F464188

General Info

Members Datasets Scaffolds Average Seq Length
564 283 550 196

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0100212|Ga0373923_0100212_164_808
Length 214
Sequence MTNGVKGRTTPAGEGSTMAASDLERLIQLLGRLPGLGPRSARRAALHLLKKRDSLMQPLATALAEAALSVKACANCGNLDSEDPCAICRDPKRDPAVICVVAEVGDLWALERSATYRGRYHVLGGTLSALDGIGPEQLNLAGLLRRAGDPVVQEVVLATGATVEGQTTAHYIADRLAGLPVTVSRLAHGLPVGGELDYLDDGTLMAALKARRPL

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221649 Leifsonia sp. Root4 Isolate Unclassified
3 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
4 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
5 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
6 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
7 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
8 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
9 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
10 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
11 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
155 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
164 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
276 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
277 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
278 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
282 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
283 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0.35
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.65
Nodule 0
Rhizoplane 8.51
Rhizosphere 63.48
Stem 0
Stem Tuber 0
Unclassified 14.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1183225 3300003578 Bacteria 2763
2 Ga0006562J51391_1183226 3300003578 Bacteria 2680
3 Ga0065714_10176103 3300005288 Bacteria 982
4 Ga0070658_10325203 3300005327 Bacteria 1313
5 Ga0070683_100664334 3300005329 Bacteria 998
6 Ga0070689_100072974 3300005340 Bacteria 2683
7 Ga0070671_100532555 3300005355 Bacteria 1012
8 Ga0070673_100706702 3300005364 Bacteria 926
9 Ga0070667_100043238 3300005367 Bacteria 3781
10 Ga0070709_10151620 3300005434 Bacteria 1602
11 Ga0070713_100100809 3300005436 Bacteria 2500
12 Ga0070711_100074380 3300005439 Bacteria 2403
13 Ga0070681_10103630 3300005458 Bacteria 2789
14 Ga0070685_10326433 3300005466 Bacteria 1042
15 Ga0070706_100310605 3300005467 Bacteria 1471
16 Ga0070679_100112752 3300005530 Bacteria 2705
17 Ga0070679_100135030 3300005530 Bacteria 2448
18 Ga0070684_100514708 3300005535 Bacteria 1109
19 Ga0070697_100028821 3300005536 Bacteria 4447
20 Ga0070697_100132896 3300005536 Bacteria 2088
21 Ga0068853_100160472 3300005539 Bacteria 2029
22 Ga0070665_100041143 3300005548 Bacteria 4645
23 Ga0070665_100123443 3300005548 Bacteria 2592
24 Ga0070665_100745077 3300005548 Bacteria 993
25 Ga0068855_100014441 3300005563 Bacteria 9508
26 Ga0068855_100216389 3300005563 Bacteria 2150
27 Ga0068855_100392301 3300005563 Bacteria 1522
28 Ga0068855_100761053 3300005563 Bacteria 1032
29 Ga0068854_100184005 3300005578 Bacteria 1633
30 Ga0070702_100278096 3300005615 Bacteria 1148
31 Ga0068852_100023506 3300005616 Bacteria 4962
32 Ga0068862_100004019 3300005844 Bacteria 12470
33 Ga0068862_100241751 3300005844 Bacteria 1642
34 Ga0068862_100666414 3300005844 Bacteria 1005
35 Ga0081455_10002932 3300005937 Bacteria 19999
36 Ga0081455_10009275 3300005937 Bacteria 10134
37 Ga0081539_10001300 3300005985 Bacteria 43786
38 Ga0070717_10579795 3300006028 Bacteria 1017
39 Ga0075365_10014893 3300006038 Bacteria 4688
40 Ga0075365_10042777 3300006038 Bacteria 2963
41 Ga0075365_10200908 3300006038 Bacteria 1396
42 Ga0075365_10299887 3300006038 Bacteria 1131
43 Ga0075368_10026671 3300006042 Bacteria 2223
44 Ga0075363_100008069 3300006048 Bacteria 4883
45 Ga0075363_100114888 3300006048 Bacteria 1499
46 Ga0075363_100145140 3300006048 Bacteria 1338
47 Ga0075364_10031764 3300006051 Bacteria 3392
48 Ga0075364_10047143 3300006051 Bacteria 2806
49 Ga0075364_10242746 3300006051 Bacteria 1224
50 Ga0070716_100423079 3300006173 Bacteria 964
51 Ga0070712_100196443 3300006175 Bacteria 1582
52 Ga0070712_100491018 3300006175 Bacteria 1028
53 Ga0075362_10003514 3300006177 Bacteria 5501
54 Ga0075362_10042432 3300006177 Bacteria 2010
55 Ga0075362_10082843 3300006177 Bacteria 1481
56 Ga0075362_10249272 3300006177 Bacteria 873
57 Ga0075367_10059084 3300006178 Bacteria 2283
58 Ga0075367_10072425 3300006178 Bacteria 2074
59 Ga0075367_10280349 3300006178 Bacteria 1048
60 Ga0075369_10001398 3300006186 Bacteria 8227
61 Ga0075369_10008940 3300006186 Bacteria 3874
62 Ga0075369_10014397 3300006186 Bacteria 3159
63 Ga0075369_10333327 3300006186 Bacteria 710
64 Ga0075366_10159300 3300006195 Bacteria 1368
65 Ga0097621_101110326 3300006237 Bacteria 743
66 Ga0075370_10006461 3300006353 Bacteria 5899
67 Ga0075370_10061961 3300006353 Bacteria 2131
68 Ga0075431_100288117 3300006847 Bacteria 1662
69 Ga0105244_10013916 3300009036 Bacteria 4675
70 Ga0105244_10021496 3300009036 Bacteria 3568
71 Ga0105244_10022438 3300009036 Bacteria 3474
72 Ga0105244_10074220 3300009036 Bacteria 1692
73 Ga0105240_10001645 3300009093 Bacteria 37949
74 Ga0105240_10004620 3300009093 Bacteria 20879
75 Ga0105240_10578050 3300009093 Bacteria 1240
76 Ga0105240_11039576 3300009093 Bacteria 874
77 Ga0111539_10989377 3300009094 Bacteria 978
78 Ga0114129_10533627 3300009147 Bacteria 1528
79 Ga0105243_10032012 3300009148 Bacteria 4059
80 Ga0105243_10167916 3300009148 Bacteria 1898
81 Ga0105243_10495745 3300009148 Bacteria 1156
82 Ga0105237_10129391 3300009545 Bacteria 2519
83 Ga0105237_10610952 3300009545 Bacteria 1097
84 Ga0105237_11317214 3300009545 Bacteria 729
85 Ga0105249_10983399 3300009553 Bacteria 912
86 Ga0157371_10077703 3300013102 Bacteria 2351
87 Ga0157371_10934564 3300013102 Bacteria 659
88 Ga0157370_10241076 3300013104 Bacteria 1673
89 Ga0157370_10251873 3300013104 Bacteria 1633
90 Ga0157370_10351965 3300013104 Unclassified 1357
91 Ga0157370_10486696 3300013104 Bacteria 1134
92 Ga0157370_10632849 3300013104 Bacteria 978
93 Ga0157370_11035776 3300013104 Bacteria 742
94 Ga0157369_10319383 3300013105 Bacteria 1614
95 Ga0171462_1004 3300013250 Bacteria 678877
96 Ga0163162_10070302 3300013306 Bacteria 3552
97 Ga0157372_10117532 3300013307 Bacteria 3050
98 Ga0157372_10267810 3300013307 Bacteria 1984
99 Ga0157372_10335804 3300013307 Bacteria 1760
100 Ga0157375_10139833 3300013308 Bacteria 2547
101 Ga0157375_10570206 3300013308 Bacteria 1293
102 Ga0157375_11262667 3300013308 Bacteria 867
103 Ga0163163_10048586 3300014325 Bacteria 4173
104 Ga0157380_10061927 3300014326 Bacteria 2996
105 Ga0182008_10120432 3300014497 Bacteria 1304
106 Ga0182008_10258574 3300014497 Bacteria 900
107 Ga0157379_10066960 3300014968 Bacteria 3211
108 Ga0182005_1031808 3300015265 Bacteria 1437
109 Ga0213873_10031748 3300021358 Bacteria 1316
110 Ga0213876_10094483 3300021384 Bacteria 1584
111 Ga0213876_10098421 3300021384 Bacteria 1550
112 Ga0209758_1000005 3300025297 Bacteria 1368918
113 Ga0209758_1016169 3300025297 Bacteria 3805
114 Ga0209257_1043074 3300025304 Bacteria 1326
115 Ga0207655_1007957 3300025728 Bacteria 6805
116 Ga0207655_1014538 3300025728 Bacteria 4442
117 Ga0207655_1057485 3300025728 Bacteria 1527
118 Ga0207692_10276533 3300025898 Bacteria 1014
119 Ga0207688_10184098 3300025901 Bacteria 1247
120 Ga0207647_10038641 3300025904 Bacteria 3017
121 Ga0207647_10078883 3300025904 Bacteria 1977
122 Ga0207699_10094149 3300025906 Bacteria 1887
123 Ga0207705_10069573 3300025909 Bacteria 2550
124 Ga0207705_10701994 3300025909 Bacteria 786
125 Ga0207684_10305953 3300025910 Bacteria 1370
126 Ga0207707_10068719 3300025912 Bacteria 3087
127 Ga0207707_10409517 3300025912 Bacteria 1163
128 Ga0207695_10000731 3300025913 Bacteria 63833
129 Ga0207695_10002254 3300025913 Bacteria 28885
130 Ga0207695_10389831 3300025913 Bacteria 1278
131 Ga0207695_10698093 3300025913 Bacteria 895
132 Ga0207693_10134446 3300025915 Bacteria 1944
133 Ga0207693_10489141 3300025915 Bacteria 961
134 Ga0207663_10482358 3300025916 Bacteria 961
135 Ga0207657_10043340 3300025919 Bacteria 3964
