207648_10178526 Ga0207648_101785262 381
67 3300026095 Ga0207676_10014881 Ga0207676_100148811 381
68 3300037471 Ga0395905_0082259 Ga0395905_0082259_140_1477 381
69 3300038443 Ga0395901_0066394 Ga0395901_0066394_658_1995 381
70 3300042006 Ga0439432_020548 Ga0439432_020548_138_1475 381
71 3300044765 Ga0466970_0016480 Ga0466970_0016480_848_2134 381
72 3300044765 Ga0466970_0044254 Ga0466970_0044254_40_1377 381
73 3300045836 Ga0466958_0058600 Ga0466958_0058600_943_2280 381
74 3300045976 Ga0466967_0155413 Ga0466967_0155413_683_2020 381
75 3300048909 Ga0496106_0113895 Ga0496106_0113895_56_1393 381
76 3300006881 Ga0068865_100067537 Ga0068865_1000675373 382
77 3300026118 Ga0207675_100084712 Ga0207675_1000847122 382
78 3300037471 Ga0395905_0016465 Ga0395905_0016465_3704_5038 382
79 3300037471 Ga0395905_0131039 Ga0395905_0131039_294_1583 383
80 3300038443 Ga0395901_0078975 Ga0395901_0078975_1140_2483 383
81 3300005355 Ga0070671_100078706 Ga0070671_1000787062 384
82 3300013105 Ga0157369_10000407 Ga0157369_1000040733 384
83 3300026116 Ga0207674_10047460 Ga0207674_100474603 384
84 3300037312 Ga0395899_0019846 Ga0395899_0019846_2533_3876 384
85 3300037418 Ga0395900_0189075 Ga0395900_0189075_786_2021 384
86 3300037466 Ga0395898_0040930 Ga0395898_0040930_860_2203 384
87 3300037466 Ga0395898_0047082 Ga0395898_0047082_1238_2575 384
88 3300037471 Ga0395905_0033644 Ga0395905_0033644_1425_2762 384
89 3300038443 Ga0395901_0029385 Ga0395901_0029385_1820_3157 384
90 3300038443 Ga0395901_0112607 Ga0395901_0112607_644_1987 384
91 3300048917 Ga0496114_0000029 Ga0496114_0000029_109891_111237 384
92 3300005354 Ga0070675_100056025 Ga0070675_1000560253 385
93 3300005356 Ga0070674_100096777 Ga0070674_1000967772 385
94 3300005435 Ga0070714_100226927 Ga0070714_1002269272 385
95 3300031995 Ga0307409_100018547 Ga0307409_1000185473 385
96 3300037418 Ga0395900_0019740 Ga0395900_0019740_909_2261 385
97 3300037418 Ga0395900_0179681 Ga0395900_0179681_655_2004 385
98 3300037471 Ga0395905_0095690 Ga0395905_0095690_428_1780 385
99 3300048912 Ga0496109_0106609 Ga0496109_0106609_783_2120 385
100 3300005328 Ga0070676_10117563 Ga0070676_101175632 386
101 3300005539 Ga0068853_100096765 Ga0068853_1000967652 386
102 3300005844 Ga0068862_100002977 Ga0068862_10000297711 386
103 3300006881 Ga0068865_100022065 Ga0068865_1000220653 386
104 3300025919 Ga0207657_10008727 Ga0207657_1000872710 386
105 3300025923 Ga0207681_10040931 Ga0207681_100409313 386
106 3300028380 Ga0268265_10003983 Ga0268265_100039836 386
107 3300038443 Ga0395901_0042195 Ga0395901_0042195_2775_4115 386
108 3300045049 Ga0466959_0041289 Ga0466959_0041289_1013_2383 386
109 3300005327 Ga0070658_10024827 Ga0070658_100248275 387
110 3300005327 Ga0070658_10110358 Ga0070658_101103582 387
111 3300005336 Ga0070680_100047805 Ga0070680_1000478054 387
112 3300005339 Ga0070660_100004413 Ga0070660_1000044134 387
113 3300005344 Ga0070661_100094670 Ga0070661_1000946702 387
114 3300005530 Ga0070679_100115169 Ga0070679_1001151692 387
115 3300025909 Ga0207705_10100399 Ga0207705_101003992 387
116 3300025917 Ga0207660_10041997 Ga0207660_100419973 387
117 3300025919 Ga0207657_10003866 Ga0207657_100038665 387
118 3300025919 Ga0207657_10031157 Ga0207657_100311571 387
119 3300025920 Ga0207649_10111240 Ga0207649_101112402 387
120 3300025921 Ga0207652_10021765 Ga0207652_100217655 387
121 3300042005 Ga0439448_0005536 Ga0439448_0005536_1515_2849 387
122 3300044684 Ga0466966_0030884 Ga0466966_0030884_523_1854 387
123 3300005327 Ga0070658_10068950 Ga0070658_100689503 388
124 3300005563 Ga0068855_100010898 Ga0068855_1000108987 388
125 3300025909 Ga0207705_10000701 Ga0207705_1000070123 388
126 3300025919 Ga0207657_10006922 Ga0207657_100069227 388
127 3300025949 Ga0207667_10002247 Ga0207667_1000224721 388
128 3300044693 Ga0466961_0105259 Ga0466961_0105259_156_1490 388
129 3300005344 Ga0070661_100076565 Ga0070661_1000765653 389
130 3300031852 Ga0307410_10066095 Ga0307410_100660952 389
131 3300031903 Ga0307407_10008755 Ga0307407_100087554 389
