F464155

General Info

Members Datasets Scaffolds Average Seq Length
564 292 1128 230

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100481891|Ga0075430_1004818912
Length 254
Sequence MLEELYTQAFWVGLLKIIGVNIILSGDNAVVIALAARSLPPKQXXAAILWGSGAAVVMRIVLTIFAVALLTLPWLKLIGSLLLFWIGIKLLVPEDGDENVSASDNLIAAIKTILIADLVMSIDNVIAVAAAAQGSYTLLILGLAISIPLVIFGSTLLLKLMERWPVIITIGGGLLGFVAGEMLVTDPALKGWLSGLGVVFDGEKPKVGGISLEILCGLVGAVIVIAAGTLIGKRRAMKQAVHEAAVEVDSGPKS

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
217 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
218 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 1.24
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100481891 3300006846 Bacteria 1023
2 JGI25406J46586_10071428 3300003203 Bacteria 1088
3 Ga0065715_10127927 3300005293 Bacteria 2076
4 Ga0070676_10035737 3300005328 Bacteria 2859
5 Ga0070676_10221643 3300005328 Bacteria 1249
6 Ga0070676_10261971 3300005328 Unclassified 1158
7 Ga0070690_100002870 3300005330 Bacteria 9295
8 Ga0070690_100016969 3300005330 Bacteria 4370
9 Ga0070690_100022777 3300005330 Bacteria 3835
10 Ga0070690_100118214 3300005330 Bacteria 1777
11 Ga0070670_100074389 3300005331 Bacteria 2918
12 Ga0068869_100002698 3300005334 Bacteria 10735
13 Ga0068869_100209976 3300005334 Bacteria 1539
14 Ga0070666_10034199 3300005335 Bacteria 3368
15 Ga0070680_100003680 3300005336 Bacteria 11448
16 Ga0070680_100018826 3300005336 Bacteria 5462
17 Ga0070680_100049774 3300005336 Bacteria 3416
18 Ga0070682_100011447 3300005337 Bacteria 5069
19 Ga0070682_100016453 3300005337 Bacteria 4299
20 Ga0068868_100003486 3300005338 Bacteria 10947
21 Ga0068868_100045739 3300005338 Bacteria 3425
22 Ga0068868_100280306 3300005338 Bacteria 1411
23 Ga0070660_100208652 3300005339 Bacteria 1585
24 Ga0070689_100004258 3300005340 Bacteria 9643
25 Ga0070689_100420420 3300005340 Bacteria 1133
26 Ga0070687_100000018 3300005343 Bacteria 53672
27 Ga0070687_100029659 3300005343 Bacteria 2666
28 Ga0070687_100368570 3300005343 Bacteria 932
29 Ga0070692_10001631 3300005345 Bacteria 8269
30 Ga0070692_10009880 3300005345 Bacteria 4322
31 Ga0070669_100254410 3300005353 Bacteria 1399
32 Ga0070669_100332712 3300005353 Unclassified 1229
33 Ga0070675_100187027 3300005354 Bacteria 1793
34 Ga0070675_100306804 3300005354 Bacteria 1399
35 Ga0070675_100310564 3300005354 Bacteria 1391
36 Ga0070671_100011803 3300005355 Bacteria 7027
37 Ga0070671_100217348 3300005355 Bacteria 1621
38 Ga0070674_100053226 3300005356 Bacteria 2794
39 Ga0070673_100421437 3300005364 Bacteria 1197
40 Ga0070688_100020460 3300005365 Bacteria 3849
41 Ga0070688_100023819 3300005365 Bacteria 3605
42 Ga0070709_10019893 3300005434 Bacteria 3889
43 Ga0070714_100000785 3300005435 Bacteria 22548
44 Ga0070713_100006452 3300005436 Bacteria 8134
45 Ga0070713_100011659 3300005436 Bacteria 6413
46 Ga0070701_10001221 3300005438 Bacteria 9422
47 Ga0070711_100616235 3300005439 Bacteria 907
48 Ga0070705_100003393 3300005440 Bacteria 7805
49 Ga0070705_100014462 3300005440 Bacteria 4060
50 Ga0070705_100201151 3300005440 Bacteria 1366
51 Ga0070705_100442639 3300005440 Bacteria 973
52 Ga0070700_100071837 3300005441 Bacteria 2211
53 Ga0070700_100072633 3300005441 Bacteria 2200
54 Ga0070700_100181594 3300005441 Bacteria 1465
55 Ga0070700_100291976 3300005441 Bacteria 1186
56 Ga0070694_100000229 3300005444 Bacteria 29512
57 Ga0070694_100046707 3300005444 Bacteria 2908
58 Ga0070694_100092086 3300005444 Bacteria 2129
59 Ga0070694_100311456 3300005444 Bacteria 1209
60 Ga0070708_100236707 3300005445 Bacteria 1714
61 Ga0070663_100368663 3300005455 Bacteria 1166
62 Ga0070678_100000773 3300005456 Bacteria 16046
63 Ga0070678_100134416 3300005456 Bacteria 1970
64 Ga0070662_100034510 3300005457 Bacteria 3567
65 Ga0070662_100083115 3300005457 Bacteria 2389
66 Ga0070681_10000834 3300005458 Bacteria 25795
67 Ga0070681_10273813 3300005458 Bacteria 1599
68 Ga0068867_100000577 3300005459 Bacteria 24298
69 Ga0068867_100303116 3300005459 Unclassified 1318
70 Ga0070685_10022617 3300005466 Bacteria 3430
71 Ga0070706_100291213 3300005467 Bacteria 1524
72 Ga0070707_100072416 3300005468 Bacteria 3321
73 Ga0070707_100223089 3300005468 Bacteria 1835
74 Ga0070698_100070223 3300005471 Bacteria 3515
75 Ga0070699_100044224 3300005518 Bacteria 3856
76 Ga0070699_100080060 3300005518 Bacteria 2847
77 Ga0070679_100006374 3300005530 Bacteria 10987
78 Ga0070679_100646941 3300005530 Unclassified 1000
79 Ga0070684_100035493 3300005535 Bacteria 4267
80 Ga0070684_100036623 3300005535 Bacteria 4205
81 Ga0070697_100006052 3300005536 Bacteria 9363
82 Ga0068853_100228757 3300005539 Bacteria 1700
83 Ga0068853_100364344 3300005539 Bacteria 1347
84 Ga0070672_100089286 3300005543 Bacteria 2483
85 Ga0070686_100000592 3300005544 Bacteria 21409
86 Ga0070686_100008122 3300005544 Bacteria 5869
87 Ga0070686_100255198 3300005544 Bacteria 1283
88 Ga0070695_100001572 3300005545 Bacteria 12736
89 Ga0070695_100030352 3300005545 Bacteria 3366
90 Ga0070695_100055028 3300005545 Bacteria 2564
91 Ga0070695_100109675 3300005545 Bacteria 1871
92 Ga0070695_100327551 3300005545 Bacteria 1141
93 Ga0070696_100004042 3300005546 Bacteria 9781
94 Ga0070696_100009153 3300005546 Bacteria 6630
95 Ga0070696_100101396 3300005546 Bacteria 2063
96 Ga0070696_100104293 3300005546 Bacteria 2036