136 Ga0207657_10478397 3300025919 Bacteria 976
137 Ga0207649_10135877 3300025920 Bacteria 1676
138 Ga0207652_10512679 3300025921 Bacteria 1079
139 Ga0207681_10222283 3300025923 Bacteria 1462
140 Ga0207694_10008590 3300025924 Bacteria 7715
141 Ga0207659_10265824 3300025926 Bacteria 1397
142 Ga0207700_10112514 3300025928 Bacteria 2193
143 Ga0207709_10007871 3300025935 Bacteria 5906
144 Ga0207665_10512522 3300025939 Bacteria 928
145 Ga0207691_10420417 3300025940 Bacteria 1139
146 Ga0207661_10163708 3300025944 Bacteria 1931
147 Ga0207679_10686549 3300025945 Bacteria 928
148 Ga0207667_10013912 3300025949 Bacteria 9192
149 Ga0207667_10536977 3300025949 Bacteria 1184
150 Ga0207640_10741253 3300025981 Bacteria 846
151 Ga0207658_11034752 3300025986 Bacteria 749
152 Ga0207639_10120189 3300026041 Bacteria 2157
153 Ga0207708_10203651 3300026075 Bacteria 1579
154 Ga0207702_10011035 3300026078 Bacteria 7541
155 Ga0207702_10177203 3300026078 Bacteria 1960
156 Ga0207641_10564726 3300026088 Bacteria 1111
157 Ga0207648_11052297 3300026089 Bacteria 763
158 Ga0207674_10031576 3300026116 Bacteria 5562
159 Ga0207675_101106775 3300026118 Bacteria 812
160 Ga0207683_10553890 3300026121 Bacteria 1063
161 Ga0207683_10875503 3300026121 Bacteria 834
162 Ga0207698_10039570 3300026142 Bacteria 3495
163 Ga0207698_10521527 3300026142 Unclassified 1160
164 Ga0207698_11081536 3300026142 Bacteria 814
165 Ga0268266_10004488 3300028379 Bacteria 13346
166 Ga0268266_10082088 3300028379 Bacteria 2811
167 Ga0268266_10136390 3300028379 Bacteria 2198
168 Ga0268266_10171060 3300028379 Bacteria 1972
169 Ga0268265_10010065 3300028380 Bacteria 6383
170 Ga0268265_10512869 3300028380 Bacteria 1132
171 Ga0268264_10276500 3300028381 Bacteria 1571
172 Ga0265334_10042217 3300028573 Bacteria 1779
173 Ga0265332_10086151 3300031238 Bacteria 1331
174 Ga0265332_10187733 3300031238 Bacteria 860
175 Ga0265340_10102327 3300031247 Bacteria 1330
176 Ga0265331_10005584 3300031250 Bacteria 7571
177 Ga0307513_10082154 3300031456 Bacteria 3318
178 Ga0307513_10570137 3300031456 Bacteria 843
179 Ga0307408_100620624 3300031548 Bacteria 963
180 Ga0265313_10000110 3300031595 Bacteria 82958
181 Ga0316575_10046652 3300031665 Bacteria 1721
182 Ga0265314_10149255 3300031711 Bacteria 1435
183 Ga0265342_10013717 3300031712 Bacteria 5417
184 Ga0316578_10161299 3300031728 Bacteria 1351
185 Ga0307405_10511281 3300031731 Bacteria 965
186 Ga0307413_10208613 3300031824 Bacteria 1417
187 Ga0307413_11056088 3300031824 Bacteria 699
188 Ga0307410_10494586 3300031852 Bacteria 1005
189 Ga0307406_10000425 3300031901 Bacteria 24553
190 Ga0307406_10254288 3300031901 Bacteria 1325
191 Ga0307406_10337234 3300031901 Bacteria 1173
192 Ga0307406_10360269 3300031901 Bacteria 1140
193 Ga0307409_100016420 3300031995 Bacteria 4898
194 Ga0307409_100020690 3300031995 Bacteria 4491
195 Ga0307409_100144057 3300031995 Bacteria 2058
196 Ga0307409_100180152 3300031995 Bacteria 1870
197 Ga0307409_100375062 3300031995 Bacteria 1350
198 Ga0307409_100395141 3300031995 Bacteria 1319
199 Ga0307409_100526874 3300031995 Bacteria 1155
200 Ga0307409_100714299 3300031995 Bacteria 1003
201 Ga0307416_100045965 3300032002 Bacteria 3442
202 Ga0307416_100068414 3300032002 Bacteria 2934
203 Ga0307416_100426746 3300032002 Bacteria 1372
204 Ga0307416_100651026 3300032002 Bacteria 1138
205 Ga0307416_100760639 3300032002 Bacteria 1062
206 Ga0307416_102139297 3300032002 Bacteria 661
207 Ga0307411_10212764 3300032005 Bacteria 1494
208 Ga0307415_100247893 3300032126 Bacteria 1445
209 Ga0307415_100597948 3300032126 Bacteria 981
210 Ga0316585_10044818 3300032137 Bacteria 1414
211 Ga0373944_0151926 3300035089 Bacteria 817
212 Ga0373923_0100212 3300035111 Bacteria 1277
213 Ga0373936_0177396 3300035113 Bacteria 934
214 Ga0373945_0074985 3300035116 Bacteria 1287
215 Ga0373956_0014911 3300035119 Bacteria 3250
216 Ga0373943_0303445 3300035170 Bacteria 907
217 Ga0373955_0018886 3300035172 Bacteria 3437
218 Ga0316574_0143940 3300035398 Bacteria 1536
219 Ga0316574_0423607 3300035398 Bacteria 836
220 Ga0373924_0112657 3300035410 Bacteria 1177
221 Ga0373924_0220129 3300035410 Bacteria 839
222 Ga0373931_0239575 3300035691 Bacteria 1099
223 Ga0373931_0437847 3300035691 Bacteria 834
224 Ga0373927_0062265 3300035695 Bacteria 2413
225 Ga0373927_0326998 3300035695 Bacteria 1010
226 Ga0373927_0543824 3300035695 Bacteria 768
227 Ga0373933_0351681 3300035724 Bacteria 957
228 Ga0373937_0030044 3300036401 Bacteria 4922
229 Ga0373937_0088302 3300036401 Bacteria 2870
230 Ga0373937_0289884 3300036401 Bacteria 1546
231 Ga0373937_1142792 3300036401 Bacteria 727
232 Ga0316584_0078953 3300036712 Bacteria 2465
233 Ga0316584_0153539 3300036712 Bacteria 1713
234 Ga0373925_0216502 3300037068 Bacteria 1527
235 Ga0373925_0282401 3300037068 Bacteria 1337
236 Ga0373925_0351490 3300037068 Bacteria 1197
237 Ga0373925_0472588 3300037068 Bacteria 1028
238 Ga0395899_0023775 3300037312 Bacteria 4637
239 Ga0395899_0070248 3300037312 Bacteria 2563
240 Ga0395899_0156021 3300037312 Bacteria 1615
241 Ga0395900_0006237 3300037418 Bacteria 12445
242 Ga0395900_0049543 3300037418 Bacteria 4328
243 Ga0395900_0053165 3300037418 Bacteria 4168
244 Ga0395900_0079134 3300037418 Bacteria 3377
245 Ga0395898_0017727 3300037466 Bacteria 7266
246 Ga0395898_0031111 3300037466 Bacteria 5337
247 Ga0395898_0341884 3300037466 Bacteria 1427
248 Ga0395905_0000002 3300037471 Bacteria 1356358
249 Ga0395905_0466982 3300037471 Bacteria 1161
250 Ga0436364_0450254 3300037853 Bacteria 5486
251 Ga0395901_0003215 3300038443 Bacteria 16441
252 Ga0395901_0022203 3300038443 Bacteria 6503
253 Ga0395901_0047333 3300038443 Bacteria 4465
254 Ga0395901_0110087 3300038443 Bacteria 2891
255 Ga0395901_0396911 3300038443 Bacteria 1417
256 Ga0395901_0460909 3300038443 Bacteria 1299
257 Ga0400486_04782 3300038742 Bacteria 4690
258 Ga0400487_37166 3300039110 Bacteria 4577
259 Ga0436365_0521390 3300039437 Bacteria 1998
260 Ga0436365_1840648 3300039437 Bacteria 2166
261 Ga0436360_0542339 3300039438 Bacteria 5515
262 Ga0436363_0932153 3300039450 Bacteria 677
263 Ga0439436_0115609 3300041404 Bacteria 750
264 Ga0439465_0263394 3300041413 Bacteria 639
265 Ga0451791_1498828 3300041451 Bacteria 1489
266 Ga0451800_1645320 3300041459 Bacteria 741
267 Ga0451837_1691409 3300041494 Bacteria 853
268 Ga0451845_0080321 3300041501 Bacteria 888
269 Ga0451577_0186153 3300042876 Bacteria 1873
270 Ga0466972_0046585 3300044658 Bacteria 2099
271 Ga0466965_0020320 3300044683 Bacteria 3191
272 Ga0466966_0069838 3300044684 Bacteria 2203
273 Ga0466961_0147121 3300044693 Bacteria 1473
274 Ga0466963_0057369 3300044694 Bacteria 2593
275 Ga0466968_0012054 3300044735 Bacteria 3377
276 Ga0466970_0008471 3300044765 Bacteria 5177
277 Ga0466970_0018720 3300044765 Bacteria 3588
278 Ga0466970_0035649 3300044765 Bacteria 2635
279 Ga0466970_0043328 3300044765 Bacteria 2394
280 Ga0466970_0139506 3300044765 Bacteria 1335
281 Ga0466970_0278717 3300044765 Bacteria 940
282 Ga0466957_0312846 3300044842 Bacteria 1058
283 Ga0466957_0337148 3300044842 Bacteria 1020
284 Ga0466960_0004174 3300044901 Bacteria 5620
285 Ga0466960_0029351 3300044901 Bacteria 2524
286 Ga0466960_0160599 3300044901 Bacteria 1206
287 Ga0466960_0395117 3300044901 Bacteria 795
288 Ga0466960_0584789 3300044901 Bacteria 661
289 Ga0466959_0185377 3300045049 Bacteria 1454
290 Ga0466959_0259180 3300045049 Bacteria 1197
291 Ga0466959_0310896 3300045049 Bacteria 1078
292 Ga0451576_0001683 3300045051 Bacteria 36623
293 Ga0466958_0059794 3300045836 Bacteria 2319
294 Ga0466958_0138097 3300045836 Bacteria 1534
295 Ga0466958_0525399 3300045836 Bacteria 768
296 Ga0466967_0009372 3300045976 Bacteria 7259
297 Ga0495638_0374231 3300046460 Bacteria 746
298 Ga0495650_0040897 3300046471 Bacteria 1986
299 Ga0495650_0100635 3300046471 Bacteria 1086
300 Ga0495580_0573104 3300046472 Bacteria 748
301 Ga0495664_0175677 3300046477 Bacteria 1299
302 Ga0495620_0125012 3300046515 Bacteria 1012
303 Ga0495630_0360492 3300046517 Bacteria 1113
304 Ga0495631_0234132 3300046518 Bacteria 783