132 3300031911 Ga0307412_10048459 Ga0307412_100484592 389
133 3300031995 Ga0307409_100129384 Ga0307409_1001293842 389
134 3300032002 Ga0307416_100065282 Ga0307416_1000652823 389
135 3300037471 Ga0395905_0103537 Ga0395905_0103537_180_1517 389
136 3300005328 Ga0070676_10035913 Ga0070676_100359131 390
137 3300005331 Ga0070670_100084361 Ga0070670_1000843612 390
138 3300005333 Ga0070677_10003086 Ga0070677_100030862 390
139 3300005353 Ga0070669_100010464 Ga0070669_1000104644 390
140 3300005457 Ga0070662_100012230 Ga0070662_1000122307 390
141 3300005543 Ga0070672_100200184 Ga0070672_1002001842 390
142 3300005564 Ga0070664_100169875 Ga0070664_1001698752 390
143 3300014326 Ga0157380_10019469 Ga0157380_100194694 390
144 3300025321 Ga0207656_10045770 Ga0207656_100457702 390
145 3300025893 Ga0207682_10005735 Ga0207682_100057353 390
146 3300025907 Ga0207645_10123169 Ga0207645_101231692 390
147 3300025925 Ga0207650_10069830 Ga0207650_100698302 390
148 3300025933 Ga0207706_10026353 Ga0207706_100263534 390
149 3300044694 Ga0466963_0102133 Ga0466963_0102133_94_1428 390
150 3300025917 Ga0207660_10034269 Ga0207660_100342695 391
151 3300037466 Ga0395898_0137629 Ga0395898_0137629_35_1375 391
152 3300038443 Ga0395901_0237783 Ga0395901_0237783_125_1465 391
153 3300005327 Ga0070658_10001117 Ga0070658_1000111717 392
154 3300005336 Ga0070680_100049342 Ga0070680_1000493421 392
155 3300005355 Ga0070671_100171097 Ga0070671_1001710971 392
156 3300005530 Ga0070679_100090490 Ga0070679_1000904901 392
157 3300005543 Ga0070672_100102076 Ga0070672_1001020762 392
158 3300025909 Ga0207705_10012309 Ga0207705_100123099 392
159 3300031995 Ga0307409_100252989 Ga0307409_1002529892 392
160 3300037312 Ga0395899_0078093 Ga0395899_0078093_652_2001 392
161 3300037466 Ga0395898_0053892 Ga0395898_0053892_2165_3514 392
162 3300037471 Ga0395905_0052176 Ga0395905_0052176_2038_3387 392
163 3300038443 Ga0395901_0212443 Ga0395901_0212443_24_1373 392
164 3300005344 Ga0070661_100108605 Ga0070661_1001086052 393
165 3300005366 Ga0070659_100014154 Ga0070659_1000141541 393
166 3300005616 Ga0068852_100029166 Ga0068852_1000291666 393
167 3300025919 Ga0207657_10008934 Ga0207657_1000893410 393
168 3300025919 Ga0207657_10157530 Ga0207657_101575302 393
169 3300025933 Ga0207706_10191416 Ga0207706_101914161 393
170 3300025933 Ga0207706_10193325 Ga0207706_101933252 393
171 3300031548 Ga0307408_100065568 Ga0307408_1000655683 393
172 3300031731 Ga0307405_10026804 Ga0307405_100268043 393
173 3300031824 Ga0307413_10157173 Ga0307413_101571732 393
174 3300031852 Ga0307410_10018102 Ga0307410_100181022 393
175 3300031852 Ga0307410_10038018 Ga0307410_100380182 393
176 3300031852 Ga0307410_10093363 Ga0307410_100933631 393
177 3300031852 Ga0307410_10193418 Ga0307410_101934181 393
178 3300031901 Ga0307406_10033398 Ga0307406_100333983 393
179 3300031901 Ga0307406_10098781 Ga0307406_100987811 393
180 3300031903 Ga0307407_10002214 Ga0307407_100022147 393
181 3300031903 Ga0307407_10007374 Ga0307407_100073744 393
182 3300031903 Ga0307407_10096889 Ga0307407_100968892 393
183 3300031911 Ga0307412_10009923 Ga0307412_100099235 393
184 3300031911 Ga0307412_10012790 Ga0307412_100127902 393
185 3300031911 Ga0307412_10062626 Ga0307412_100626263 393
186 3300031995 Ga0307409_100001956 Ga0307409_10000195611 393
187 3300031995 Ga0307409_100043043 Ga0307409_1000430432 393
188 3300032002 Ga0307416_100070990 Ga0307416_1000709902 393
189 3300032002 Ga0307416_100097290 Ga0307416_1000972901 393
190 3300032002 Ga0307416_100299035 Ga0307416_1002990351 393
191 3300032004 Ga0307414_10005096 Ga0307414_1000509610 393
192 3300032004 Ga0307414_10166348 Ga0307414_101663482 393
193 3300032005 Ga0307411_10003049 Ga0307411_100030492 393
194 3300032005 Ga0307411_10009800 Ga0307411_100098003 393
195 3300032005 Ga0307411_10023834 Ga0307411_100238342 393
196 3300032005 Ga0307411_10060227 Ga0307411_100602272 393
197 3300032126 Ga0307415_100008878 Ga0307415_1000088788 393