97 Ga0070696_100155270 3300005546 Bacteria 1683
98 Ga0070693_100000136 3300005547 Bacteria 33252
99 Ga0070693_100000931 3300005547 Bacteria 12987
100 Ga0070693_100214033 3300005547 Bacteria 1259
101 Ga0070693_100235393 3300005547 Bacteria 1207
102 Ga0070693_100480286 3300005547 Bacteria 878
103 Ga0070665_100253273 3300005548 Bacteria 1761
104 Ga0070704_100002022 3300005549 Bacteria 11239
105 Ga0070704_100097672 3300005549 Bacteria 2205
106 Ga0070704_100172110 3300005549 Bacteria 1723
107 Ga0070704_100178440 3300005549 Bacteria 1696
108 Ga0070704_100188067 3300005549 Bacteria 1657
109 Ga0068855_100001415 3300005563 Bacteria 29792
110 Ga0068854_100005240 3300005578 Bacteria 8179
111 Ga0068854_100007094 3300005578 Bacteria 7154
112 Ga0068854_100012314 3300005578 Bacteria 5597
113 Ga0068856_100014600 3300005614 Bacteria 7588
114 Ga0068856_100076780 3300005614 Bacteria 3309
115 Ga0068856_100396511 3300005614 Bacteria 1400
116 Ga0070702_100000129 3300005615 Bacteria 23189
117 Ga0070702_100009464 3300005615 Bacteria 4771
118 Ga0070702_100050588 3300005615 Bacteria 2374
119 Ga0070702_100124701 3300005615 Bacteria 1617
120 Ga0070702_100158442 3300005615 Bacteria 1460
121 Ga0070702_100324957 3300005615 Bacteria 1073
122 Ga0068852_100036441 3300005616 Bacteria 4116
123 Ga0068859_100004921 3300005617 Bacteria 13585
124 Ga0068859_100014988 3300005617 Bacteria 7781
125 Ga0068859_100056936 3300005617 Bacteria 3937
126 Ga0068859_100165254 3300005617 Bacteria 2293
127 Ga0068864_100002651 3300005618 Bacteria 14774
128 Ga0068864_100206614 3300005618 Bacteria 1806
129 Ga0068866_10003524 3300005718 Bacteria 6406
130 Ga0068866_10005091 3300005718 Bacteria 5417
131 Ga0068866_10019895 3300005718 Bacteria 3065
132 Ga0068861_100001869 3300005719 Bacteria 13561
133 Ga0068861_100208494 3300005719 Bacteria 1645
134 Ga0068851_10060593 3300005834 Bacteria 1938
135 Ga0068870_10007192 3300005840 Bacteria 4956
136 Ga0068863_100052363 3300005841 Bacteria 3869
137 Ga0068863_100060886 3300005841 Bacteria 3569
138 Ga0068863_100185330 3300005841 Bacteria 1999
139 Ga0068863_100656372 3300005841 Bacteria 1041
140 Ga0068858_100001230 3300005842 Bacteria 26467
141 Ga0068858_100046767 3300005842 Bacteria 4011
142 Ga0068858_100067139 3300005842 Bacteria 3321
143 Ga0068858_100068289 3300005842 Bacteria 3294
144 Ga0068860_100007739 3300005843 Bacteria 10735
145 Ga0068860_100037729 3300005843 Bacteria 4624
146 Ga0068860_100047588 3300005843 Bacteria 4087
147 Ga0068862_100001654 3300005844 Bacteria 20281
148 Ga0081539_10005604 3300005985 Bacteria 12647
149 Ga0070717_10838864 3300006028 Bacteria 836
150 Ga0070715_10087054 3300006163 Bacteria 1430
151 Ga0070716_100410360 3300006173 Bacteria 976
152 Ga0070712_100002535 3300006175 Bacteria 11284
153 Ga0070712_100260147 3300006175 Bacteria 1390
154 Ga0075366_10006869 3300006195 Bacteria 6262
155 Ga0075366_10011146 3300006195 Bacteria 5067
156 Ga0097621_100000387 3300006237 Bacteria 30657
157 Ga0097621_100003771 3300006237 Bacteria 10502
158 Ga0075370_10205322 3300006353 Bacteria 1163
159 Ga0068871_100000344 3300006358 Bacteria 32279
160 Ga0068871_100015508 3300006358 Bacteria 5706
161 Ga0068871_100093061 3300006358 Bacteria 2514
162 Ga0068871_100186440 3300006358 Bacteria 1785
163 Ga0075428_100009707 3300006844 Bacteria 10688
164 Ga0075428_100058560 3300006844 Bacteria 4217
165 Ga0075428_100180738 3300006844 Bacteria 2283
166 Ga0075430_100014432 3300006846 Bacteria 6730
167 Ga0075430_100354313 3300006846 Bacteria 1212
168 Ga0075431_100019249 3300006847 Bacteria 6959
169 Ga0075431_100301297 3300006847 Bacteria 1619
170 Ga0075433_10012156 3300006852 Bacteria 6941
171 Ga0075433_10072325 3300006852 Bacteria 3032
172 Ga0075433_10215587 3300006852 Bacteria 1706
173 Ga0075434_100000066 3300006871 Bacteria 54004
174 Ga0075434_100001877 3300006871 Bacteria 18186
175 Ga0075434_100061980 3300006871 Bacteria 3722
176 Ga0075434_100082187 3300006871 Bacteria 3218
177 Ga0075434_100669534 3300006871 Bacteria 1056
178 Ga0075429_100000783 3300006880 Bacteria 25072
179 Ga0075429_100000863 3300006880 Bacteria 23895
180 Ga0075429_100658041 3300006880 Bacteria 918
181 Ga0068865_100000159 3300006881 Bacteria 36900
182 Ga0068865_100059726 3300006881 Bacteria 2668
183 Ga0075436_100000232 3300006914 Bacteria 34912
184 Ga0075436_100053146 3300006914 Bacteria 2796
185 Ga0097620_100004921 3300006931 Bacteria 13585
186 Ga0097620_100014989 3300006931 Bacteria 7781
187 Ga0097620_100056933 3300006931 Bacteria 3937
188 Ga0097620_100165248 3300006931 Bacteria 2293
189 Ga0075435_100001417 3300007076 Bacteria 15465
190 Ga0075435_100012612 3300007076 Bacteria 6260
191 Ga0075435_100036897 3300007076 Bacteria 3888
192 Ga0075435_100374551 3300007076 Bacteria 1223
193 Ga0075435_100480917 3300007076 Bacteria 1073
194 Ga0099794_10019340 3300007265 Bacteria 3066
195 Ga0099794_10147578 3300007265 Bacteria 1193
196 Ga0099794_10191014 3300007265 Bacteria 1047
197 Ga0105240_10575123 3300009093 Bacteria 1243
198 Ga0111539_10031508 3300009094 Bacteria 6440
199 Ga0111539_10112809 3300009094 Bacteria 3189
200 Ga0111539_10340190 3300009094 Bacteria 1747
201 Ga0105245_10002096 3300009098 Bacteria 18082
202 Ga0105245_10028836 3300009098 Bacteria 4899
203 Ga0105245_10405720 3300009098 Bacteria 1363
204 Ga0105247_10007076 3300009101 Bacteria 6893
205 Ga0114129_10000341 3300009147 Bacteria 54331