305 Ga0495652_0050154 3300046529 Bacteria 3570
306 Ga0495652_0550967 3300046529 Bacteria 793
307 Ga0495654_0060416 3300046530 Bacteria 1822
308 Ga0495587_0061749 3300046536 Bacteria 2195
309 Ga0495609_0067573 3300046538 Bacteria 1574
310 Ga0495645_0102700 3300046543 Bacteria 2032
311 Ga0495625_0038720 3300046660 Unclassified 3488
312 Ga0495625_0515944 3300046660 Bacteria 729
313 Ga0495657_0343122 3300046675 Bacteria 885
314 Ga0495599_0103422 3300046678 Bacteria 1775
315 Ga0495613_0363697 3300046689 Bacteria 992
316 Ga0495671_0113441 3300046692 Bacteria 1324
317 Ga0495680_0074698 3300047322 Bacteria 2574
318 Ga0495675_0327883 3300047444 Bacteria 905
319 Ga0495686_0111143 3300047472 Bacteria 1643
320 Ga0495602_0092889 3300048088 Bacteria 2498
321 Ga0495615_0010905 3300048090 Unclassified 1832
322 Ga0496100_0035880 3300048903 Bacteria 3123
323 Ga0496100_0141732 3300048903 Bacteria 1704
324 Ga0496100_0900771 3300048903 Unclassified 695
325 Ga0496101_0023103 3300048904 Bacteria 4290
326 Ga0496101_0313477 3300048904 Bacteria 1230
327 Ga0496102_0091853 3300048905 Bacteria 2810
328 Ga0496102_1107557 3300048905 Bacteria 712
329 Ga0496103_0061695 3300048906 Bacteria 2332
330 Ga0496104_0024582 3300048907 Bacteria 5542
331 Ga0496104_0041312 3300048907 Bacteria 4324
332 Ga0496104_0266737 3300048907 Bacteria 1625
333 Ga0496105_0025738 3300048908 Bacteria 4793
334 Ga0496105_0154282 3300048908 Bacteria 1886
335 Ga0496105_0314162 3300048908 Bacteria 1257
336 Ga0496105_0506530 3300048908 Bacteria 947
337 Ga0496105_0693324 3300048908 Bacteria 782
338 Ga0496107_0039500 3300048910 Bacteria 3386
339 Ga0496107_0102068 3300048910 Bacteria 2103
340 Ga0496108_0024042 3300048911 Bacteria 5016
341 Ga0496108_0090427 3300048911 Bacteria 2602
342 Ga0496108_0308018 3300048911 Bacteria 1380
343 Ga0496108_0514044 3300048911 Bacteria 1046
344 Ga0496108_0577877 3300048911 Bacteria 980
345 Ga0496109_0107029 3300048912 Bacteria 2597
346 Ga0496109_0449299 3300048912 Bacteria 1217
347 Ga0496110_0012176 3300048913 Bacteria 7067
348 Ga0496110_0031151 3300048913 Bacteria 4600
349 Ga0496110_0624871 3300048913 Bacteria 976
350 Ga0496111_0094057 3300048914 Bacteria 2198
351 Ga0496111_0098253 3300048914 Bacteria 2150
352 Ga0496111_0099178 3300048914 Bacteria 2139
353 Ga0496111_0158197 3300048914 Bacteria 1681
354 Ga0496111_0414329 3300048914 Bacteria 995
355 Ga0496112_0153004 3300048915 Bacteria 2274
356 Ga0496112_0655543 3300048915 Bacteria 979
357 Ga0496112_0764851 3300048915 Bacteria 892
358 Ga0496113_0007029 3300048916 Bacteria 7199
359 Ga0496113_0021926 3300048916 Bacteria 4511
360 Ga0496113_0263758 3300048916 Bacteria 1376
361 Ga0496114_0091823 3300048917 Bacteria 2579
362 Ga0496114_0091933 3300048917 Bacteria 2577
363 Ga0496114_0182416 3300048917 Bacteria 1833
364 Ga0496114_0450028 3300048917 Bacteria 1140
365 Ga0496115_0037879 3300048918 Bacteria 3823
366 Ga0496115_0135031 3300048918 Bacteria 2034
367 Ga0496115_0446969 3300048918 Bacteria 1044
368 Ga0496116_0000092 3300048919 Bacteria 206620
369 Ga0496116_0120421 3300048919 Bacteria 1520
370 Ga0496117_0000061 3300048920 Bacteria 258454
371 Ga0496117_0002882 3300048920 Bacteria 20867
372 Ga0496117_0012517 3300048920 Bacteria 7468
373 Ga0496117_0026019 3300048920 Bacteria 4586
374 Ga0496117_0058019 3300048920 Bacteria 2683
375 Ga0496117_0069350 3300048920 Bacteria 2374
376 Ga0496117_0076314 3300048920 Bacteria 2222
377 Ga0496117_0117976 3300048920 Bacteria 1637
378 Ga0496117_0136079 3300048920 Bacteria 1480
379 Ga0496118_0000450 3300048921 Bacteria 68053
380 Ga0496118_0003148 3300048921 Bacteria 21102
381 Ga0496118_0004410 3300048921 Bacteria 16712
382 Ga0496118_0006908 3300048921 Bacteria 12281
383 Ga0496118_0017605 3300048921 Bacteria 6492
384 Ga0496118_0045395 3300048921 Bacteria 3431
385 Ga0496119_0000295 3300048922 Bacteria 69951
386 Ga0496119_0001439 3300048922 Bacteria 28702
387 Ga0496119_0004939 3300048922 Bacteria 13041
388 Ga0496119_0005748 3300048922 Bacteria 11755
389 Ga0496119_0023703 3300048922 Bacteria 4341
390 Ga0496119_0026710 3300048922 Bacteria 3993
391 Ga0496119_0046275 3300048922 Bacteria 2718
392 Ga0496119_0077030 3300048922 Bacteria 1933
393 Ga0496119_0087241 3300048922 Bacteria 1781
394 Ga0496120_0010995 3300048923 Bacteria 6255
395 Ga0496120_0060524 3300048923 Bacteria 2118
396 Ga0496120_0064262 3300048923 Bacteria 2038
397 Ga0496120_0117159 3300048923 Bacteria 1382
398 Ga0496120_0228453 3300048923 Bacteria 885
399 Ga0496122_0000338 3300048925 Bacteria 101772
400 Ga0496122_0001010 3300048925 Bacteria 49780
401 Ga0496122_0001023 3300048925 Bacteria 49485
402 Ga0496122_0056960 3300048925 Bacteria 2908
403 Ga0496122_0068536 3300048925 Bacteria 2546
404 Ga0496122_0234380 3300048925 Bacteria 1041
405 Ga0496122_0284389 3300048925 Bacteria 902
406 Ga0496123_0000031 3300048926 Bacteria 287596
407 Ga0496123_0000354 3300048926 Bacteria 86153
408 Ga0496123_0006387 3300048926 Bacteria 11435
409 Ga0496123_0015668 3300048926 Bacteria 6204
410 Ga0496123_0239782 3300048926 Bacteria 901
411 Ga0496124_0000070 3300048927 Bacteria 220875
412 Ga0496124_0004869 3300048927 Bacteria 15437
413 Ga0496124_0005465 3300048927 Bacteria 14279
414 Ga0496124_0008791 3300048927 Bacteria 10489
415 Ga0496124_0066767 3300048927 Bacteria 2995
416 Ga0496124_0069767 3300048927 Bacteria 2917
417 Ga0496124_0104026 3300048927 Bacteria 2296
418 Ga0496124_0188121 3300048927 Bacteria 1583
419 Ga0496124_0300948 3300048927 Bacteria 1158
420 Ga0496125_0000074 3300048928 Bacteria 235549
421 Ga0496125_0000802 3300048928 Bacteria 51278
422 Ga0496125_0004143 3300048928 Bacteria 16917
423 Ga0496125_0006236 3300048928 Bacteria 12966
424 Ga0496125_0017434 3300048928 Bacteria 6845
425 Ga0496125_0068336 3300048928 Bacteria 2796
426 Ga0496126_0006734 3300048929 Bacteria 12758
427 Ga0496126_0061532 3300048929 Bacteria 3372
428 Ga0496126_0126219 3300048929 Bacteria 2214
429 Ga0496126_0141597 3300048929 Bacteria 2069
430 Ga0496126_0190682 3300048929 Bacteria 1736
431 Ga0496126_0299301 3300048929 Bacteria 1328
432 Ga0496126_0349922 3300048929 Bacteria 1209
433 Ga0501031_0006134 3300049568 Bacteria 7846
434 Ga0501032_0001070 3300049569 Bacteria 21896
435 Ga0501032_0092848 3300049569 Bacteria 2002
436 Ga0501032_0349963 3300049569 Bacteria 952
437 Ga0501033_0144637 3300049570 Bacteria 1718
438 Ga0501033_0272071 3300049570 Bacteria 1197
439 Ga0501034_0002869 3300049571 Bacteria 20047
440 Ga0501034_0004422 3300049571 Bacteria 15639
441 Ga0501034_0008894 3300049571 Bacteria 10554
442 Ga0501034_0011019 3300049571 Bacteria 9386
443 Ga0501034_0144832 3300049571 Bacteria 2354
444 Ga0501034_0509183 3300049571 Bacteria 1117
445 Ga0501037_0047069 3300049573 Bacteria 3162
446 Ga0501037_0173958 3300049573 Bacteria 1530
447 Ga0501038_0055638 3300049574 Bacteria 3398
448 Ga0501038_0073510 3300049574 Bacteria 2895
449 Ga0501038_0084419 3300049574 Bacteria 2672
450 Ga0501038_0503726 3300049574 Bacteria 925
451 Ga0501039_0234674 3300049575 Bacteria 1442
452 Ga0501040_0717094 3300049576 Bacteria 723
453 Ga0501043_0012201 3300049579 Bacteria 6717
454 Ga0501046_0004097 3300049580 Bacteria 13277
455 Ga0501046_0074921 3300049580 Bacteria 2625
456 Ga0501047_0001979 3300049581 Bacteria 19657
457 Ga0501047_0007431 3300049581 Bacteria 10313
458 Ga0501047_0404530 3300049581 Bacteria 1198
459 Ga0501067_0333194 3300049583 Bacteria 845
460 Ga0501068_0000776 3300049584 Bacteria 16480
461 Ga0501068_0057806 3300049584 Bacteria 2352
462 Ga0501070_0018912 3300049586 Bacteria 5779
463 Ga0501070_0039496 3300049586 Bacteria 3937
464 Ga0501070_0042700 3300049586 Bacteria 3776
465 Ga0501070_0047161 3300049586 Bacteria 3582
466 Ga0501070_0164584 3300049586 Bacteria 1828
467 Ga0501070_0403432 3300049586 Bacteria 1105
468 Ga0501070_0995863 3300049586 Bacteria 650
469 Ga0501072_0172123 3300049588 Bacteria 1728
470 Ga0501072_0763625 3300049588 Bacteria 758
471 Ga0501073_0083014 3300049589 Bacteria 2229
472 Ga0501073_0240132 3300049589 Bacteria 1251
473 Ga0501073_0479975 3300049589 Bacteria 860
474 Ga0501074_0277763 3300049590 Bacteria 1191