198 3300032126 Ga0307415_100029854 Ga0307415_1000298543 393
199 3300042006 Ga0439432_030908 Ga0439432_030908_151_1491 393
200 3300005530 Ga0070679_100034374 Ga0070679_1000343746 394
201 3300005614 Ga0068856_100110139 Ga0068856_1001101393 394
202 3300005616 Ga0068852_100004740 Ga0068852_1000047403 394
203 3300013104 Ga0157370_10088516 Ga0157370_100885161 394
204 3300013105 Ga0157369_10217548 Ga0157369_102175481 394
205 3300013307 Ga0157372_10123098 Ga0157372_101230982 394
206 3300020081 Ga0206354_11338315 Ga0206354_113383152 394
207 3300025921 Ga0207652_10087414 Ga0207652_100874143 394
208 3300025949 Ga0207667_10021357 Ga0207667_100213577 394
209 3300026142 Ga0207698_10009497 Ga0207698_100094974 394
210 3300031911 Ga0307412_10117466 Ga0307412_101174661 394
211 3300032005 Ga0307411_10110669 Ga0307411_101106692 394
212 3300044694 Ga0466963_0007958 Ga0466963_0007958_4542_5888 394
213 3300032126 Ga0307415_100020086 Ga0307415_1000200863 395
214 3300045836 Ga0466958_0052570 Ga0466958_0052570_475_1821 395
215 3300005334 Ga0068869_100222893 Ga0068869_1002228931 396
216 3300005343 Ga0070687_100081063 Ga0070687_1000810632 396
217 3300005564 Ga0070664_100045863 Ga0070664_1000458632 396
218 3300005577 Ga0068857_100025569 Ga0068857_1000255697 396
219 3300005614 Ga0068856_100055783 Ga0068856_1000557832 396
220 3300005617 Ga0068859_100040235 Ga0068859_1000402358 396
221 3300005618 Ga0068864_100019593 Ga0068864_1000195933 396
222 3300005834 Ga0068851_10016667 Ga0068851_100166671 396
223 3300005841 Ga0068863_100006869 Ga0068863_1000068697 396
224 3300006931 Ga0097620_100040239 Ga0097620_1000402398 396
225 3300014497 Ga0182008_10022417 Ga0182008_100224175 396
226 3300014968 Ga0157379_10046223 Ga0157379_100462232 396
227 3300025321 Ga0207656_10016448 Ga0207656_100164483 396
228 3300025904 Ga0207647_10042929 Ga0207647_100429292 396
229 3300025931 Ga0207644_10048509 Ga0207644_100485093 396
230 3300025931 Ga0207644_10052840 Ga0207644_100528403 396
231 3300025933 Ga0207706_10195253 Ga0207706_101952532 396
232 3300025945 Ga0207679_10094966 Ga0207679_100949662 396
233 3300026078 Ga0207702_10070816 Ga0207702_100708163 396
234 3300026088 Ga0207641_10098225 Ga0207641_100982252 396
235 3300026095 Ga0207676_10112001 Ga0207676_101120012 396
236 3300026116 Ga0207674_10000859 Ga0207674_1000085942 396
237 3300037312 Ga0395899_0022606 Ga0395899_0022606_1094_2287 396
238 3300037466 Ga0395898_0010289 Ga0395898_0010289_3352_4545 396
239 3300037471 Ga0395905_0024923 Ga0395905_0024923_1186_2523 396
240 3300037471 Ga0395905_0247919 Ga0395905_0247919_117_1454 396
241 3300048904 Ga0496101_0064742 Ga0496101_0064742_1067_2410 396
242 3300048906 Ga0496103_0024689 Ga0496103_0024689_1809_3152 396
243 3300048907 Ga0496104_0076909 Ga0496104_0076909_608_1951 396
244 3300048909 Ga0496106_0052564 Ga0496106_0052564_538_1881 396
245 3300048910 Ga0496107_0060103 Ga0496107_0060103_859_2202 396
246 3300048911 Ga0496108_0019090 Ga0496108_0019090_4155_5492 396
247 3300048911 Ga0496108_0019846 Ga0496108_0019846_148_1491 396
248 3300048912 Ga0496109_0078529 Ga0496109_0078529_146_1489 396
249 3300048913 Ga0496110_0014792 Ga0496110_0014792_2734_4071 396
250 3300048913 Ga0496110_0026694 Ga0496110_0026694_2284_3627 396
251 3300048914 Ga0496111_0049519 Ga0496111_0049519_638_1981 396
252 3300048915 Ga0496112_0067956 Ga0496112_0067956_510_1853 396
253 3300048916 Ga0496113_0063519 Ga0496113_0063519_1177_2520 396
254 3300001989 JGI24739J22299_10008279 JGI24739J22299_100082792 397
255 3300005327 Ga0070658_10010526 Ga0070658_100105267 397
256 3300005328 Ga0070676_10014066 Ga0070676_100140666 397
257 3300005330 Ga0070690_100053579 Ga0070690_1000535792 397
258 3300005338 Ga0068868_100004343 Ga0068868_1000043437 397
259 3300005345 Ga0070692_10010806 Ga0070692_100108063 397
260 3300005347 Ga0070668_100061643 Ga0070668_1000616432 397
261 3300005353 Ga0070669_100002167 Ga0070669_10000216712 397
262 3300005354 Ga0070675_100069855 Ga0070675_1000698551 397
263 3300005364 Ga0070673_100000793 Ga0070673_10000079310 397