206 Ga0114129_10000823 3300009147 Bacteria 40012
207 Ga0105243_10000346 3300009148 Bacteria 49790
208 Ga0105243_10032494 3300009148 Bacteria 4033
209 Ga0105243_10042059 3300009148 Bacteria 3576
210 Ga0105241_10043337 3300009174 Bacteria 3408
211 Ga0105241_10069079 3300009174 Bacteria 2739
212 Ga0105241_10434091 3300009174 Bacteria 1159
213 Ga0105242_10000310 3300009176 Bacteria 39046
214 Ga0105242_10003033 3300009176 Bacteria 13123
215 Ga0105242_10004136 3300009176 Bacteria 11293
216 Ga0105242_10099140 3300009176 Bacteria 2466
217 Ga0105248_10051220 3300009177 Bacteria 4633
218 Ga0105248_10093463 3300009177 Bacteria 3387
219 Ga0105237_10021401 3300009545 Bacteria 6648
220 Ga0105237_10971640 3300009545 Bacteria 856
221 Ga0105238_10034965 3300009551 Bacteria 5111
222 Ga0105249_10045885 3300009553 Bacteria 3976
223 Ga0105249_10106641 3300009553 Bacteria 2643
224 Ga0105249_10285973 3300009553 Bacteria 1649
225 Ga0105239_10205242 3300010375 Bacteria 2208
226 Ga0105239_10456796 3300010375 Bacteria 1449
227 Ga0105246_10037203 3300011119 Bacteria 3265
228 Ga0105246_10086703 3300011119 Bacteria 2245
229 Ga0157373_10041685 3300013100 Bacteria 3283
230 Ga0157371_10091313 3300013102 Bacteria 2157
231 Ga0157370_10009451 3300013104 Bacteria 10414
232 Ga0157374_10001734 3300013296 Bacteria 18285
233 Ga0157374_10628972 3300013296 Bacteria 1084
234 Ga0157378_10002094 3300013297 Bacteria 17820
235 Ga0157378_10055301 3300013297 Bacteria 3535
236 Ga0163162_10077454 3300013306 Bacteria 3389
237 Ga0157375_10264081 3300013308 Bacteria 1883
238 Ga0163163_10260147 3300014325 Bacteria 1786
239 Ga0157377_10135642 3300014745 Bacteria 1508
240 Ga0157379_10031503 3300014968 Bacteria 4724
241 Ga0157379_10067888 3300014968 Bacteria 3188
242 Ga0157376_10010266 3300014969 Bacteria 6838
243 Ga0157376_10036329 3300014969 Bacteria 3991
244 Ga0163161_10014997 3300017792 Bacteria 5399
245 Ga0207697_10057634 3300025315 Bacteria 1612
246 Ga0207682_10051913 3300025893 Bacteria 1699
247 Ga0207682_10204669 3300025893 Bacteria 909
248 Ga0207642_10002369 3300025899 Bacteria 5867
249 Ga0207642_10003563 3300025899 Bacteria 4935
250 Ga0207642_10018405 3300025899 Bacteria 2680
251 Ga0207688_10039269 3300025901 Bacteria 2629
252 Ga0207688_10099639 3300025901 Bacteria 1676
253 Ga0207680_10011039 3300025903 Bacteria 4548
254 Ga0207680_10095901 3300025903 Bacteria 1896
255 Ga0207680_10373651 3300025903 Bacteria 1004
256 Ga0207685_10039883 3300025905 Bacteria 1746
257 Ga0207699_10270132 3300025906 Bacteria 1178
258 Ga0207645_10131092 3300025907 Bacteria 1631
259 Ga0207643_10007902 3300025908 Bacteria 5708
260 Ga0207643_10018026 3300025908 Bacteria 3867
261 Ga0207684_10060695 3300025910 Bacteria 3211
262 Ga0207654_10001352 3300025911 Bacteria 13006
263 Ga0207654_10022750 3300025911 Bacteria 3348
264 Ga0207654_10093253 3300025911 Bacteria 1841
265 Ga0207707_10005007 3300025912 Bacteria 11639
266 Ga0207707_10005308 3300025912 Bacteria 11258
267 Ga0207695_10073003 3300025913 Bacteria 3498
268 Ga0207671_10445958 3300025914 Bacteria 1031
269 Ga0207693_10000070 3300025915 Bacteria 90057
270 Ga0207693_10012380 3300025915 Bacteria 6891
271 Ga0207663_10054072 3300025916 Bacteria 2512
272 Ga0207663_10169077 3300025916 Bacteria 1551
273 Ga0207663_10303992 3300025916 Bacteria 1193
274 Ga0207660_10006325 3300025917 Bacteria 7677
275 Ga0207660_10018761 3300025917 Bacteria 4617
276 Ga0207660_10030677 3300025917 Bacteria 3696
277 Ga0207662_10000347 3300025918 Bacteria 20979
278 Ga0207662_10010767 3300025918 Bacteria 5056
279 Ga0207662_10106473 3300025918 Bacteria 1744
280 Ga0207662_10172028 3300025918 Bacteria 1389
281 Ga0207662_10306838 3300025918 Bacteria 1056
282 Ga0207657_10006160 3300025919 Bacteria 12468
283 Ga0207649_10144551 3300025920 Bacteria 1631
284 Ga0207652_10009608 3300025921 Bacteria 7780
285 Ga0207652_10034629 3300025921 Bacteria 4257
286 Ga0207646_10107547 3300025922 Bacteria 2502
287 Ga0207681_10056076 3300025923 Bacteria 2686
288 Ga0207681_10161954 3300025923 Bacteria 1687
289 Ga0207694_10109388 3300025924 Bacteria 2197
290 Ga0207650_10120240 3300025925 Bacteria 2044
291 Ga0207650_10260606 3300025925 Bacteria 1406
292 Ga0207659_10118874 3300025926 Bacteria 2022
293 Ga0207687_10003929 3300025927 Bacteria 9958
294 Ga0207687_10004204 3300025927 Bacteria 9630
295 Ga0207687_10075472 3300025927 Bacteria 2420
296 Ga0207687_10199297 3300025927 Bacteria 1563
297 Ga0207700_10008288 3300025928 Bacteria 6424
298 Ga0207700_10134915 3300025928 Bacteria 2020
299 Ga0207664_10001186 3300025929 Bacteria 17334
300 Ga0207644_10082033 3300025931 Bacteria 2384
301 Ga0207644_10091563 3300025931 Bacteria 2267
302 Ga0207690_10145576 3300025932 Bacteria 1751
303 Ga0207706_10011317 3300025933 Bacteria 8130
304 Ga0207686_10000520 3300025934 Bacteria 24908
305 Ga0207686_10000948 3300025934 Bacteria 17305
306 Ga0207686_10038187 3300025934 Bacteria 2904
307 Ga0207709_10000485 3300025935 Bacteria 36221
308 Ga0207709_10022066 3300025935 Bacteria 3609
309 Ga0207670_10001310 3300025936 Bacteria 13144
310 Ga0207669_10033274 3300025937 Bacteria 2907
311 Ga0207669_10096135 3300025937 Bacteria 1943
312 Ga0207704_10007350 3300025938 Bacteria 5198
313 Ga0207704_10015942 3300025938 Bacteria 3846
314 Ga0207704_10033420 3300025938 Bacteria 2924
315 Ga0207665_10023237 3300025939 Bacteria 4084