475 Ga0501077_0285329 3300049593 Bacteria 1051
476 Ga0501079_0619629 3300049741 Bacteria 852
477 Ga0501080_0056276 3300049742 Bacteria 3663
478 Ga0501080_0637521 3300049742 Bacteria 944
479 Ga0501080_1012472 3300049742 Bacteria 720
480 Ga0501083_0011522 3300049744 Bacteria 6203
481 Ga0501083_0050961 3300049744 Bacteria 2785
482 Ga0501083_0501564 3300049744 Bacteria 790
483 Ga0501035_0019707 3300049822 Bacteria 6198
484 Ga0501035_0149481 3300049822 Bacteria 2028
485 Ga0501044_0002889 3300049823 Bacteria 19566
486 Ga0501044_0020139 3300049823 Bacteria 7120
487 Ga0501044_0045814 3300049823 Bacteria 4530
488 Ga0501044_0190625 3300049823 Bacteria 2013
489 Ga0501044_0210971 3300049823 Bacteria 1896
490 Ga0501044_0382080 3300049823 Bacteria 1323
491 Ga0501045_0723002 3300049824 Bacteria 734
492 nmdc:mga03683_409_c1 3300050489 Bacteria 12382
493 nmdc:mga03683_4645_c1 3300050489 Bacteria 4574
494 nmdc:mga03683_63787_c1 3300050489 Bacteria 1562
495 nmdc:mga03683_64860_c1 3300050489 Bacteria 1551
496 nmdc:mga03n38_120540_c1 3300050490 Bacteria 1288
497 nmdc:mga03n38_133610_c1 3300050490 Bacteria 1232
498 nmdc:mga03n38_5887_c1 3300050490 Bacteria 4213
499 nmdc:mga00v17_178203_c1 3300050491 Bacteria 1371
500 nmdc:mga00v17_26257_c1 3300050491 Bacteria 3392
501 nmdc:mga00v17_39238_c1 3300050491 Bacteria 2835
502 nmdc:mga00v17_589284_c1 3300050491 Bacteria 717
503 nmdc:mga0yw44_24916_c1 3300050492 Bacteria 3394
504 nmdc:mga0yw44_46239_c1 3300050492 Bacteria 2613
505 nmdc:mga0k408_100821_c1 3300050493 Bacteria 1702
506 nmdc:mga0k408_91999_c1 3300050493 Bacteria 1782
507 nmdc:mga06z11_118903_c1 3300050494 Bacteria 1472
508 nmdc:mga06z11_22545_c1 3300050494 Bacteria 2943
509 nmdc:mga06z11_293653_c1 3300050494 Bacteria 965
510 nmdc:mga06z11_3127_c1 3300050494 Bacteria 6386
511 nmdc:mga06z11_350881_c1 3300050494 Bacteria 883
512 nmdc:mga04h51_18317_c1 3300050495 Bacteria 2060
513 nmdc:mga07m45_157835_c1 3300050496 Bacteria 1316
514 nmdc:mga07m45_40671_c1 3300050496 Bacteria 2601
515 nmdc:mga08y16_807809_c1 3300050511 Bacteria 930
516 nmdc:mga08y16_990006_c1 3300050511 Bacteria 821
517 nmdc:mga0a205_151595_c1 3300050515 Bacteria 2217
518 nmdc:mga0sz30_17400_c1 3300050516 Bacteria 2866
519 nmdc:mga0sz30_37094_c1 3300050516 Bacteria 2039
520 nmdc:mga0sz30_698_c1 3300050516 Bacteria 12401
521 Ga0495601_0148766 3300053077 Bacteria 1528
522 Ga0495612_0119719 3300053078 Bacteria 1132
523 Ga0500643_003251 3300053087 Bacteria 7913
524 Ga0500643_046626 3300053087 Bacteria 1251
525 Ga0500651_0033487 3300053093 Bacteria 3240
526 Ga0500555_019629 3300053103 Bacteria 1946
527 Ga0500555_037559 3300053103 Bacteria 1356
528 Ga0500562_000167 3300053108 Bacteria 18265
529 Ga0500593_085260 3300053117 Bacteria 1346
530 Ga0500618_022462 3300053125 Unclassified 1533
531 Ga0500642_0004948 3300053130 Bacteria 4238
532 Ga0500642_0151945 3300053130 Bacteria 1087
533 Ga0500658_0002800 3300053134 Bacteria 6694
534 Ga0500658_0238493 3300053134 Bacteria 835
535 Ga0500568_0009636 3300053139 Bacteria 4575
536 Ga0500577_0007954 3300053142 Bacteria 2999
537 Ga0500604_0003334 3300053151 Bacteria 4322
538 Ga0500604_0007801 3300053151 Bacteria 2837
539 Ga0500616_0047223 3300053153 Bacteria 2286
540 Ga0500616_0083399 3300053153 Bacteria 1601
541 Ga0500620_042865 3300053155 Bacteria 1492
542 Ga0500633_0094790 3300053160 Bacteria 1094
543 Ga0500611_013325 3300053727 Bacteria 1409
544 Ga0500609_000033 3300053731 Bacteria 18784
545 Ga0500609_004058 3300053731 Bacteria 2037
546 Ga0501084_0062924 3300054114 Bacteria 3106
547 Ga0501082_0001010 3300060353 Bacteria 24869
548 Ga0501082_0074121 3300060353 Bacteria 2931
549 Ga0501082_0149693 3300060353 Bacteria 2027
550 Ga0501082_0982579 3300060353 Bacteria 738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006177 Ga0075362_10003514 Ga0075362_100035147 169
2 3300005329 Ga0070683_100664334 Ga0070683_1006643342 173
3 3300005548 Ga0070665_100041143 Ga0070665_1000411433 174
4 3300025926 Ga0207659_10265824 Ga0207659_102658243 174
5 3300028379 Ga0268266_10136390 Ga0268266_101363902 174
6 3300005844 Ga0068862_100241751 Ga0068862_1002417513 175
7 3300005985 Ga0081539_10001300 Ga0081539_1000130020 175
8 3300009553 Ga0105249_10983399 Ga0105249_109833991 175
9 3300046460 Ga0495638_0374231 Ga0495638_0374231_64_657 175
10 3300053153 Ga0500616_0083399 Ga0500616_0083399_687_1298 175
11 3300006048 Ga0075363_100114888 Ga0075363_1001148882 176
12 3300006177 Ga0075362_10042432 Ga0075362_100424323 176
13 3300006178 Ga0075367_10280349 Ga0075367_102803491 176
14 3300006186 Ga0075369_10001398 Ga0075369_100013985 176
15 3300006353 Ga0075370_10061961 Ga0075370_100619613 176
16 3300025940 Ga0207691_10420417 Ga0207691_104204172 176
17 3300049588 Ga0501072_0763625 Ga0501072_0763625_189_740 176
18 3300050489 nmdc:mga03683_4645_c1 nmdc:mga03683_4645_c1_2353_2946 176
19 3300050490 nmdc:mga03n38_120540_c1 nmdc:mga03n38_120540_c1_347_940 176
20 3300050493 nmdc:mga0k408_91999_c1 nmdc:mga0k408_91999_c1_309_902 176
21 3300050494 nmdc:mga06z11_118903_c1 nmdc:mga06z11_118903_c1_668_1261 176
22 3300050496 nmdc:mga07m45_40671_c1 nmdc:mga07m45_40671_c1_1548_2141 176
23 3300050516 nmdc:mga0sz30_698_c1 nmdc:mga0sz30_698_c1_5123_5716 176
24 3300049586 Ga0501070_0164584 Ga0501070_0164584_703_1296 177
25 3300050489 nmdc:mga03683_409_c1 nmdc:mga03683_409_c1_982_1575 177
26 3300046517 Ga0495630_0360492 Ga0495630_0360492_218_811 179
27 3300053125 Ga0500618_022462 Ga0500618_022462_658_1269 181
28 3300035170 Ga0373943_0303445 Ga0373943_0303445_81_662 182
29 3300035695 Ga0373927_0326998 Ga0373927_0326998_114_695 182
30 3300037068 Ga0373925_0282401 Ga0373925_0282401_241_822 182
31 3300035410 Ga0373924_0220129 Ga0373924_0220129_171_764 185
32 3300035695 Ga0373927_0543824 Ga0373927_0543824_53_646 185
33 3300036401 Ga0373937_0088302 Ga0373937_0088302_972_1565 185
34 3300045051 Ga0451576_0001683 Ga0451576_0001683_14869_15459 185
35 3300044694 Ga0466963_0057369 Ga0466963_0057369_1885_2445 186
36 3300005937 Ga0081455_10002932 Ga0081455_1000293215 187
37 3300009545 Ga0105237_11317214 Ga0105237_113172141 187
38 3300026116 Ga0207674_10031576 Ga0207674_100315765 187
39 3300031238 Ga0265332_10086151 Ga0265332_100861512 187
40 3300035724 Ga0373933_0351681 Ga0373933_0351681_32_598 188
41 3300005563 Ga0068855_100216389 Ga0068855_1002163893 189
42 3300005578 Ga0068854_100184005 Ga0068854_1001840052 189
43 3300005616 Ga0068852_100023506 Ga0068852_1000235064 189
44 3300009093 Ga0105240_11039576 Ga0105240_110395761 189
45 3300013104 Ga0157370_10241076 Ga0157370_102410761 189
46 3300013307 Ga0157372_10335804 Ga0157372_103358043 189
47 3300014497 Ga0182008_10258574 Ga0182008_102585742 189
48 3300025913 Ga0207695_10698093 Ga0207695_106980931 189
49 3300025945 Ga0207679_10686549 Ga0207679_106865492 189
50 3300025981 Ga0207640_10741253 Ga0207640_107412532 189
51 3300026078 Ga0207702_10011035 Ga0207702_100110356 189
52 3300026142 Ga0207698_10039570 Ga0207698_100395702 189
53 3300028573 Ga0265334_10042217 Ga0265334_100422172 189
54 3300031247 Ga0265340_10102327 Ga0265340_101023273 189
55 3300036401 Ga0373937_1142792 Ga0373937_1142792_35_628 189
56 3300037312 Ga0395899_0070248 Ga0395899_0070248_1092_1685 189
57 3300037418 Ga0395900_0049543 Ga0395900_0049543_1673_2266 189
58 3300037466 Ga0395898_0031111 Ga0395898_0031111_819_1412 189
59 3300038443 Ga0395901_0022203 Ga0395901_0022203_4976_5569 189
60 3300005615 Ga0070702_100278096 Ga0070702_1002780962 190
61 3300005937 Ga0081455_10009275 Ga0081455_100092753 190
62 3300006237 Ga0097621_101110326 Ga0097621_1011103262 190
63 3300026075 Ga0207708_10203651 Ga0207708_102036512 190
64 3300026118 Ga0207675_101106775 Ga0207675_1011067751 190
65 3300026121 Ga0207683_10875503 Ga0207683_108755032 190
66 3300035691 Ga0373931_0239575 Ga0373931_0239575_225_818 190
67 3300037853 Ga0436364_0450254 Ga0436364_0450254_4610_5206 190
68 3300050511 nmdc:mga08y16_990006_c1 nmdc:mga08y16_990006_c1_69_662 190
69 3300005434 Ga0070709_10151620 Ga0070709_101516202 191
70 3300005436 Ga0070713_100100809 Ga0070713_1001008093 191