264 3300005366 Ga0070659_100021394 Ga0070659_1000213942 397
265 3300005366 Ga0070659_100049074 Ga0070659_1000490743 397
266 3300005367 Ga0070667_100015694 Ga0070667_1000156943 397
267 3300005459 Ga0068867_100015377 Ga0068867_1000153773 397
268 3300005539 Ga0068853_100065407 Ga0068853_1000654072 397
269 3300005543 Ga0070672_100002865 Ga0070672_1000028657 397
270 3300005564 Ga0070664_100015327 Ga0070664_1000153272 397
271 3300005616 Ga0068852_100091170 Ga0068852_1000911702 397
272 3300005617 Ga0068859_100056179 Ga0068859_1000561792 397
273 3300005618 Ga0068864_100021302 Ga0068864_1000213026 397
274 3300005834 Ga0068851_10056093 Ga0068851_100560932 397
275 3300006881 Ga0068865_100026058 Ga0068865_1000260582 397
276 3300006931 Ga0097620_100056178 Ga0097620_1000561782 397
277 3300009098 Ga0105245_10047670 Ga0105245_100476702 397
278 3300009174 Ga0105241_10065447 Ga0105241_100654472 397
279 3300009177 Ga0105248_10153817 Ga0105248_101538172 397
280 3300013100 Ga0157373_10130635 Ga0157373_101306352 397
281 3300013102 Ga0157371_10003353 Ga0157371_100033533 397
282 3300013104 Ga0157370_10046492 Ga0157370_100464924 397
283 3300013297 Ga0157378_10108682 Ga0157378_101086822 397
284 3300013306 Ga0163162_10044360 Ga0163162_100443602 397
285 3300013307 Ga0157372_10074204 Ga0157372_100742042 397
286 3300014745 Ga0157377_10013765 Ga0157377_100137653 397
287 3300025315 Ga0207697_10000921 Ga0207697_1000092117 397
288 3300025901 Ga0207688_10001651 Ga0207688_100016512 397
289 3300025904 Ga0207647_10000107 Ga0207647_1000010741 397
290 3300025907 Ga0207645_10010181 Ga0207645_100101816 397
291 3300025909 Ga0207705_10097186 Ga0207705_100971863 397
292 3300025919 Ga0207657_10000267 Ga0207657_1000026752 397
293 3300025919 Ga0207657_10006028 Ga0207657_100060289 397
294 3300025923 Ga0207681_10066678 Ga0207681_100666782 397
295 3300025926 Ga0207659_10016216 Ga0207659_100162165 397
296 3300025927 Ga0207687_10046913 Ga0207687_100469132 397
297 3300025932 Ga0207690_10127876 Ga0207690_101278762 397
298 3300025933 Ga0207706_10002331 Ga0207706_100023317 397
299 3300025938 Ga0207704_10078003 Ga0207704_100780031 397
300 3300025940 Ga0207691_10019892 Ga0207691_100198927 397
301 3300025941 Ga0207711_10056388 Ga0207711_100563882 397
302 3300025942 Ga0207689_10002883 Ga0207689_1000288315 397
303 3300025960 Ga0207651_10008766 Ga0207651_100087664 397
304 3300026023 Ga0207677_10049942 Ga0207677_100499422 397
305 3300026041 Ga0207639_10055632 Ga0207639_100556322 397
306 3300026089 Ga0207648_10002604 Ga0207648_1000260412 397
307 3300026142 Ga0207698_10100696 Ga0207698_101006961 397
308 3300037312 Ga0395899_0006461 Ga0395899_0006461_4566_5897 397
309 3300037418 Ga0395900_0000447 Ga0395900_0000447_6592_7923 397
310 3300037466 Ga0395898_0061291 Ga0395898_0061291_1077_2408 397
311 3300037471 Ga0395905_0010773 Ga0395905_0010773_1417_2757 397
312 3300038443 Ga0395901_0000324 Ga0395901_0000324_6624_7955 397
313 3300049583 Ga0501067_0016871 Ga0501067_0016871_722_2053 397
314 3300001979 JGI24740J21852_10009398 JGI24740J21852_100093982 398
315 3300002067 JGI24735J21928_10007456 JGI24735J21928_100074564 398
316 3300002077 JGI24744J21845_10007541 JGI24744J21845_100075412 398
317 3300005327 Ga0070658_10019153 Ga0070658_100191532 398
318 3300005328 Ga0070676_10083884 Ga0070676_100838842 398
319 3300005329 Ga0070683_100017549 Ga0070683_1000175494 398
320 3300005329 Ga0070683_100048152 Ga0070683_1000481525 398
321 3300005330 Ga0070690_100014404 Ga0070690_1000144042 398
322 3300005331 Ga0070670_100101494 Ga0070670_1001014942 398
323 3300005335 Ga0070666_10050412 Ga0070666_100504122 398
324 3300005336 Ga0070680_100000197 Ga0070680_1000001975 398
325 3300005336 Ga0070680_100005937 Ga0070680_10000593717 398
326 3300005336 Ga0070680_100026216 Ga0070680_1000262164 398
327 3300005337 Ga0070682_100006247 Ga0070682_1000062479 398
328 3300005338 Ga0068868_100000792 Ga0068868_1000007927 398
329 3300005338 Ga0068868_100054967 Ga0068868_1000549673 398