316 Ga0207665_10092907 3300025939 Bacteria 2094
317 Ga0207691_10060007 3300025940 Bacteria 3457
318 Ga0207711_10106387 3300025941 Bacteria 2489
319 Ga0207711_10174694 3300025941 Bacteria 1951
320 Ga0207711_10228616 3300025941 Bacteria 1703
321 Ga0207689_10000488 3300025942 Bacteria 37483
322 Ga0207689_10023643 3300025942 Bacteria 5153
323 Ga0207661_10039572 3300025944 Bacteria 3701
324 Ga0207679_10305244 3300025945 Bacteria 1373
325 Ga0207667_10015843 3300025949 Bacteria 8544
326 Ga0207667_10077947 3300025949 Bacteria 3435
327 Ga0207651_10083401 3300025960 Bacteria 2311
328 Ga0207651_10137349 3300025960 Bacteria 1882
329 Ga0207651_10159913 3300025960 Bacteria 1764
330 Ga0207651_10400981 3300025960 Bacteria 1167
331 Ga0207712_10026339 3300025961 Bacteria 3872
332 Ga0207712_10105753 3300025961 Bacteria 2101
333 Ga0207712_10458829 3300025961 Bacteria 1082
334 Ga0207668_10184849 3300025972 Bacteria 1647
335 Ga0207640_10005235 3300025981 Bacteria 7061
336 Ga0207640_10101706 3300025981 Bacteria 2017
337 Ga0207658_10199489 3300025986 Bacteria 1669
338 Ga0207677_10017567 3300026023 Bacteria 4270
339 Ga0207703_10006801 3300026035 Bacteria 9113
340 Ga0207703_10039579 3300026035 Bacteria 3767
341 Ga0207703_10087743 3300026035 Bacteria 2609
342 Ga0207639_10331696 3300026041 Bacteria 1354
343 Ga0207678_10083592 3300026067 Bacteria 2731
344 Ga0207678_10358845 3300026067 Bacteria 1257
345 Ga0207708_10001062 3300026075 Bacteria 20593
346 Ga0207702_10016430 3300026078 Bacteria 6127
347 Ga0207702_10027177 3300026078 Bacteria 4751
348 Ga0207702_10320462 3300026078 Bacteria 1476
349 Ga0207641_10007815 3300026088 Bacteria 8880
350 Ga0207641_10051352 3300026088 Bacteria 3491
351 Ga0207641_10087693 3300026088 Bacteria 2715
352 Ga0207641_10165371 3300026088 Bacteria 2014
353 Ga0207641_10553107 3300026088 Bacteria 1122
354 Ga0207648_10000361 3300026089 Bacteria 50161
355 Ga0207648_10020688 3300026089 Bacteria 5923
356 Ga0207676_10013342 3300026095 Bacteria 5902
357 Ga0207676_10086918 3300026095 Bacteria 2555
358 Ga0207676_10331040 3300026095 Bacteria 1401
359 Ga0207674_10008147 3300026116 Bacteria 12150
360 Ga0207674_10339655 3300026116 Bacteria 1452
361 Ga0207675_100000316 3300026118 Bacteria 46037
362 Ga0207683_10000503 3300026121 Bacteria 36106
363 Ga0207683_10014173 3300026121 Bacteria 6792
364 Ga0207698_10063982 3300026142 Bacteria 2881
365 Ga0207698_10620984 3300026142 Bacteria 1068
366 Ga0210000_1001882 3300027462 Bacteria 2964
367 Ga0209588_1053303 3300027671 Bacteria 1308
368 Ga0209971_1027775 3300027682 Bacteria 1353
369 Ga0207428_10000679 3300027907 Bacteria 39859
370 Ga0207428_10001263 3300027907 Bacteria 27090
371 Ga0207428_10084116 3300027907 Bacteria 2480
372 Ga0207428_10139280 3300027907 Bacteria 1853
373 Ga0268265_10002823 3300028380 Bacteria 12777
374 Ga0268265_10706579 3300028380 Bacteria 974
375 Ga0268264_10007460 3300028381 Bacteria 9127
376 Ga0268264_10029236 3300028381 Bacteria 4512
377 Ga0268264_10064334 3300028381 Bacteria 3086
378 Ga0268264_10124768 3300028381 Bacteria 2274
379 Ga0307515_10057131 3300028794 Bacteria 5654
380 Ga0307408_100044567 3300031548 Bacteria 3162
381 Ga0307408_100214053 3300031548 Bacteria 1568
382 Ga0307405_10136042 3300031731 Bacteria 1706
383 Ga0307412_10353103 3300031911 Bacteria 1181
384 Ga0307412_10402784 3300031911 Bacteria 1114
385 Ga0307416_100033779 3300032002 Bacteria 3883
386 Ga0307416_100318801 3300032002 Bacteria 1555
387 Ga0307415_100290683 3300032126 Bacteria 1349
388 Ga0307415_100512658 3300032126 Bacteria 1051
389 Ga0373926_0001218 3300035083 Bacteria 7730
390 Ga0373926_0128080 3300035083 Bacteria 960
391 Ga0373928_0043334 3300035084 Bacteria 1041
392 Ga0373940_0093452 3300035088 Bacteria 904
393 Ga0373944_0032289 3300035089 Bacteria 1580
394 Ga0373944_0032870 3300035089 Bacteria 1569
395 Ga0373949_0028304 3300035090 Bacteria 1322
396 Ga0373951_0006474 3300035091 Bacteria 2679
397 Ga0373952_0007785 3300035092 Bacteria 2018
398 Ga0373932_0009165 3300035112 Bacteria 2376
399 Ga0373936_0024892 3300035113 Bacteria 2339
400 Ga0373936_0091616 3300035113 Bacteria 1275
401 Ga0373936_0128343 3300035113 Bacteria 1088
402 Ga0373939_0003659 3300035114 Bacteria 3619
403 Ga0373939_0140549 3300035114 Bacteria 870
404 Ga0373941_0029067 3300035115 Bacteria 1628
405 Ga0373945_0001462 3300035116 Bacteria 7207
406 Ga0373945_0014320 3300035116 Bacteria 2655
407 Ga0373945_0077406 3300035116 Bacteria 1269
408 Ga0373953_0102318 3300035117 Bacteria 1206
409 Ga0373954_0010094 3300035118 Bacteria 4160
410 Ga0373954_0080465 3300035118 Bacteria 1556
411 Ga0373956_0064428 3300035119 Bacteria 1664
412 Ga0373957_0003702 3300035120 Bacteria 4567
413 Ga0373960_0006085 3300035121 Bacteria 2819
414 Ga0373943_0004090 3300035170 Bacteria 6623
415 Ga0373943_0004457 3300035170 Bacteria 6339
416 Ga0373943_0048389 3300035170 Bacteria 2083
417 Ga0373943_0176658 3300035170 Bacteria 1171
418 Ga0373946_0006405 3300035171 Bacteria 4266
419 Ga0373955_0138709 3300035172 Bacteria 1424
420 Ga0373942_0025883 3300035207 Bacteria 1516
421 Ga0373942_0031584 3300035207 Bacteria 1401
422 Ga0373962_0022800 3300035242 Bacteria 1663
423 Ga0373924_0030351 3300035410 Bacteria 2166
424 Ga0373931_0000320 3300035691 Bacteria 20211
425 Ga0373931_0057053 3300035691 Bacteria 2093
426 Ga0373931_0079871 3300035691 Bacteria 1803