71 3300006028 Ga0070717_10579795 Ga0070717_105797951 191
72 3300006173 Ga0070716_100423079 Ga0070716_1004230791 191
73 3300006175 Ga0070712_100491018 Ga0070712_1004910182 191
74 3300006177 Ga0075362_10249272 Ga0075362_102492722 191
75 3300006178 Ga0075367_10059084 Ga0075367_100590843 191
76 3300025898 Ga0207692_10276533 Ga0207692_102765332 191
77 3300025915 Ga0207693_10489141 Ga0207693_104891412 191
78 3300025928 Ga0207700_10112514 Ga0207700_101125143 191
79 3300025939 Ga0207665_10512522 Ga0207665_105125221 191
80 3300031731 Ga0307405_10511281 Ga0307405_105112812 191
81 3300035113 Ga0373936_0177396 Ga0373936_0177396_183_776 191
82 3300037068 Ga0373925_0216502 Ga0373925_0216502_860_1453 191
83 3300046678 Ga0495599_0103422 Ga0495599_0103422_170_763 191
84 3300046689 Ga0495613_0363697 Ga0495613_0363697_62_655 191
85 3300050489 nmdc:mga03683_63787_c1 nmdc:mga03683_63787_c1_143_736 191
86 3300050494 nmdc:mga06z11_350881_c1 nmdc:mga06z11_350881_c1_240_833 191
87 3300005563 Ga0068855_100392301 Ga0068855_1003923013 192
88 3300021384 Ga0213876_10098421 Ga0213876_100984213 192
89 3300025949 Ga0207667_10536977 Ga0207667_105369772 192
90 3300039437 Ga0436365_0521390 Ga0436365_0521390_1015_1611 192
91 3300005563 Ga0068855_100014441 Ga0068855_10001444112 193
92 3300009093 Ga0105240_10001645 Ga0105240_1000164535 193
93 3300009093 Ga0105240_10004620 Ga0105240_1000462023 193
94 3300025913 Ga0207695_10000731 Ga0207695_1000073148 193
95 3300025913 Ga0207695_10002254 Ga0207695_1000225433 193
96 3300025949 Ga0207667_10013912 Ga0207667_1001391212 193
97 3300026142 Ga0207698_10521527 Ga0207698_105215271 193
98 iso_pu_bacteria 2585428094 2587863879 193
99 iso_pu_bacteria 2643221649 2644278778 193
100 iso_pu_bacteria 2808606700 2810365867 193
101 iso_pu_bacteria 2811994880 2812363791 193
102 iso_pu_bacteria 2883291878 2883292336 193
103 iso_pu_bacteria 2883354860 2883355333 193
104 iso_pu_bacteria 2884994152 2884997059 193
105 iso_pu_bacteria 2905926851 2905930709 193
106 iso_pu_bacteria 2946033335 2946036694 193
107 iso_pu_bacteria 2995726249 2995729021 193
108 iso_pu_bacteria 8002811521 8002814224 193
109 iso_pu_bacteria 8055037949 8055039360 193
110 iso_pu_bacteria 3000017691 3000019577 194
111 3300005340 Ga0070689_100072974 Ga0070689_1000729743 196
112 3300006847 Ga0075431_100288117 Ga0075431_1002881171 196
113 3300009148 Ga0105243_10495745 Ga0105243_104957451 196
114 3300014325 Ga0163163_10048586 Ga0163163_100485862 196
115 3300014968 Ga0157379_10066960 Ga0157379_100669603 196
116 3300026088 Ga0207641_10564726 Ga0207641_105647261 196
117 3300037471 Ga0395905_0000002 Ga0395905_0000002_203189_203803 196
118 3300046660 Ga0495625_0038720 Ga0495625_0038720_354_965 196
119 3300048090 Ga0495615_0010905 Ga0495615_0010905_1142_1753 196
120 3300048911 Ga0496108_0308018 Ga0496108_0308018_13_639 196
121 3300048913 Ga0496110_0031151 Ga0496110_0031151_932_1558 196
122 3300048914 Ga0496111_0098253 Ga0496111_0098253_1494_2120 196
123 3300050515 nmdc:mga0a205_151595_c1 nmdc:mga0a205_151595_c1_928_1530 196
124 3300003578 Ga0006562J51391_1183225 Ga0006562J51391_11832254 197
125 3300003578 Ga0006562J51391_1183226 Ga0006562J51391_11832261 197
126 3300005288 Ga0065714_10176103 Ga0065714_101761032 197
127 3300005327 Ga0070658_10325203 Ga0070658_103252031 197
128 3300005355 Ga0070671_100532555 Ga0070671_1005325552 197
129 3300005364 Ga0070673_100706702 Ga0070673_1007067022 197
130 3300005367 Ga0070667_100043238 Ga0070667_1000432382 197
131 3300005439 Ga0070711_100074380 Ga0070711_1000743802 197
132 3300005458 Ga0070681_10103630 Ga0070681_101036303 197
133 3300005466 Ga0070685_10326433 Ga0070685_103264332 197
134 3300005467 Ga0070706_100310605 Ga0070706_1003106052 197
135 3300005530 Ga0070679_100112752 Ga0070679_1001127523 197
136 3300005530 Ga0070679_100135030 Ga0070679_1001350302 197
137 3300005535 Ga0070684_100514708 Ga0070684_1005147081 197
138 3300005536 Ga0070697_100028821 Ga0070697_1000288215 197
139 3300005536 Ga0070697_100132896 Ga0070697_1001328962 197
140 3300005539 Ga0068853_100160472 Ga0068853_1001604723 197
141 3300005548 Ga0070665_100123443 Ga0070665_1001234433 197
142 3300005548 Ga0070665_100745077 Ga0070665_1007450772 197
143 3300005563 Ga0068855_100761053 Ga0068855_1007610532 197
144 3300005844 Ga0068862_100004019 Ga0068862_1000040197 197
145 3300005844 Ga0068862_100666414 Ga0068862_1006664142 197
146 3300006038 Ga0075365_10014893 Ga0075365_100148936 197
147 3300006038 Ga0075365_10042777 Ga0075365_100427772 197
148 3300006038 Ga0075365_10200908 Ga0075365_102009082 197
149 3300006038 Ga0075365_10299887 Ga0075365_102998872 197
150 3300006042 Ga0075368_10026671 Ga0075368_100266712 197
151 3300006048 Ga0075363_100008069 Ga0075363_1000080693 197
152 3300006048 Ga0075363_100145140 Ga0075363_1001451403 197
153 3300006051 Ga0075364_10031764 Ga0075364_100317642 197
154 3300006051 Ga0075364_10047143 Ga0075364_100471433 197
155 3300006051 Ga0075364_10242746 Ga0075364_102427462 197
156 3300006175 Ga0070712_100196443 Ga0070712_1001964433 197
157 3300006177 Ga0075362_10082843 Ga0075362_100828432 197
158 3300006178 Ga0075367_10072425 Ga0075367_100724253 197
159 3300006186 Ga0075369_10008940 Ga0075369_100089403 197
160 3300006186 Ga0075369_10014397 Ga0075369_100143973 197
161 3300006186 Ga0075369_10333327 Ga0075369_103333272 197
162 3300006195 Ga0075366_10159300 Ga0075366_101593002 197
163 3300006353 Ga0075370_10006461 Ga0075370_100064617 197
164 3300009036 Ga0105244_10013916 Ga0105244_100139163 197
165 3300009036 Ga0105244_10021496 Ga0105244_100214963 197
166 3300009036 Ga0105244_10022438 Ga0105244_100224383 197
167 3300009036 Ga0105244_10074220 Ga0105244_100742202 197
168 3300009093 Ga0105240_10578050 Ga0105240_105780502 197
169 3300009094 Ga0111539_10989377 Ga0111539_109893772 197
170 3300009147 Ga0114129_10533627 Ga0114129_105336272 197
171 3300009148 Ga0105243_10032012 Ga0105243_100320122 197
172 3300009148 Ga0105243_10167916 Ga0105243_101679162 197
173 3300009545 Ga0105237_10129391 Ga0105237_101293912 197
174 3300009545 Ga0105237_10610952 Ga0105237_106109522 197
175 3300013102 Ga0157371_10077703 Ga0157371_100777033 197
176 3300013102 Ga0157371_10934564 Ga0157371_109345641 197
177 3300013104 Ga0157370_10251873 Ga0157370_102518732 197
178 3300013104 Ga0157370_10351965 Ga0157370_103519652 197
179 3300013104 Ga0157370_10486696 Ga0157370_104866962 197
180 3300013104 Ga0157370_10632849 Ga0157370_106328492 197
181 3300013104 Ga0157370_11035776 Ga0157370_110357761 197
182 3300013105 Ga0157369_10319383 Ga0157369_103193832 197
183 3300013250 Ga0171462_1004 Ga0171462_1004425 197
184 3300013306 Ga0163162_10070302 Ga0163162_100703023 197
185 3300013307 Ga0157372_10117532 Ga0157372_101175322 197
186 3300013307 Ga0157372_10267810 Ga0157372_102678103 197
187 3300013308 Ga0157375_10139833 Ga0157375_101398332 197
188 3300013308 Ga0157375_10570206 Ga0157375_105702062 197
189 3300013308 Ga0157375_11262667 Ga0157375_112626672 197
190 3300014326 Ga0157380_10061927 Ga0157380_100619272 197
191 3300014497 Ga0182008_10120432 Ga0182008_101204322 197
192 3300015265 Ga0182005_1031808 Ga0182005_10318082 197
193 3300021358 Ga0213873_10031748 Ga0213873_100317483 197
194 3300021384 Ga0213876_10094483 Ga0213876_100944833 197
195 3300025297 Ga0209758_1000005 Ga0209758_100000518 197
196 3300025297 Ga0209758_1016169 Ga0209758_10161693 197
197 3300025304 Ga0209257_1043074 Ga0209257_10430742 197
198 3300025728 Ga0207655_1007957 Ga0207655_10079573 197
199 3300025728 Ga0207655_1014538 Ga0207655_10145383 197
200 3300025728 Ga0207655_1057485 Ga0207655_10574852 197
201 3300025901 Ga0207688_10184098 Ga0207688_101840981 197
202 3300025904 Ga0207647_10038641 Ga0207647_100386413 197
203 3300025904 Ga0207647_10078883 Ga0207647_100788832 197
204 3300025906 Ga0207699_10094149 Ga0207699_100941492 197
205 3300025909 Ga0207705_10069573 Ga0207705_100695733 197
206 3300025909 Ga0207705_10701994 Ga0207705_107019941 197
207 3300025910 Ga0207684_10305953 Ga0207684_103059532 197
208 3300025912 Ga0207707_10068719 Ga0207707_100687193 197
209 3300025912 Ga0207707_10409517 Ga0207707_104095172 197