330 3300005339 Ga0070660_100037277 Ga0070660_1000372774 398
331 3300005339 Ga0070660_100065997 Ga0070660_1000659973 398
332 3300005339 Ga0070660_100081311 Ga0070660_1000813111 398
333 3300005341 Ga0070691_10010016 Ga0070691_100100163 398
334 3300005344 Ga0070661_100012334 Ga0070661_1000123348 398
335 3300005353 Ga0070669_100222274 Ga0070669_1002222741 398
336 3300005355 Ga0070671_100035482 Ga0070671_1000354823 398
337 3300005356 Ga0070674_100015214 Ga0070674_1000152142 398
338 3300005356 Ga0070674_100043599 Ga0070674_1000435992 398
339 3300005364 Ga0070673_100013681 Ga0070673_1000136815 398
340 3300005366 Ga0070659_100027357 Ga0070659_1000273572 398
341 3300005366 Ga0070659_100033630 Ga0070659_1000336303 398
342 3300005366 Ga0070659_100043039 Ga0070659_1000430393 398
343 3300005366 Ga0070659_100286484 Ga0070659_1002864841 398
344 3300005367 Ga0070667_100021116 Ga0070667_1000211165 398
345 3300005435 Ga0070714_100161756 Ga0070714_1001617561 398
346 3300005436 Ga0070713_100033018 Ga0070713_1000330183 398
347 3300005455 Ga0070663_100003383 Ga0070663_1000033835 398
348 3300005457 Ga0070662_100036627 Ga0070662_1000366272 398
349 3300005457 Ga0070662_100054873 Ga0070662_1000548732 398
350 3300005457 Ga0070662_100056790 Ga0070662_1000567902 398
351 3300005458 Ga0070681_10093236 Ga0070681_100932363 398
352 3300005530 Ga0070679_100034281 Ga0070679_1000342814 398
353 3300005530 Ga0070679_100037917 Ga0070679_1000379175 398
354 3300005530 Ga0070679_100171517 Ga0070679_1001715172 398
355 3300005535 Ga0070684_100012270 Ga0070684_1000122705 398
356 3300005539 Ga0068853_100023544 Ga0068853_1000235443 398
357 3300005539 Ga0068853_100091770 Ga0068853_1000917702 398
358 3300005563 Ga0068855_100084543 Ga0068855_1000845433 398
359 3300005563 Ga0068855_100107079 Ga0068855_1001070792 398
360 3300005564 Ga0070664_100044908 Ga0070664_1000449083 398
361 3300005564 Ga0070664_100067816 Ga0070664_1000678163 398
362 3300005578 Ga0068854_100001320 Ga0068854_1000013204 398
363 3300005614 Ga0068856_100009025 Ga0068856_10000902510 398
364 3300005614 Ga0068856_100119701 Ga0068856_1001197012 398
365 3300005614 Ga0068856_100162884 Ga0068856_1001628842 398
366 3300005616 Ga0068852_100000433 Ga0068852_10000043313 398
367 3300005616 Ga0068852_100022509 Ga0068852_1000225092 398
368 3300005616 Ga0068852_100030974 Ga0068852_1000309743 398
369 3300005617 Ga0068859_100054051 Ga0068859_1000540514 398
370 3300005617 Ga0068859_100062393 Ga0068859_1000623934 398
371 3300005618 Ga0068864_100007063 Ga0068864_1000070635 398
372 3300005618 Ga0068864_100031398 Ga0068864_1000313986 398
373 3300005618 Ga0068864_100066856 Ga0068864_1000668563 398
374 3300005834 Ga0068851_10026145 Ga0068851_100261452 398
375 3300005841 Ga0068863_100001264 Ga0068863_1000012644 398
376 3300005841 Ga0068863_100104560 Ga0068863_1001045602 398
377 3300005842 Ga0068858_100001147 Ga0068858_1000011479 398
378 3300005842 Ga0068858_100005425 Ga0068858_10000542511 398
379 3300005985 Ga0081539_10025333 Ga0081539_100253334 398
380 3300006931 Ga0097620_100054051 Ga0097620_1000540514 398
381 3300006931 Ga0097620_100062384 Ga0097620_1000623842 398
382 3300009093 Ga0105240_10104782 Ga0105240_101047822 398
383 3300009093 Ga0105240_10291990 Ga0105240_102919902 398
384 3300009098 Ga0105245_10192216 Ga0105245_101922162 398
385 3300009101 Ga0105247_10011543 Ga0105247_100115434 398
386 3300009177 Ga0105248_10000308 Ga0105248_100003088 398
387 3300009177 Ga0105248_10002368 Ga0105248_100023686 398
388 3300009177 Ga0105248_10061888 Ga0105248_100618884 398
389 3300009177 Ga0105248_10089423 Ga0105248_100894232 398
390 3300009551 Ga0105238_10046711 Ga0105238_100467112 398
391 3300009553 Ga0105249_10176060 Ga0105249_101760602 398
392 3300011119 Ga0105246_10069222 Ga0105246_100692222 398
393 3300013100 Ga0157373_10039867 Ga0157373_100398673 398
394 3300013102 Ga0157371_10023246 Ga0157371_100232464 398
395 3300013104 Ga0157370_10082118 Ga0157370_100821182 398
396 3300013105 Ga0157369_10060403 Ga0157369_100604033 398