427 Ga0373935_0000976 3300035692 Bacteria 15535
428 Ga0373935_0004965 3300035692 Bacteria 7824
429 Ga0373935_0017872 3300035692 Bacteria 4308
430 Ga0373927_0005507 3300035695 Bacteria 8721
431 Ga0373927_0009262 3300035695 Bacteria 6604
432 Ga0373927_0038989 3300035695 Bacteria 3083
433 Ga0373933_0034790 3300035724 Bacteria 2938
434 Ga0373947_0018280 3300035725 Bacteria 4034
435 Ga0373947_0018513 3300035725 Bacteria 4009
436 Ga0373947_0032504 3300035725 Bacteria 3075
437 Ga0373937_0007823 3300036401 Bacteria 9264
438 Ga0373937_0073389 3300036401 Bacteria 3157
439 Ga0373937_0093586 3300036401 Bacteria 2786
440 Ga0373937_0096628 3300036401 Bacteria 2740
441 Ga0373925_0021067 3300037068 Bacteria 4749
442 Ga0373925_0030730 3300037068 Bacteria 3943
443 Ga0373925_0060196 3300037068 Bacteria 2851
444 Ga0373925_0062294 3300037068 Bacteria 2804
445 Ga0439441_000169 3300042001 Bacteria 5796
446 Ga0439441_002758 3300042001 Bacteria 2508
447 Ga0439456_028046 3300042013 Bacteria 1201
448 Ga0439435_0000647 3300042436 Bacteria 5727
449 Ga0439435_0013204 3300042436 Bacteria 2015
450 Ga0439460_0010415 3300042461 Bacteria 2378
451 Ga0451577_0033311 3300042876 Bacteria 4644
452 Ga0451577_0053894 3300042876 Bacteria 3590
453 Ga0453683_0028149 3300044673 Bacteria 3560
454 Ga0466957_0108258 3300044842 Bacteria 1760
455 Ga0451576_0002782 3300045051 Bacteria 25257
456 Ga0451576_0008778 3300045051 Bacteria 11824
457 Ga0451576_0044724 3300045051 Bacteria 4665
458 Ga0451576_0072494 3300045051 Bacteria 3584
459 Ga0451576_0170123 3300045051 Bacteria 2274
460 Ga0451576_0297186 3300045051 Bacteria 1688
461 Ga0466967_0004104 3300045976 Bacteria 9731
462 Ga0495592_0001493 3300046454 Bacteria 16284
463 Ga0495592_0068400 3300046454 Bacteria 2593
464 Ga0495603_0041453 3300046455 Bacteria 2753
465 Ga0495603_0338241 3300046455 Bacteria 864
466 Ga0495629_0031121 3300046459 Bacteria 3779
467 Ga0495580_0009081 3300046472 Bacteria 7839
468 Ga0495580_0107286 3300046472 Bacteria 1939
469 Ga0495639_0081068 3300046475 Bacteria 1511
470 Ga0495664_0053529 3300046477 Bacteria 2400
471 Ga0495594_0265152 3300046499 Bacteria 978
472 Ga0495608_0002230 3300046511 Bacteria 13989
473 Ga0495618_0016244 3300046514 Bacteria 4551
474 Ga0495628_0000532 3300046516 Bacteria 34861
475 Ga0495666_0055507 3300046526 Bacteria 1898
476 Ga0495642_0043119 3300046528 Bacteria 1840
477 Ga0495665_0046703 3300046531 Bacteria 2298
478 Ga0495665_0127050 3300046531 Bacteria 1335
479 Ga0495586_0004128 3300046535 Bacteria 7782
480 Ga0495587_0068444 3300046536 Bacteria 2068
481 Ga0495621_0038456 3300046539 Bacteria 1669
482 Ga0495645_0004307 3300046543 Bacteria 9722
483 Ga0495622_0080296 3300046557 Bacteria 1501
484 Ga0495667_0006039 3300046559 Bacteria 8197
485 Ga0495634_0002477 3300046642 Bacteria 15325
486 Ga0495635_0011578 3300046663 Bacteria 6183
487 Ga0495635_0239883 3300046663 Bacteria 1223
488 Ga0495588_0005471 3300046674 Bacteria 5654
489 Ga0495599_0021534 3300046678 Bacteria 4023
490 Ga0495647_0002025 3300046681 Bacteria 6333
491 Ga0495658_0001264 3300046683 Bacteria 13289
492 Ga0495658_0008954 3300046683 Bacteria 4976
493 Ga0495658_0233215 3300046683 Bacteria 1154
494 Ga0495669_0001394 3300046684 Bacteria 9963
495 Ga0495669_0122472 3300046684 Bacteria 1220
496 Ga0495613_0026742 3300046689 Bacteria 4297
497 Ga0495613_0035870 3300046689 Bacteria 3678
498 Ga0495600_0081825 3300046809 Bacteria 2107
499 Ga0495600_0114240 3300046809 Bacteria 1758
500 Ga0495581_0000535 3300047315 Bacteria 19542
501 Ga0495581_0025443 3300047315 Bacteria 3432
502 Ga0495604_0412509 3300047317 Bacteria 888
503 Ga0495636_0000950 3300047318 Bacteria 10813
504 Ga0495676_0284560 3300047321 Bacteria 1119
505 Ga0495680_0006339 3300047322 Bacteria 11010
506 Ga0495675_0184005 3300047444 Bacteria 1278
507 Ga0495684_0006061 3300047471 Bacteria 9398
508 Ga0495684_0257184 3300047471 Bacteria 1268
509 Ga0495593_0180413 3300047673 Bacteria 1063
510 Ga0496102_0187896 3300048905 Bacteria 1947
511 Ga0496104_0026574 3300048907 Bacteria 5348
512 Ga0496106_0294030 3300048909 Bacteria 1302
513 Ga0496109_0614870 3300048912 Bacteria 1023
514 Ga0496110_0993091 3300048913 Bacteria 747
515 Ga0496114_0169025 3300048917 Bacteria 1905
516 Ga0496114_0391479 3300048917 Unclassified 1231
517 Ga0501036_0070002 3300049572 Bacteria 2966
518 Ga0501036_0173682 3300049572 Bacteria 1815
519 Ga0501038_0071614 3300049574 Bacteria 2940
520 Ga0501039_0048840 3300049575 Bacteria 3271
521 Ga0501040_0095560 3300049576 Bacteria 2068
522 Ga0501041_0011840 3300049577 Bacteria 5162
523 Ga0501068_0000852 3300049584 Bacteria 15889
524 Ga0501069_0242846 3300049585 Bacteria 1050
525 Ga0501072_0051803 3300049588 Bacteria 3232
526 Ga0501073_0124465 3300049589 Bacteria 1787
527 Ga0501075_0101335 3300049591 Bacteria 2187
528 Ga0501077_0108454 3300049593 Bacteria 1759
529 Ga0501045_0021917 3300049824 Bacteria 4572
530 nmdc:mga0k408_18187_c1 3300050493 Bacteria 3921
531 nmdc:mga0k408_26289_c1 3300050493 Bacteria 3299
532 nmdc:mga05p37_2617_c1 3300050507 Bacteria 20946
533 nmdc:mga05p37_5315_c1 3300050507 Bacteria 15118
534 nmdc:mga09592_10_c1 3300050508 Bacteria 106937
535 nmdc:mga09592_125123_c1 3300050508 Bacteria 2210
536 nmdc:mga09592_301_c1 3300050508 Bacteria 35907
537 nmdc:mga0qj67_140172_c1 3300050509 Bacteria 1960