210 3300025913 Ga0207695_10389831 Ga0207695_103898312 197
211 3300025915 Ga0207693_10134446 Ga0207693_101344463 197
212 3300025916 Ga0207663_10482358 Ga0207663_104823581 197
213 3300025919 Ga0207657_10043340 Ga0207657_100433402 197
214 3300025919 Ga0207657_10478397 Ga0207657_104783971 197
215 3300025920 Ga0207649_10135877 Ga0207649_101358772 197
216 3300025921 Ga0207652_10512679 Ga0207652_105126791 197
217 3300025923 Ga0207681_10222283 Ga0207681_102222832 197
218 3300025924 Ga0207694_10008590 Ga0207694_100085904 197
219 3300025935 Ga0207709_10007871 Ga0207709_100078712 197
220 3300025944 Ga0207661_10163708 Ga0207661_101637082 197
221 3300025986 Ga0207658_11034752 Ga0207658_110347521 197
222 3300026041 Ga0207639_10120189 Ga0207639_101201893 197
223 3300026078 Ga0207702_10177203 Ga0207702_101772032 197
224 3300026089 Ga0207648_11052297 Ga0207648_110522971 197
225 3300026121 Ga0207683_10553890 Ga0207683_105538902 197
226 3300026142 Ga0207698_11081536 Ga0207698_110815361 197
227 3300028379 Ga0268266_10004488 Ga0268266_100044889 197
228 3300028379 Ga0268266_10082088 Ga0268266_100820883 197
229 3300028379 Ga0268266_10171060 Ga0268266_101710603 197
230 3300028380 Ga0268265_10010065 Ga0268265_100100653 197
231 3300028380 Ga0268265_10512869 Ga0268265_105128692 197
232 3300028381 Ga0268264_10276500 Ga0268264_102765002 197
233 3300031238 Ga0265332_10187733 Ga0265332_101877332 197
234 3300031250 Ga0265331_10005584 Ga0265331_100055845 197
235 3300031456 Ga0307513_10082154 Ga0307513_100821543 197
236 3300031456 Ga0307513_10570137 Ga0307513_105701372 197
237 3300031548 Ga0307408_100620624 Ga0307408_1006206241 197
238 3300031595 Ga0265313_10000110 Ga0265313_1000011038 197
239 3300031665 Ga0316575_10046652 Ga0316575_100466522 197
240 3300031711 Ga0265314_10149255 Ga0265314_101492552 197
241 3300031712 Ga0265342_10013717 Ga0265342_100137173 197
242 3300031728 Ga0316578_10161299 Ga0316578_101612992 197
243 3300031824 Ga0307413_10208613 Ga0307413_102086132 197
244 3300031824 Ga0307413_11056088 Ga0307413_110560881 197
245 3300031852 Ga0307410_10494586 Ga0307410_104945862 197
246 3300031901 Ga0307406_10000425 Ga0307406_100004252 197
247 3300031901 Ga0307406_10254288 Ga0307406_102542882 197
248 3300031901 Ga0307406_10337234 Ga0307406_103372341 197
249 3300031901 Ga0307406_10360269 Ga0307406_103602692 197
250 3300031995 Ga0307409_100016420 Ga0307409_1000164204 197
251 3300031995 Ga0307409_100020690 Ga0307409_1000206905 197
252 3300031995 Ga0307409_100144057 Ga0307409_1001440573 197
253 3300031995 Ga0307409_100180152 Ga0307409_1001801521 197
254 3300031995 Ga0307409_100375062 Ga0307409_1003750622 197
255 3300031995 Ga0307409_100395141 Ga0307409_1003951412 197
256 3300031995 Ga0307409_100526874 Ga0307409_1005268742 197
257 3300031995 Ga0307409_100714299 Ga0307409_1007142991 197
258 3300032002 Ga0307416_100045965 Ga0307416_1000459651 197
259 3300032002 Ga0307416_100068414 Ga0307416_1000684142 197
260 3300032002 Ga0307416_100426746 Ga0307416_1004267462 197
261 3300032002 Ga0307416_100651026 Ga0307416_1006510261 197
262 3300032002 Ga0307416_100760639 Ga0307416_1007606392 197
263 3300032002 Ga0307416_102139297 Ga0307416_1021392971 197
264 3300032005 Ga0307411_10212764 Ga0307411_102127643 197
265 3300032126 Ga0307415_100247893 Ga0307415_1002478932 197
266 3300032126 Ga0307415_100597948 Ga0307415_1005979481 197
267 3300032137 Ga0316585_10044818 Ga0316585_100448183 197
268 3300035089 Ga0373944_0151926 Ga0373944_0151926_89_682 197
269 3300035111 Ga0373923_0100212 Ga0373923_0100212_164_808 197
270 3300035116 Ga0373945_0074985 Ga0373945_0074985_85_729 197
271 3300035119 Ga0373956_0014911 Ga0373956_0014911_1463_2068 197
272 3300035172 Ga0373955_0018886 Ga0373955_0018886_421_1026 197
273 3300035398 Ga0316574_0143940 Ga0316574_0143940_901_1506 197
274 3300035398 Ga0316574_0423607 Ga0316574_0423607_153_761 197
275 3300035410 Ga0373924_0112657 Ga0373924_0112657_518_1123 197
276 3300035691 Ga0373931_0437847 Ga0373931_0437847_139_732 197
277 3300035695 Ga0373927_0062265 Ga0373927_0062265_662_1255 197
278 3300036401 Ga0373937_0030044 Ga0373937_0030044_882_1475 197
279 3300036401 Ga0373937_0289884 Ga0373937_0289884_111_755 197
280 3300036712 Ga0316584_0078953 Ga0316584_0078953_939_1544 197
281 3300036712 Ga0316584_0153539 Ga0316584_0153539_705_1310 197
282 3300037068 Ga0373925_0351490 Ga0373925_0351490_369_962 197
283 3300037068 Ga0373925_0472588 Ga0373925_0472588_170_763 197
284 3300037312 Ga0395899_0023775 Ga0395899_0023775_736_1329 197
285 3300037312 Ga0395899_0156021 Ga0395899_0156021_468_1061 197
286 3300037418 Ga0395900_0006237 Ga0395900_0006237_6792_7391 197
287 3300037418 Ga0395900_0053165 Ga0395900_0053165_1431_2024 197
288 3300037418 Ga0395900_0079134 Ga0395900_0079134_172_765 197
289 3300037466 Ga0395898_0017727 Ga0395898_0017727_3842_4435 197
290 3300037466 Ga0395898_0341884 Ga0395898_0341884_547_1146 197
291 3300037471 Ga0395905_0466982 Ga0395905_0466982_289_888 197
292 3300038443 Ga0395901_0003215 Ga0395901_0003215_849_1448 197
293 3300038443 Ga0395901_0047333 Ga0395901_0047333_1283_1876 197
294 3300038443 Ga0395901_0110087 Ga0395901_0110087_179_772 197
295 3300038443 Ga0395901_0396911 Ga0395901_0396911_84_677 197
296 3300038443 Ga0395901_0460909 Ga0395901_0460909_544_1146 197
297 3300038742 Ga0400486_04782 Ga0400486_04782_3257_3862 197
298 3300039110 Ga0400487_37166 Ga0400487_37166_2904_3509 197
299 3300039437 Ga0436365_1840648 Ga0436365_1840648_955_1557 197
300 3300039438 Ga0436360_0542339 Ga0436360_0542339_1998_2591 197
301 3300039450 Ga0436363_0932153 Ga0436363_0932153_50_649 197
302 3300041404 Ga0439436_0115609 Ga0439436_0115609_92_691 197
303 3300041413 Ga0439465_0263394 Ga0439465_0263394_14_607 197
304 3300041451 Ga0451791_1498828 Ga0451791_1498828_695_1288 197
305 3300041459 Ga0451800_1645320 Ga0451800_1645320_23_616 197
306 3300041494 Ga0451837_1691409 Ga0451837_1691409_10_603 197
307 3300041501 Ga0451845_0080321 Ga0451845_0080321_97_690 197
308 3300042876 Ga0451577_0186153 Ga0451577_0186153_1241_1840 197
309 3300044658 Ga0466972_0046585 Ga0466972_0046585_399_995 197
310 3300044683 Ga0466965_0020320 Ga0466965_0020320_1658_2251 197
311 3300044684 Ga0466966_0069838 Ga0466966_0069838_1085_1684 197
312 3300044693 Ga0466961_0147121 Ga0466961_0147121_244_843 197
313 3300044735 Ga0466968_0012054 Ga0466968_0012054_2700_3293 197
314 3300044765 Ga0466970_0008471 Ga0466970_0008471_1216_1815 197
315 3300044765 Ga0466970_0018720 Ga0466970_0018720_174_773 197
316 3300044765 Ga0466970_0035649 Ga0466970_0035649_131_730 197
317 3300044765 Ga0466970_0043328 Ga0466970_0043328_454_1053 197
318 3300044765 Ga0466970_0139506 Ga0466970_0139506_645_1244 197
319 3300044765 Ga0466970_0278717 Ga0466970_0278717_152_751 197
320 3300044842 Ga0466957_0312846 Ga0466957_0312846_10_609 197
321 3300044842 Ga0466957_0337148 Ga0466957_0337148_194_787 197
322 3300044901 Ga0466960_0004174 Ga0466960_0004174_1699_2298 197
323 3300044901 Ga0466960_0029351 Ga0466960_0029351_1674_2267 197
324 3300044901 Ga0466960_0160599 Ga0466960_0160599_529_1122 197
325 3300044901 Ga0466960_0395117 Ga0466960_0395117_131_730 197
326 3300044901 Ga0466960_0584789 Ga0466960_0584789_21_620 197
327 3300045049 Ga0466959_0185377 Ga0466959_0185377_779_1378 197
328 3300045049 Ga0466959_0259180 Ga0466959_0259180_508_1107 197
329 3300045049 Ga0466959_0310896 Ga0466959_0310896_351_950 197
330 3300045836 Ga0466958_0059794 Ga0466958_0059794_438_1037 197
331 3300045836 Ga0466958_0138097 Ga0466958_0138097_479_1078 197
332 3300045836 Ga0466958_0525399 Ga0466958_0525399_74_673 197
333 3300045976 Ga0466967_0009372 Ga0466967_0009372_1566_2165 197
334 3300046471 Ga0495650_0040897 Ga0495650_0040897_148_747 197
335 3300046471 Ga0495650_0100635 Ga0495650_0100635_86_685 197
336 3300046472 Ga0495580_0573104 Ga0495580_0573104_113_706 197
337 3300046477 Ga0495664_0175677 Ga0495664_0175677_294_899 197
338 3300046515 Ga0495620_0125012 Ga0495620_0125012_109_702 197
339 3300046518 Ga0495631_0234132 Ga0495631_0234132_168_767 197