397 3300013105 Ga0157369_10099810 Ga0157369_100998103 398
398 3300013297 Ga0157378_10046578 Ga0157378_100465784 398
399 3300013306 Ga0163162_10051321 Ga0163162_100513214 398
400 3300013307 Ga0157372_10098752 Ga0157372_100987523 398
401 3300014325 Ga0163163_10000139 Ga0163163_1000013974 398
402 3300014325 Ga0163163_10069531 Ga0163163_100695313 398
403 3300014968 Ga0157379_10017387 Ga0157379_100173879 398
404 3300020081 Ga0206354_11075063 Ga0206354_110750632 398
405 3300025893 Ga0207682_10007913 Ga0207682_100079133 398
406 3300025900 Ga0207710_10006603 Ga0207710_100066035 398
407 3300025903 Ga0207680_10002648 Ga0207680_100026486 398
408 3300025904 Ga0207647_10017762 Ga0207647_100177624 398
409 3300025907 Ga0207645_10078379 Ga0207645_100783792 398
410 3300025909 Ga0207705_10006617 Ga0207705_100066177 398
411 3300025909 Ga0207705_10010979 Ga0207705_100109794 398
412 3300025909 Ga0207705_10017137 Ga0207705_100171372 398
413 3300025909 Ga0207705_10018898 Ga0207705_100188985 398
414 3300025909 Ga0207705_10022551 Ga0207705_100225513 398
415 3300025912 Ga0207707_10181718 Ga0207707_101817182 398
416 3300025913 Ga0207695_10016905 Ga0207695_100169052 398
417 3300025917 Ga0207660_10037204 Ga0207660_100372042 398
418 3300025917 Ga0207660_10043271 Ga0207660_100432712 398
419 3300025919 Ga0207657_10051394 Ga0207657_100513942 398
420 3300025919 Ga0207657_10052607 Ga0207657_100526072 398
421 3300025919 Ga0207657_10065195 Ga0207657_100651952 398
422 3300025919 Ga0207657_10126809 Ga0207657_101268092 398
423 3300025920 Ga0207649_10028197 Ga0207649_100281973 398
424 3300025921 Ga0207652_10024259 Ga0207652_100242594 398
425 3300025921 Ga0207652_10074466 Ga0207652_100744663 398
426 3300025921 Ga0207652_10149888 Ga0207652_101498882 398
427 3300025924 Ga0207694_10013944 Ga0207694_100139447 398
428 3300025925 Ga0207650_10077484 Ga0207650_100774842 398
429 3300025928 Ga0207700_10040884 Ga0207700_100408842 398
430 3300025929 Ga0207664_10163897 Ga0207664_101638972 398
431 3300025931 Ga0207644_10024557 Ga0207644_100245573 398
432 3300025931 Ga0207644_10055692 Ga0207644_100556922 398
433 3300025931 Ga0207644_10135454 Ga0207644_101354541 398
434 3300025932 Ga0207690_10017923 Ga0207690_100179232 398
435 3300025932 Ga0207690_10026477 Ga0207690_100264772 398
436 3300025932 Ga0207690_10069033 Ga0207690_100690332 398
437 3300025933 Ga0207706_10018600 Ga0207706_100186005 398
438 3300025933 Ga0207706_10074822 Ga0207706_100748222 398
439 3300025941 Ga0207711_10000673 Ga0207711_1000067316 398
440 3300025941 Ga0207711_10000760 Ga0207711_1000076021 398
441 3300025941 Ga0207711_10019474 Ga0207711_100194743 398
442 3300025944 Ga0207661_10020834 Ga0207661_100208342 398
443 3300025944 Ga0207661_10030713 Ga0207661_100307133 398
444 3300025945 Ga0207679_10036492 Ga0207679_100364923 398
445 3300025945 Ga0207679_10065625 Ga0207679_100656252 398
446 3300025949 Ga0207667_10072029 Ga0207667_100720293 398
447 3300025960 Ga0207651_10000620 Ga0207651_100006206 398
448 3300025960 Ga0207651_10005055 Ga0207651_100050556 398
449 3300025960 Ga0207651_10072693 Ga0207651_100726932 398
450 3300025961 Ga0207712_10043314 Ga0207712_100433143 398
451 3300025981 Ga0207640_10031371 Ga0207640_100313713 398
452 3300026035 Ga0207703_10003144 Ga0207703_1000314416 398
453 3300026041 Ga0207639_10029316 Ga0207639_100293163 398
454 3300026067 Ga0207678_10015193 Ga0207678_100151931 398
455 3300026067 Ga0207678_10042942 Ga0207678_100429424 398
456 3300026067 Ga0207678_10087195 Ga0207678_100871952 398
457 3300026078 Ga0207702_10021213 Ga0207702_100212135 398
458 3300026088 Ga0207641_10006496 Ga0207641_100064964 398
459 3300026088 Ga0207641_10016806 Ga0207641_100168063 398
460 3300026088 Ga0207641_10135998 Ga0207641_101359982 398
461 3300026089 Ga0207648_10009898 Ga0207648_100098989 398
462 3300026095 Ga0207676_10001441 Ga0207676_1000144116 398
463 3300026095 Ga0207676_10072836 Ga0207676_100728363 398
464 3300026116 Ga0207674_10036692 Ga0207674_100366925 398