538 nmdc:mga0qj67_43266_c1 3300050509 Bacteria 3547
539 nmdc:mga0qj67_84922_c1 3300050509 Bacteria 2539
540 nmdc:mga06r32_31271_c1 3300050510 Bacteria 4998
541 nmdc:mga06r32_391768_c1 3300050510 Bacteria 1372
542 nmdc:mga08y16_29351_c1 3300050511 Bacteria 5795
543 nmdc:mga08y16_546396_c1 3300050511 Bacteria 1173
544 nmdc:mga08y16_63092_c1 3300050511 Bacteria 3869
545 nmdc:mga08y16_91454_c1 3300050511 Bacteria 3171
546 nmdc:mga0n895_1887_c1 3300050512 Bacteria 16030
547 nmdc:mga0n895_31954_c1 3300050512 Bacteria 5047
548 nmdc:mga0n895_46_c1 3300050512 Bacteria 73853
549 nmdc:mga0n895_482941_c1 3300050512 Bacteria 1249
550 nmdc:mga0n895_57856_c1 3300050512 Bacteria 3822
551 nmdc:mga0rr50_150_c1 3300050513 Bacteria 38355
552 nmdc:mga0rr50_186241_c1 3300050513 Bacteria 1699
553 nmdc:mga0rr50_402143_c1 3300050513 Bacteria 1157
554 nmdc:mga0rr50_5774_c1 3300050513 Bacteria 7428
555 nmdc:mga0rr50_95183_c1 3300050513 Bacteria 2327
556 nmdc:mga08x19_3306_c1 3300050514 Bacteria 9633
557 nmdc:mga0a205_117719_c1 3300050515 Bacteria 2555
558 nmdc:mga0a205_16538_c1 3300050515 Bacteria 6910
559 nmdc:mga0a205_388021_c1 3300050515 Bacteria 1261
560 nmdc:mga0a205_49672_c1 3300050515 Bacteria 4050
561 Ga0495601_0029523 3300053077 Bacteria 3402
562 Ga0495619_0007995 3300053085 Bacteria 6693
563 Ga0501084_0627638 3300054114 Bacteria 907
564 2998346584 2998344455 Bacteria 4222996
565 Ga0075430_100481891
566 JGI25406J46586_10071428
567 Ga0065715_10127927
568 Ga0070676_10035737
569 Ga0070676_10221643
570 Ga0070676_10261971
571 Ga0070690_100002870
572 Ga0070690_100016969
573 Ga0070690_100022777
574 Ga0070690_100118214
575 Ga0070670_100074389
576 Ga0068869_100002698
577 Ga0068869_100209976
578 Ga0070666_10034199
579 Ga0070680_100003680
580 Ga0070680_100018826
581 Ga0070680_100049774
582 Ga0070682_100011447
583 Ga0070682_100016453
584 Ga0068868_100003486
585 Ga0068868_100045739
586 Ga0068868_100280306
587 Ga0070660_100208652
588 Ga0070689_100004258
589 Ga0070689_100420420
590 Ga0070687_100000018
591 Ga0070687_100029659
592 Ga0070687_100368570
593 Ga0070692_10001631
594 Ga0070692_10009880
595 Ga0070669_100254410
596 Ga0070669_100332712
597 Ga0070675_100187027
598 Ga0070675_100306804
599 Ga0070675_100310564
600 Ga0070671_100011803
601 Ga0070671_100217348
602 Ga0070674_100053226
603 Ga0070673_100421437
604 Ga0070688_100020460
605 Ga0070688_100023819
606 Ga0070709_10019893
607 Ga0070714_100000785
608 Ga0070713_100006452
609 Ga0070713_100011659
610 Ga0070701_10001221
611 Ga0070711_100616235
612 Ga0070705_100003393
613 Ga0070705_100014462
614 Ga0070705_100201151
615 Ga0070705_100442639
616 Ga0070700_100071837
617 Ga0070700_100072633
618 Ga0070700_100181594
619 Ga0070700_100291976
620 Ga0070694_100000229
621 Ga0070694_100046707
622 Ga0070694_100092086
623 Ga0070694_100311456
624 Ga0070708_100236707
625 Ga0070663_100368663
626 Ga0070678_100000773
627 Ga0070678_100134416
628 Ga0070662_100034510
629 Ga0070662_100083115
630 Ga0070681_10000834
631 Ga0070681_10273813
632 Ga0068867_100000577
633 Ga0068867_100303116
634 Ga0070685_10022617
635 Ga0070706_100291213
636 Ga0070707_100072416
637 Ga0070707_100223089
638 Ga0070698_100070223
639 Ga0070699_100044224
640 Ga0070699_100080060
641 Ga0070679_100006374
642 Ga0070679_100646941
643 Ga0070684_100035493
644 Ga0070684_100036623
645 Ga0070697_100006052
646 Ga0068853_100228757
647 Ga0068853_100364344
648 Ga0070672_100089286
649 Ga0070686_100000592
650 Ga0070686_100008122
651 Ga0070686_100255198
652 Ga0070695_100001572
653 Ga0070695_100030352
654 Ga0070695_100055028
655 Ga0070695_100109675
656 Ga0070695_100327551
657 Ga0070696_100004042
658 Ga0070696_100009153
659 Ga0070696_100101396
660 Ga0070696_100104293
661 Ga0070696_100155270
662 Ga0070693_100000136
663 Ga0070693_100000931
664 Ga0070693_100214033
665 Ga0070693_100235393
666 Ga0070693_100480286
667 Ga0070665_100253273
668 Ga0070704_100002022
669 Ga0070704_100097672
670 Ga0070704_100172110
671 Ga0070704_100178440
672 Ga0070704_100188067
673 Ga0068855_100001415
674 Ga0068854_100005240
675 Ga0068854_100007094
676 Ga0068854_100012314
677 Ga0068856_100014600
678 Ga0068856_100076780
679 Ga0068856_100396511
680 Ga0070702_100000129
681 Ga0070702_100009464
682 Ga0070702_100050588
683 Ga0070702_100124701
684 Ga0070702_100158442
685 Ga0070702_100324957
686 Ga0068852_100036441
687 Ga0068859_100004921
688 Ga0068859_100014988
689 Ga0068859_100056936
690 Ga0068859_100165254
691 Ga0068864_100002651
692 Ga0068864_100206614
693 Ga0068866_10003524
694 Ga0068866_10005091
695 Ga0068866_10019895
696 Ga0068861_100001869
697 Ga0068861_100208494
698 Ga0068851_10060593
699 Ga0068870_10007192
700 Ga0068863_100052363
701 Ga0068863_100060886
702 Ga0068863_100185330
703 Ga0068863_100656372
704 Ga0068858_100001230
705 Ga0068858_100046767
706 Ga0068858_100067139
707 Ga0068858_100068289
708 Ga0068860_100007739
709 Ga0068860_100037729
710 Ga0068860_100047588
711 Ga0068862_100001654
712 Ga0081539_10005604
713 Ga0070717_10838864
714 Ga0070715_10087054
715 Ga0070716_100410360
716 Ga0070712_100002535
717 Ga0070712_100260147
718 Ga0075366_10006869
719 Ga0075366_10011146
720 Ga0097621_100000387
721 Ga0097621_100003771
722 Ga0075370_10205322
723 Ga0068871_100000344
724 Ga0068871_100015508
725 Ga0068871_100093061
726 Ga0068871_100186440
727 Ga0075428_100009707
728 Ga0075428_100058560