340 3300046529 Ga0495652_0050154 Ga0495652_0050154_996_1601 197
341 3300046529 Ga0495652_0550967 Ga0495652_0550967_131_724 197
342 3300046530 Ga0495654_0060416 Ga0495654_0060416_1056_1649 197
343 3300046536 Ga0495587_0061749 Ga0495587_0061749_711_1316 197
344 3300046538 Ga0495609_0067573 Ga0495609_0067573_237_836 197
345 3300046543 Ga0495645_0102700 Ga0495645_0102700_824_1417 197
346 3300046660 Ga0495625_0515944 Ga0495625_0515944_32_625 197
347 3300046675 Ga0495657_0343122 Ga0495657_0343122_10_615 197
348 3300046692 Ga0495671_0113441 Ga0495671_0113441_243_836 197
349 3300047322 Ga0495680_0074698 Ga0495680_0074698_1154_1759 197
350 3300047444 Ga0495675_0327883 Ga0495675_0327883_149_742 197
351 3300047472 Ga0495686_0111143 Ga0495686_0111143_113_706 197
352 3300048088 Ga0495602_0092889 Ga0495602_0092889_1632_2237 197
353 3300048903 Ga0496100_0035880 Ga0496100_0035880_2473_3072 197
354 3300048903 Ga0496100_0141732 Ga0496100_0141732_802_1395 197
355 3300048903 Ga0496100_0900771 Ga0496100_0900771_30_635 197
356 3300048904 Ga0496101_0023103 Ga0496101_0023103_803_1396 197
357 3300048904 Ga0496101_0313477 Ga0496101_0313477_534_1133 197
358 3300048905 Ga0496102_0091853 Ga0496102_0091853_1415_2008 197
359 3300048905 Ga0496102_1107557 Ga0496102_1107557_15_620 197
360 3300048906 Ga0496103_0061695 Ga0496103_0061695_923_1516 197
361 3300048907 Ga0496104_0024582 Ga0496104_0024582_1360_1953 197
362 3300048907 Ga0496104_0041312 Ga0496104_0041312_3129_3722 197
363 3300048907 Ga0496104_0266737 Ga0496104_0266737_60_665 197
364 3300048908 Ga0496105_0025738 Ga0496105_0025738_2651_3244 197
365 3300048908 Ga0496105_0154282 Ga0496105_0154282_1172_1765 197
366 3300048908 Ga0496105_0314162 Ga0496105_0314162_232_825 197
367 3300048908 Ga0496105_0506530 Ga0496105_0506530_207_800 197
368 3300048908 Ga0496105_0693324 Ga0496105_0693324_45_638 197
369 3300048910 Ga0496107_0039500 Ga0496107_0039500_357_962 197
370 3300048910 Ga0496107_0102068 Ga0496107_0102068_523_1116 197
371 3300048911 Ga0496108_0024042 Ga0496108_0024042_2750_3343 197
372 3300048911 Ga0496108_0090427 Ga0496108_0090427_1345_1938 197
373 3300048911 Ga0496108_0514044 Ga0496108_0514044_76_675 197
374 3300048911 Ga0496108_0577877 Ga0496108_0577877_141_734 197
375 3300048912 Ga0496109_0107029 Ga0496109_0107029_634_1227 197
376 3300048912 Ga0496109_0449299 Ga0496109_0449299_258_851 197
377 3300048913 Ga0496110_0012176 Ga0496110_0012176_6100_6693 197
378 3300048913 Ga0496110_0624871 Ga0496110_0624871_321_920 197
379 3300048914 Ga0496111_0094057 Ga0496111_0094057_990_1583 197
380 3300048914 Ga0496111_0099178 Ga0496111_0099178_158_757 197
381 3300048914 Ga0496111_0158197 Ga0496111_0158197_603_1196 197
382 3300048914 Ga0496111_0414329 Ga0496111_0414329_333_926 197
383 3300048915 Ga0496112_0153004 Ga0496112_0153004_1654_2247 197
384 3300048915 Ga0496112_0655543 Ga0496112_0655543_317_910 197
385 3300048915 Ga0496112_0764851 Ga0496112_0764851_131_730 197
386 3300048916 Ga0496113_0007029 Ga0496113_0007029_5546_6139 197
387 3300048916 Ga0496113_0021926 Ga0496113_0021926_3037_3630 197
388 3300048916 Ga0496113_0263758 Ga0496113_0263758_429_1022 197
389 3300048917 Ga0496114_0091823 Ga0496114_0091823_915_1508 197
390 3300048917 Ga0496114_0091933 Ga0496114_0091933_476_1069 197
391 3300048917 Ga0496114_0182416 Ga0496114_0182416_422_1015 197
392 3300048917 Ga0496114_0450028 Ga0496114_0450028_359_952 197
393 3300048918 Ga0496115_0037879 Ga0496115_0037879_1573_2166 197
394 3300048918 Ga0496115_0135031 Ga0496115_0135031_855_1448 197
395 3300048918 Ga0496115_0446969 Ga0496115_0446969_48_641 197
396 3300048919 Ga0496116_0000092 Ga0496116_0000092_179550_180155 197
397 3300048919 Ga0496116_0120421 Ga0496116_0120421_145_738 197
398 3300048920 Ga0496117_0000061 Ga0496117_0000061_178322_178915 197
399 3300048920 Ga0496117_0002882 Ga0496117_0002882_945_1544 197
400 3300048920 Ga0496117_0012517 Ga0496117_0012517_4085_4678 197
401 3300048920 Ga0496117_0026019 Ga0496117_0026019_2028_2621 197
402 3300048920 Ga0496117_0058019 Ga0496117_0058019_388_993 197
403 3300048920 Ga0496117_0069350 Ga0496117_0069350_1277_1870 197
404 3300048920 Ga0496117_0076314 Ga0496117_0076314_573_1172 197
405 3300048920 Ga0496117_0117976 Ga0496117_0117976_457_1050 197
406 3300048920 Ga0496117_0136079 Ga0496117_0136079_191_790 197
407 3300048921 Ga0496118_0000450 Ga0496118_0000450_30636_31235 197
408 3300048921 Ga0496118_0003148 Ga0496118_0003148_4483_5076 197
409 3300048921 Ga0496118_0004410 Ga0496118_0004410_4785_5378 197
410 3300048921 Ga0496118_0006908 Ga0496118_0006908_989_1594 197
411 3300048921 Ga0496118_0017605 Ga0496118_0017605_3147_3746 197
412 3300048921 Ga0496118_0045395 Ga0496118_0045395_1925_2518 197
413 3300048922 Ga0496119_0000295 Ga0496119_0000295_6107_6700 197
414 3300048922 Ga0496119_0001439 Ga0496119_0001439_902_1495 197
415 3300048922 Ga0496119_0004939 Ga0496119_0004939_11349_11942 197
416 3300048922 Ga0496119_0005748 Ga0496119_0005748_10807_11400 197
417 3300048922 Ga0496119_0023703 Ga0496119_0023703_246_845 197
418 3300048922 Ga0496119_0026710 Ga0496119_0026710_546_1139 197
419 3300048922 Ga0496119_0046275 Ga0496119_0046275_341_940 197
420 3300048922 Ga0496119_0077030 Ga0496119_0077030_752_1351 197
421 3300048922 Ga0496119_0087241 Ga0496119_0087241_1017_1610 197
422 3300048923 Ga0496120_0010995 Ga0496120_0010995_3937_4530 197
423 3300048923 Ga0496120_0060524 Ga0496120_0060524_624_1217 197
424 3300048923 Ga0496120_0064262 Ga0496120_0064262_928_1521 197
425 3300048923 Ga0496120_0117159 Ga0496120_0117159_77_670 197
426 3300048923 Ga0496120_0228453 Ga0496120_0228453_32_631 197
427 3300048925 Ga0496122_0000338 Ga0496122_0000338_90788_91381 197
428 3300048925 Ga0496122_0001010 Ga0496122_0001010_19713_20306 197
429 3300048925 Ga0496122_0001023 Ga0496122_0001023_39851_40450 197
430 3300048925 Ga0496122_0056960 Ga0496122_0056960_1965_2558 197
431 3300048925 Ga0496122_0068536 Ga0496122_0068536_826_1425 197
432 3300048925 Ga0496122_0234380 Ga0496122_0234380_337_930 197
433 3300048925 Ga0496122_0284389 Ga0496122_0284389_27_626 197
434 3300048926 Ga0496123_0000031 Ga0496123_0000031_242380_242973 197
435 3300048926 Ga0496123_0000354 Ga0496123_0000354_29434_30027 197
436 3300048926 Ga0496123_0006387 Ga0496123_0006387_1756_2349 197
437 3300048926 Ga0496123_0015668 Ga0496123_0015668_945_1544 197
438 3300048926 Ga0496123_0239782 Ga0496123_0239782_223_822 197
439 3300048927 Ga0496124_0000070 Ga0496124_0000070_187343_187942 197
440 3300048927 Ga0496124_0004869 Ga0496124_0004869_10657_11250 197
441 3300048927 Ga0496124_0005465 Ga0496124_0005465_7488_8081 197
442 3300048927 Ga0496124_0008791 Ga0496124_0008791_8480_9073 197
443 3300048927 Ga0496124_0066767 Ga0496124_0066767_1044_1637 197
444 3300048927 Ga0496124_0069767 Ga0496124_0069767_380_979 197
445 3300048927 Ga0496124_0104026 Ga0496124_0104026_1356_1949 197
446 3300048927 Ga0496124_0188121 Ga0496124_0188121_920_1525 197
447 3300048927 Ga0496124_0300948 Ga0496124_0300948_416_1015 197
448 3300048928 Ga0496125_0000074 Ga0496125_0000074_222479_223078 197
449 3300048928 Ga0496125_0000802 Ga0496125_0000802_15861_16454 197
450 3300048928 Ga0496125_0004143 Ga0496125_0004143_284_877 197
451 3300048928 Ga0496125_0006236 Ga0496125_0006236_4046_4639 197
452 3300048928 Ga0496125_0017434 Ga0496125_0017434_1474_2067 197
453 3300048928 Ga0496125_0068336 Ga0496125_0068336_1982_2575 197
454 3300048929 Ga0496126_0006734 Ga0496126_0006734_2990_3583 197
455 3300048929 Ga0496126_0061532 Ga0496126_0061532_2040_2639 197
456 3300048929 Ga0496126_0126219 Ga0496126_0126219_216_809 197
457 3300048929 Ga0496126_0141597 Ga0496126_0141597_1300_1896 197
458 3300048929 Ga0496126_0190682 Ga0496126_0190682_1091_1684 197
459 3300048929 Ga0496126_0299301 Ga0496126_0299301_465_1058 197
460 3300048929 Ga0496126_0349922 Ga0496126_0349922_534_1127 197
461 3300049568 Ga0501031_0006134 Ga0501031_0006134_3250_3849 197
462 3300049569 Ga0501032_0001070 Ga0501032_0001070_3070_3669 197
463 3300049569 Ga0501032_0092848 Ga0501032_0092848_446_1039 197
464 3300049569 Ga0501032_0349963 Ga0501032_0349963_306_899 197