465 3300026116 Ga0207674_10041064 Ga0207674_100410643 398
466 3300026116 Ga0207674_10125737 Ga0207674_101257372 398
467 3300026121 Ga0207683_10026311 Ga0207683_100263115 398
468 3300026142 Ga0207698_10000421 Ga0207698_1000042114 398
469 3300026142 Ga0207698_10012429 Ga0207698_100124294 398
470 3300028381 Ga0268264_10020235 Ga0268264_100202353 398
471 3300031731 Ga0307405_10015739 Ga0307405_100157393 398
472 3300031824 Ga0307413_10000460 Ga0307413_100004608 398
473 3300031852 Ga0307410_10001814 Ga0307410_100018146 398
474 3300031852 Ga0307410_10059823 Ga0307410_100598233 398
475 3300031903 Ga0307407_10002575 Ga0307407_100025753 398
476 3300031911 Ga0307412_10037135 Ga0307412_100371351 398
477 3300031995 Ga0307409_100005191 Ga0307409_1000051914 398
478 3300031995 Ga0307409_100023817 Ga0307409_1000238173 398
479 3300032002 Ga0307416_100007788 Ga0307416_1000077887 398
480 3300032004 Ga0307414_10002382 Ga0307414_100023827 398
481 3300032005 Ga0307411_10003034 Ga0307411_100030347 398
482 3300032005 Ga0307411_10061724 Ga0307411_100617242 398
483 3300032126 Ga0307415_100000189 Ga0307415_10000018933 398
484 3300037312 Ga0395899_0003009 Ga0395899_0003009_6271_7608 398
485 3300037312 Ga0395899_0032669 Ga0395899_0032669_1426_2763 398
486 3300037312 Ga0395899_0034932 Ga0395899_0034932_449_1783 398
487 3300037312 Ga0395899_0038230 Ga0395899_0038230_1258_2595 398
488 3300037418 Ga0395900_0000294 Ga0395900_0000294_5861_7198 398
489 3300037418 Ga0395900_0001367 Ga0395900_0001367_7980_9314 398
490 3300037418 Ga0395900_0017609 Ga0395900_0017609_3848_5182 398
491 3300037418 Ga0395900_0064132 Ga0395900_0064132_2421_3755 398
492 3300037418 Ga0395900_0106111 Ga0395900_0106111_1103_2437 398
493 3300037418 Ga0395900_0281451 Ga0395900_0281451_288_1622 398
494 3300037466 Ga0395898_0001857 Ga0395898_0001857_19886_21223 398
495 3300037466 Ga0395898_0009865 Ga0395898_0009865_4348_5682 398
496 3300037466 Ga0395898_0048970 Ga0395898_0048970_2408_3742 398
497 3300037466 Ga0395898_0103456 Ga0395898_0103456_1213_2547 398
498 3300037471 Ga0395905_0000066 Ga0395905_0000066_175924_177261 398
499 3300037471 Ga0395905_0000215 Ga0395905_0000215_5548_6885 398
500 3300037471 Ga0395905_0001138 Ga0395905_0001138_24096_25430 398
501 3300037471 Ga0395905_0009384 Ga0395905_0009384_1550_2884 398
502 3300037471 Ga0395905_0023962 Ga0395905_0023962_1152_2489 398
503 3300037471 Ga0395905_0056316 Ga0395905_0056316_2060_3394 398
504 3300037471 Ga0395905_0099491 Ga0395905_0099491_299_1636 398
505 3300037471 Ga0395905_0144543 Ga0395905_0144543_202_1539 398
506 3300038443 Ga0395901_0002914 Ga0395901_0002914_2525_3862 398
507 3300038443 Ga0395901_0016739 Ga0395901_0016739_3310_4644 398
508 3300038443 Ga0395901_0022456 Ga0395901_0022456_2279_3613 398
509 3300038443 Ga0395901_0029627 Ga0395901_0029627_1172_2506 398
510 3300038443 Ga0395901_0385680 Ga0395901_0385680_41_1375 398
511 3300045976 Ga0466967_0147745 Ga0466967_0147745_846_2180 398
512 3300046492 Ga0495585_0014323 Ga0495585_0014323_2574_3977 398
513 3300046525 Ga0495663_0000545 Ga0495663_0000545_4216_5619 398
514 3300046537 Ga0495598_0000255 Ga0495598_0000255_2076_3479 398
515 3300046539 Ga0495621_0000513 Ga0495621_0000513_3891_5294 398
516 3300046558 Ga0495633_0002280 Ga0495633_0002280_7596_8999 398
517 3300046684 Ga0495669_0001278 Ga0495669_0001278_4589_5992 398
518 3300046684 Ga0495669_0018484 Ga0495669_0018484_407_1744 398
519 3300046691 Ga0495670_0002513 Ga0495670_0002513_5704_7107 398
520 3300047445 Ga0495677_0002975 Ga0495677_0002975_1179_2582 398
521 3300048910 Ga0496107_0090475 Ga0496107_0090475_138_1475 398
522 3300048911 Ga0496108_0129591 Ga0496108_0129591_248_1582 398
523 3300048912 Ga0496109_0030214 Ga0496109_0030214_2362_3696 398
524 3300048915 Ga0496112_0020378 Ga0496112_0020378_4855_6189 398
525 3300048916 Ga0496113_0089046 Ga0496113_0089046_356_1690 398
526 3300061719 Ga0466962_0016743 Ga0466962_0016743_2164_3498 398
527 3300005614 Ga0068856_100040797 Ga0068856_1000407977 399