729 Ga0075428_100180738
730 Ga0075430_100014432
731 Ga0075430_100354313
732 Ga0075431_100019249
733 Ga0075431_100301297
734 Ga0075433_10012156
735 Ga0075433_10072325
736 Ga0075433_10215587
737 Ga0075434_100000066
738 Ga0075434_100001877
739 Ga0075434_100061980
740 Ga0075434_100082187
741 Ga0075434_100669534
742 Ga0075429_100000783
743 Ga0075429_100000863
744 Ga0075429_100658041
745 Ga0068865_100000159
746 Ga0068865_100059726
747 Ga0075436_100000232
748 Ga0075436_100053146
749 Ga0097620_100004921
750 Ga0097620_100014989
751 Ga0097620_100056933
752 Ga0097620_100165248
753 Ga0075435_100001417
754 Ga0075435_100012612
755 Ga0075435_100036897
756 Ga0075435_100374551
757 Ga0075435_100480917
758 Ga0099794_10019340
759 Ga0099794_10147578
760 Ga0099794_10191014
761 Ga0105240_10575123
762 Ga0111539_10031508
763 Ga0111539_10112809
764 Ga0111539_10340190
765 Ga0105245_10002096
766 Ga0105245_10028836
767 Ga0105245_10405720
768 Ga0105247_10007076
769 Ga0114129_10000341
770 Ga0114129_10000823
771 Ga0105243_10000346
772 Ga0105243_10032494
773 Ga0105243_10042059
774 Ga0105241_10043337
775 Ga0105241_10069079
776 Ga0105241_10434091
777 Ga0105242_10000310
778 Ga0105242_10003033
779 Ga0105242_10004136
780 Ga0105242_10099140
781 Ga0105248_10051220
782 Ga0105248_10093463
783 Ga0105237_10021401
784 Ga0105237_10971640
785 Ga0105238_10034965
786 Ga0105249_10045885
787 Ga0105249_10106641
788 Ga0105249_10285973
789 Ga0105239_10205242
790 Ga0105239_10456796
791 Ga0105246_10037203
792 Ga0105246_10086703
793 Ga0157373_10041685
794 Ga0157371_10091313
795 Ga0157370_10009451
796 Ga0157374_10001734
797 Ga0157374_10628972
798 Ga0157378_10002094
799 Ga0157378_10055301
800 Ga0163162_10077454
801 Ga0157375_10264081
802 Ga0163163_10260147
803 Ga0157377_10135642
804 Ga0157379_10031503
805 Ga0157379_10067888
806 Ga0157376_10010266
807 Ga0157376_10036329
808 Ga0163161_10014997
809 Ga0207697_10057634
810 Ga0207682_10051913
811 Ga0207682_10204669
812 Ga0207642_10002369
813 Ga0207642_10003563
814 Ga0207642_10018405
815 Ga0207688_10039269
816 Ga0207688_10099639
817 Ga0207680_10011039
818 Ga0207680_10095901
819 Ga0207680_10373651
820 Ga0207685_10039883
821 Ga0207699_10270132
822 Ga0207645_10131092
823 Ga0207643_10007902
824 Ga0207643_10018026
825 Ga0207684_10060695
826 Ga0207654_10001352
827 Ga0207654_10022750
828 Ga0207654_10093253
829 Ga0207707_10005007
830 Ga0207707_10005308
831 Ga0207695_10073003
832 Ga0207671_10445958
833 Ga0207693_10000070
834 Ga0207693_10012380
835 Ga0207663_10054072
836 Ga0207663_10169077
837 Ga0207663_10303992
838 Ga0207660_10006325
839 Ga0207660_10018761
840 Ga0207660_10030677
841 Ga0207662_10000347
842 Ga0207662_10010767
843 Ga0207662_10106473
844 Ga0207662_10172028
845 Ga0207662_10306838
846 Ga0207657_10006160
847 Ga0207649_10144551
848 Ga0207652_10009608
849 Ga0207652_10034629
850 Ga0207646_10107547
851 Ga0207681_10056076
852 Ga0207681_10161954
853 Ga0207694_10109388
854 Ga0207650_10120240
855 Ga0207650_10260606
856 Ga0207659_10118874
857 Ga0207687_10003929
858 Ga0207687_10004204
859 Ga0207687_10075472
860 Ga0207687_10199297
861 Ga0207700_10008288
862 Ga0207700_10134915
863 Ga0207664_10001186
864 Ga0207644_10082033
865 Ga0207644_10091563
866 Ga0207690_10145576
867 Ga0207706_10011317
868 Ga0207686_10000520
869 Ga0207686_10000948
870 Ga0207686_10038187
871 Ga0207709_10000485
872 Ga0207709_10022066
873 Ga0207670_10001310
874 Ga0207669_10033274
875 Ga0207669_10096135
876 Ga0207704_10007350
877 Ga0207704_10015942
878 Ga0207704_10033420
879 Ga0207665_10023237
880 Ga0207665_10092907
881 Ga0207691_10060007
882 Ga0207711_10106387
883 Ga0207711_10174694
884 Ga0207711_10228616
885 Ga0207689_10000488
886 Ga0207689_10023643
887 Ga0207661_10039572
888 Ga0207679_10305244
889 Ga0207667_10015843
890 Ga0207667_10077947
891 Ga0207651_10083401
892 Ga0207651_10137349
893 Ga0207651_10159913
894 Ga0207651_10400981
895 Ga0207712_10026339
896 Ga0207712_10105753
897 Ga0207712_10458829
898 Ga0207668_10184849
899 Ga0207640_10005235
900 Ga0207640_10101706
901 Ga0207658_10199489
902 Ga0207677_10017567
903 Ga0207703_10006801
904 Ga0207703_10039579
905 Ga0207703_10087743
906 Ga0207639_10331696
907 Ga0207678_10083592
908 Ga0207678_10358845
909 Ga0207708_10001062
910 Ga0207702_10016430
911 Ga0207702_10027177
912 Ga0207702_10320462
913 Ga0207641_10007815
914 Ga0207641_10051352
915 Ga0207641_10087693
916 Ga0207641_10165371
917 Ga0207641_10553107
918 Ga0207648_10000361
919 Ga0207648_10020688
920 Ga0207676_10013342
921 Ga0207676_10086918
922 Ga0207676_10331040
923 Ga0207674_10008147
924 Ga0207674_10339655
925 Ga0207675_100000316
926 Ga0207683_10000503
927 Ga0207683_10014173
928 Ga0207698_10063982
929 Ga0207698_10620984
930 Ga0210000_1001882
931 Ga0209588_1053303
932 Ga0209971_1027775
933 Ga0207428_10000679
934 Ga0207428_10001263
935 Ga0207428_10084116
936 Ga0207428_10139280
937 Ga0268265_10002823
938 Ga0268265_10706579
939 Ga0268264_10007460
940 Ga0268264_10029236
941 Ga0268264_10064334
942 Ga0268264_10124768
943 Ga0307515_10057131
944 Ga0307408_100044567
945 Ga0307408_100214053
946 Ga0307405_10136042
947 Ga0307412_10353103
948 Ga0307412_10402784
949 Ga0307416_100033779
950 Ga0307416_100318801
951 Ga0307415_100290683
952 Ga0307415_100512658
953 Ga0373926_0001218
954 Ga0373926_0128080
955 Ga0373928_0043334
956 Ga0373940_0093452
957 Ga0373944_0032289
958 Ga0373944_0032870