465 3300049570 Ga0501033_0144637 Ga0501033_0144637_46_639 197
466 3300049570 Ga0501033_0272071 Ga0501033_0272071_500_1099 197
467 3300049571 Ga0501034_0002869 Ga0501034_0002869_16495_17094 197
468 3300049571 Ga0501034_0004422 Ga0501034_0004422_11223_11816 197
469 3300049571 Ga0501034_0008894 Ga0501034_0008894_6984_7577 197
470 3300049571 Ga0501034_0011019 Ga0501034_0011019_4422_5015 197
471 3300049571 Ga0501034_0144832 Ga0501034_0144832_355_948 197
472 3300049571 Ga0501034_0509183 Ga0501034_0509183_493_1086 197
473 3300049573 Ga0501037_0047069 Ga0501037_0047069_2242_2841 197
474 3300049573 Ga0501037_0173958 Ga0501037_0173958_497_1090 197
475 3300049574 Ga0501038_0055638 Ga0501038_0055638_1973_2566 197
476 3300049574 Ga0501038_0073510 Ga0501038_0073510_1258_1851 197
477 3300049574 Ga0501038_0084419 Ga0501038_0084419_1186_1779 197
478 3300049574 Ga0501038_0503726 Ga0501038_0503726_245_844 197
479 3300049575 Ga0501039_0234674 Ga0501039_0234674_722_1315 197
480 3300049576 Ga0501040_0717094 Ga0501040_0717094_48_647 197
481 3300049579 Ga0501043_0012201 Ga0501043_0012201_82_675 197
482 3300049580 Ga0501046_0004097 Ga0501046_0004097_4570_5169 197
483 3300049580 Ga0501046_0074921 Ga0501046_0074921_228_821 197
484 3300049581 Ga0501047_0001979 Ga0501047_0001979_5136_5735 197
485 3300049581 Ga0501047_0007431 Ga0501047_0007431_2966_3559 197
486 3300049581 Ga0501047_0404530 Ga0501047_0404530_222_815 197
487 3300049583 Ga0501067_0333194 Ga0501067_0333194_142_735 197
488 3300049584 Ga0501068_0000776 Ga0501068_0000776_4819_5412 197
489 3300049584 Ga0501068_0057806 Ga0501068_0057806_737_1330 197
490 3300049586 Ga0501070_0018912 Ga0501070_0018912_4343_4936 197
491 3300049586 Ga0501070_0039496 Ga0501070_0039496_1155_1748 197
492 3300049586 Ga0501070_0042700 Ga0501070_0042700_1291_1884 197
493 3300049586 Ga0501070_0047161 Ga0501070_0047161_2532_3131 197
494 3300049586 Ga0501070_0403432 Ga0501070_0403432_49_642 197
495 3300049586 Ga0501070_0995863 Ga0501070_0995863_26_619 197
496 3300049588 Ga0501072_0172123 Ga0501072_0172123_1105_1704 197
497 3300049589 Ga0501073_0083014 Ga0501073_0083014_1458_2051 197
498 3300049589 Ga0501073_0240132 Ga0501073_0240132_227_826 197
499 3300049589 Ga0501073_0479975 Ga0501073_0479975_111_704 197
500 3300049590 Ga0501074_0277763 Ga0501074_0277763_99_698 197
501 3300049593 Ga0501077_0285329 Ga0501077_0285329_416_1015 197
502 3300049741 Ga0501079_0619629 Ga0501079_0619629_88_681 197
503 3300049742 Ga0501080_0056276 Ga0501080_0056276_2972_3565 197
504 3300049742 Ga0501080_0637521 Ga0501080_0637521_19_612 197
505 3300049742 Ga0501080_1012472 Ga0501080_1012472_67_660 197
506 3300049744 Ga0501083_0011522 Ga0501083_0011522_965_1564 197
507 3300049744 Ga0501083_0050961 Ga0501083_0050961_570_1163 197
508 3300049744 Ga0501083_0501564 Ga0501083_0501564_36_635 197
509 3300049822 Ga0501035_0019707 Ga0501035_0019707_3238_3837 197
510 3300049822 Ga0501035_0149481 Ga0501035_0149481_353_946 197
511 3300049823 Ga0501044_0002889 Ga0501044_0002889_15351_15950 197
512 3300049823 Ga0501044_0020139 Ga0501044_0020139_132_725 197
513 3300049823 Ga0501044_0045814 Ga0501044_0045814_1936_2529 197
514 3300049823 Ga0501044_0190625 Ga0501044_0190625_1380_1973 197
515 3300049823 Ga0501044_0210971 Ga0501044_0210971_1137_1730 197
516 3300049823 Ga0501044_0382080 Ga0501044_0382080_204_797 197
517 3300049824 Ga0501045_0723002 Ga0501045_0723002_108_707 197
518 3300050489 nmdc:mga03683_64860_c1 nmdc:mga03683_64860_c1_446_1039 197
519 3300050490 nmdc:mga03n38_133610_c1 nmdc:mga03n38_133610_c1_488_1081 197
520 3300050490 nmdc:mga03n38_5887_c1 nmdc:mga03n38_5887_c1_2787_3380 197
521 3300050491 nmdc:mga00v17_178203_c1 nmdc:mga00v17_178203_c1_476_1072 197
522 3300050491 nmdc:mga00v17_26257_c1 nmdc:mga00v17_26257_c1_1752_2345 197
523 3300050491 nmdc:mga00v17_39238_c1 nmdc:mga00v17_39238_c1_439_1032 197
524 3300050491 nmdc:mga00v17_589284_c1 nmdc:mga00v17_589284_c1_88_681 197
525 3300050492 nmdc:mga0yw44_24916_c1 nmdc:mga0yw44_24916_c1_2369_2962 197
526 3300050492 nmdc:mga0yw44_46239_c1 nmdc:mga0yw44_46239_c1_205_798 197
527 3300050493 nmdc:mga0k408_100821_c1 nmdc:mga0k408_100821_c1_711_1304 197
528 3300050494 nmdc:mga06z11_22545_c1 nmdc:mga06z11_22545_c1_1365_1958 197
529 3300050494 nmdc:mga06z11_293653_c1 nmdc:mga06z11_293653_c1_205_798 197
530 3300050494 nmdc:mga06z11_3127_c1 nmdc:mga06z11_3127_c1_1065_1658 197
531 3300050495 nmdc:mga04h51_18317_c1 nmdc:mga04h51_18317_c1_268_861 197
532 3300050496 nmdc:mga07m45_157835_c1 nmdc:mga07m45_157835_c1_215_808 197
533 3300050511 nmdc:mga08y16_807809_c1 nmdc:mga08y16_807809_c1_18_623 197
534 3300050516 nmdc:mga0sz30_17400_c1 nmdc:mga0sz30_17400_c1_1943_2536 197
535 3300050516 nmdc:mga0sz30_37094_c1 nmdc:mga0sz30_37094_c1_375_968 197
536 3300053077 Ga0495601_0148766 Ga0495601_0148766_870_1475 197
537 3300053078 Ga0495612_0119719 Ga0495612_0119719_139_744 197
538 3300053087 Ga0500643_003251 Ga0500643_003251_476_1075 197
539 3300053087 Ga0500643_046626 Ga0500643_046626_513_1106 197
540 3300053093 Ga0500651_0033487 Ga0500651_0033487_2324_2917 197
541 3300053103 Ga0500555_019629 Ga0500555_019629_575_1168 197
542 3300053103 Ga0500555_037559 Ga0500555_037559_118_750 197
543 3300053108 Ga0500562_000167 Ga0500562_000167_2726_3358 197
544 3300053117 Ga0500593_085260 Ga0500593_085260_518_1150 197
545 3300053130 Ga0500642_0004948 Ga0500642_0004948_90_683 197
546 3300053130 Ga0500642_0151945 Ga0500642_0151945_462_1055 197
547 3300053134 Ga0500658_0002800 Ga0500658_0002800_5856_6449 197
548 3300053134 Ga0500658_0238493 Ga0500658_0238493_218_811 197
549 3300053139 Ga0500568_0009636 Ga0500568_0009636_2140_2733 197
550 3300053142 Ga0500577_0007954 Ga0500577_0007954_721_1314 197
551 3300053151 Ga0500604_0003334 Ga0500604_0003334_3403_3996 197
552 3300053151 Ga0500604_0007801 Ga0500604_0007801_1335_1928 197
553 3300053153 Ga0500616_0047223 Ga0500616_0047223_83_688 197
554 3300053155 Ga0500620_042865 Ga0500620_042865_724_1317 197
555 3300053160 Ga0500633_0094790 Ga0500633_0094790_240_833 197
556 3300053727 Ga0500611_013325 Ga0500611_013325_237_830 197
557 3300053731 Ga0500609_000033 Ga0500609_000033_7895_8488 197
558 3300053731 Ga0500609_004058 Ga0500609_004058_1045_1638 197
559 3300054114 Ga0501084_0062924 Ga0501084_0062924_1905_2504 197
560 3300060353 Ga0501082_0001010 Ga0501082_0001010_18118_18717 197
561 3300060353 Ga0501082_0074121 Ga0501082_0074121_696_1289 197
562 3300060353 Ga0501082_0149693 Ga0501082_0149693_459_1058 197
563 3300060353 Ga0501082_0982579 Ga0501082_0982579_23_616 197
564 iso_pu_bacteria 8055034563 8055037148 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

189

212

0.99

PF13662

Toprim_4

Toprim domain

96

187

0.98

PF21176

RecR_HhH

RecR, helix-hairpin-helix

23

67

0.97

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

70

90

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.951 80 170
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9309 80 170
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.886 17 197
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8813 17 197
1t6t-assembly1.cif.gz_1 putative protein from aquifex aeolicus 0.866 79 166
ID Description Score Start End Superfamily
af_P9WHI3_76_174_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9873 76 169 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9845 76 197 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9766 76 197 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9477 75 169 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9382 75 169 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A6P1B0M1-F1-model_v4 deleted 0.9877 57 151
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.987 70 172 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A6P1B0M1-F1-model_v4 deleted 0.9775 57 151
AF-W1XYN8-F1-model_v4 Recombination protein RecR 0.971 37 151 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9684 70 172 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.53 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map