528 3300005614 Ga0068856_100196516 Ga0068856_1001965162 399
529 3300026078 Ga0207702_10111801 Ga0207702_101118012 399
530 3300037471 Ga0395905_0005031 Ga0395905_0005031_3117_4454 399
531 3300037471 Ga0395905_0018831 Ga0395905_0018831_2678_4021 399
532 3300037471 Ga0395905_0112975 Ga0395905_0112975_993_2336 399
533 3300038443 Ga0395901_0038534 Ga0395901_0038534_1519_2859 399
534 3300044719 Ga0466971_0025166 Ga0466971_0025166_713_2056 399
535 3300009093 Ga0105240_10008382 Ga0105240_100083829 400
536 3300001904 JGI24736J21556_1000347 JGI24736J21556_10003472 401
537 3300005344 Ga0070661_100026136 Ga0070661_1000261363 401
538 3300005563 Ga0068855_100093764 Ga0068855_1000937642 401
539 3300005578 Ga0068854_100004723 Ga0068854_1000047237 401
540 3300005616 Ga0068852_100121267 Ga0068852_1001212673 401
541 3300009093 Ga0105240_10081161 Ga0105240_100811615 401
542 3300009551 Ga0105238_10020295 Ga0105238_100202958 401
543 3300010375 Ga0105239_10163816 Ga0105239_101638162 401
544 3300013100 Ga0157373_10012180 Ga0157373_100121803 401
545 3300013296 Ga0157374_10016292 Ga0157374_100162928 401
546 3300013307 Ga0157372_10103614 Ga0157372_101036143 401
547 3300025904 Ga0207647_10026668 Ga0207647_100266683 401
548 3300025909 Ga0207705_10000033 Ga0207705_1000003323 401
549 3300025913 Ga0207695_10077216 Ga0207695_100772163 401
550 3300025919 Ga0207657_10022450 Ga0207657_100224503 401
551 3300025920 Ga0207649_10000827 Ga0207649_1000082713 401
552 3300025924 Ga0207694_10064740 Ga0207694_100647402 401
553 3300025949 Ga0207667_10058244 Ga0207667_100582442 401
554 3300025949 Ga0207667_10065091 Ga0207667_100650913 401
555 3300025981 Ga0207640_10001486 Ga0207640_100014867 401
556 3300025981 Ga0207640_10013244 Ga0207640_100132446 401
557 3300026067 Ga0207678_10020762 Ga0207678_100207622 401
558 3300026116 Ga0207674_10096286 Ga0207674_100962863 401
559 3300037312 Ga0395899_0057013 Ga0395899_0057013_1350_2693 401
560 3300037418 Ga0395900_0101616 Ga0395900_0101616_698_2041 401
561 3300037466 Ga0395898_0030773 Ga0395898_0030773_500_1843 401
562 3300037471 Ga0395905_0104515 Ga0395905_0104515_1108_2451 401
563 3300044694 Ga0466963_0016100 Ga0466963_0016100_535_1878 401
564 3300045976 Ga0466967_0070831 Ga0466967_0070831_1245_2588 401
565 3300061719 Ga0466962_0074077 Ga0466962_0074077_345_1559 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00082

Peptidase_S8

Subtilase family

242

446

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y6m-assembly1.cif.gz_D intracellular subtilisin from bacillus sp. 0.8807 162 383
1c9j-assembly1.cif.gz_A bacillus lentus subtilisin k27r/n87s/v104y/n123s/t274a variant 0.8799 164 389
5ard-assembly1.cif.gz_A cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase 0.8793 164 388
1sub-assembly1.cif.gz_A calcium-independent subtilisin by design 0.8772 164 388
1thm-assembly1.cif.gz_A crystal structure of thermitase at 1.4 angstroms resolution 0.8768 164 388
ID Description Score Start End Superfamily
af_Q1LWH3_203_489_3.40.50.200 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8683 165 388 3.40.50.200
2b6nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8655 161 360 3.40.50.200
af_G5ECN9_130_485_3.40.50.200 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8644 165 360 3.40.50.200
1y9zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8644 162 388 3.40.50.200
af_A0A1D8PRH0_181_485_3.40.50.200 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8616 161 360 3.40.50.200
ID Description Score Start End GO Terms
AF-A0A7Y1XHI7-F1-model_v4 deleted 0.9442 13 398
AF-A0A259JX70-F1-model_v4 Peptidase S8/S53 domain-containing protein 0.9438 240 391 GO:0004252
GO:0006508
AF-A0A520YHP0-F1-model_v4 Serine protease 0.9432 12 398 GO:0004252
GO:0006508
AF-A0A2T5G086-F1-model_v4 Serine protease 0.9409 23 398 GO:0004252
GO:0006508
AF-A0A7G9S8S1-F1-model_v4 S8 family serine peptidase 0.9336 21 398 GO:0004252
GO:0006508

Feature Viewer

pLDDT pTM Quality
87.34 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map