959 Ga0373949_0028304
960 Ga0373951_0006474
961 Ga0373952_0007785
962 Ga0373932_0009165
963 Ga0373936_0024892
964 Ga0373936_0091616
965 Ga0373936_0128343
966 Ga0373939_0003659
967 Ga0373939_0140549
968 Ga0373941_0029067
969 Ga0373945_0001462
970 Ga0373945_0014320
971 Ga0373945_0077406
972 Ga0373953_0102318
973 Ga0373954_0010094
974 Ga0373954_0080465
975 Ga0373956_0064428
976 Ga0373957_0003702
977 Ga0373960_0006085
978 Ga0373943_0004090
979 Ga0373943_0004457
980 Ga0373943_0048389
981 Ga0373943_0176658
982 Ga0373946_0006405
983 Ga0373955_0138709
984 Ga0373942_0025883
985 Ga0373942_0031584
986 Ga0373962_0022800
987 Ga0373924_0030351
988 Ga0373931_0000320
989 Ga0373931_0057053
990 Ga0373931_0079871
991 Ga0373935_0000976
992 Ga0373935_0004965
993 Ga0373935_0017872
994 Ga0373927_0005507
995 Ga0373927_0009262
996 Ga0373927_0038989
997 Ga0373933_0034790
998 Ga0373947_0018280
999 Ga0373947_0018513
1000 Ga0373947_0032504
1001 Ga0373937_0007823
1002 Ga0373937_0073389
1003 Ga0373937_0093586
1004 Ga0373937_0096628
1005 Ga0373925_0021067
1006 Ga0373925_0030730
1007 Ga0373925_0060196
1008 Ga0373925_0062294
1009 Ga0439441_000169
1010 Ga0439441_002758
1011 Ga0439456_028046
1012 Ga0439435_0000647
1013 Ga0439435_0013204
1014 Ga0439460_0010415
1015 Ga0451577_0033311
1016 Ga0451577_0053894
1017 Ga0453683_0028149
1018 Ga0466957_0108258
1019 Ga0451576_0002782
1020 Ga0451576_0008778
1021 Ga0451576_0044724
1022 Ga0451576_0072494
1023 Ga0451576_0170123
1024 Ga0451576_0297186
1025 Ga0466967_0004104
1026 Ga0495592_0001493
1027 Ga0495592_0068400
1028 Ga0495603_0041453
1029 Ga0495603_0338241
1030 Ga0495629_0031121
1031 Ga0495580_0009081
1032 Ga0495580_0107286
1033 Ga0495639_0081068
1034 Ga0495664_0053529
1035 Ga0495594_0265152
1036 Ga0495608_0002230
1037 Ga0495618_0016244
1038 Ga0495628_0000532
1039 Ga0495666_0055507
1040 Ga0495642_0043119
1041 Ga0495665_0046703
1042 Ga0495665_0127050
1043 Ga0495586_0004128
1044 Ga0495587_0068444
1045 Ga0495621_0038456
1046 Ga0495645_0004307
1047 Ga0495622_0080296
1048 Ga0495667_0006039
1049 Ga0495634_0002477
1050 Ga0495635_0011578
1051 Ga0495635_0239883
1052 Ga0495588_0005471
1053 Ga0495599_0021534
1054 Ga0495647_0002025
1055 Ga0495658_0001264
1056 Ga0495658_0008954
1057 Ga0495658_0233215
1058 Ga0495669_0001394
1059 Ga0495669_0122472
1060 Ga0495613_0026742
1061 Ga0495613_0035870
1062 Ga0495600_0081825
1063 Ga0495600_0114240
1064 Ga0495581_0000535
1065 Ga0495581_0025443
1066 Ga0495604_0412509
1067 Ga0495636_0000950
1068 Ga0495676_0284560
1069 Ga0495680_0006339
1070 Ga0495675_0184005
1071 Ga0495684_0006061
1072 Ga0495684_0257184
1073 Ga0495593_0180413
1074 Ga0496102_0187896
1075 Ga0496104_0026574
1076 Ga0496106_0294030
1077 Ga0496109_0614870
1078 Ga0496110_0993091
1079 Ga0496114_0169025
1080 Ga0496114_0391479
1081 Ga0501036_0070002
1082 Ga0501036_0173682
1083 Ga0501038_0071614
1084 Ga0501039_0048840
1085 Ga0501040_0095560
1086 Ga0501041_0011840
1087 Ga0501068_0000852
1088 Ga0501069_0242846
1089 Ga0501072_0051803
1090 Ga0501073_0124465
1091 Ga0501075_0101335
1092 Ga0501077_0108454
1093 Ga0501045_0021917
1094 nmdc:mga0k408_18187_c1
1095 nmdc:mga0k408_26289_c1
1096 nmdc:mga05p37_2617_c1
1097 nmdc:mga05p37_5315_c1
1098 nmdc:mga09592_10_c1
1099 nmdc:mga09592_125123_c1
1100 nmdc:mga09592_301_c1
1101 nmdc:mga0qj67_140172_c1
1102 nmdc:mga0qj67_43266_c1
1103 nmdc:mga0qj67_84922_c1
1104 nmdc:mga06r32_31271_c1
1105 nmdc:mga06r32_391768_c1
1106 nmdc:mga08y16_29351_c1
1107 nmdc:mga08y16_546396_c1
1108 nmdc:mga08y16_63092_c1
1109 nmdc:mga08y16_91454_c1
1110 nmdc:mga0n895_1887_c1
1111 nmdc:mga0n895_31954_c1
1112 nmdc:mga0n895_46_c1
1113 nmdc:mga0n895_482941_c1
1114 nmdc:mga0n895_57856_c1
1115 nmdc:mga0rr50_150_c1
1116 nmdc:mga0rr50_186241_c1
1117 nmdc:mga0rr50_402143_c1
1118 nmdc:mga0rr50_5774_c1
1119 nmdc:mga0rr50_95183_c1
1120 nmdc:mga08x19_3306_c1
1121 nmdc:mga0a205_117719_c1
1122 nmdc:mga0a205_16538_c1
1123 nmdc:mga0a205_388021_c1
1124 nmdc:mga0a205_49672_c1
1125 Ga0495601_0029523
1126 Ga0495619_0007995
1127 Ga0501084_0627638
1128 2998346584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

15

186

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.373 14 237
8t69-assembly1.cif.gz_A human vmat2 in complex with tetrabenazine 0.3692 14 237
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3639 16 231
8d2s-assembly1.cif.gz_A zebrafish mfsd2a isoform b in inward open ligand bound conformation 0.3601 17 228
8d2w-assembly1.cif.gz_A zebrafish mfsd2a isoform b in inward open ligand 2b conformation 0.3557 17 228
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8433 16 179 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7685 16 179 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7365 16 179 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6267 16 179 1.20.1250.20
af_K7KKQ1_1_284_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5101 12 179 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2W4LJ33-F1-model_v4 TerC family protein 0.955 6 236 GO:0016020
AF-A0A537A6I3-F1-model_v4 TerC family protein 0.953 3 190 GO:0016020
AF-A0A537CWK4-F1-model_v4 TerC family protein 0.9494 1 243 GO:0016020
AF-A0A537CWK4-F1-model_v4 TerC family protein 0.9381 1 243 GO:0016020
AF-A0A6J4MQ55-F1-model_v4 Membrane protein TerC, possibly involved in tellurium resistance 0.9352 2 235 GO:0016020

Map