F464083

General Info

Members Datasets Scaffolds Average Seq Length
563 245 563 223

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0016330|Ga0466959_0016330_4473_5252
Length 259
Sequence MNPAQAAAGGASGRPRIGHSAAVPASTIRGARHPHRSWSEIVIERVHVIGSGRVGSAVAARLRERGVXXXVDDPDVVLLCVPDTAIADVSRCLTPGRAWVGHVSGATPLAALEPHERRFSLHPLQTFDRSGDPAQFDGAWAAVSGETDDALAIARELAEILGLQPFELADEDRTLYHAGAVFASNYLVTLERAAVRLGVPAEALVPLMTRTIENGFDLTGPIARGDWATVEAHKRAIHEAQPELEHLYETLAGATVALR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.88
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10010313 3300005327 Bacteria 7498
2 Ga0070658_10016021 3300005327 Bacteria 5996
3 Ga0070683_100041457 3300005329 Bacteria 4235
4 Ga0070683_100192959 3300005329 Bacteria 1934
5 Ga0070683_100193260 3300005329 Bacteria 1933
6 Ga0070670_100377520 3300005331 Unclassified 1248
7 Ga0070677_10351284 3300005333 Bacteria 764
8 Ga0070680_100332000 3300005336 Bacteria 1291
9 Ga0070682_100121089 3300005337 Bacteria 1757
10 Ga0070682_100209279 3300005337 Bacteria 1381
11 Ga0068868_100004283 3300005338 Bacteria 9991
12 Ga0068868_100257198 3300005338 Unclassified 1471
13 Ga0070660_100061865 3300005339 Bacteria 2907
14 Ga0070660_100141658 3300005339 Bacteria 1929
15 Ga0070660_100195937 3300005339 Bacteria 1637
16 Ga0070660_100438926 3300005339 Bacteria 1082
17 Ga0070689_100065489 3300005340 Bacteria 2830
18 Ga0070687_100367966 3300005343 Bacteria 933
19 Ga0070661_100581575 3300005344 Bacteria 904
20 Ga0070668_100139945 3300005347 Bacteria 1949
21 Ga0070668_100771013 3300005347 Bacteria 853
22 Ga0070671_100174569 3300005355 Bacteria 1818
23 Ga0070671_100287221 3300005355 Bacteria 1400
24 Ga0070714_100014293 3300005435 Bacteria 6374
25 Ga0070714_100060585 3300005435 Bacteria 3248
26 Ga0070714_100063992 3300005435 Bacteria 3165
27 Ga0070714_100528531 3300005435 Bacteria 1127
28 Ga0070710_10006454 3300005437 Bacteria 5636
29 Ga0070710_10174144 3300005437 Bacteria 1343
30 Ga0070710_10417852 3300005437 Bacteria 902
31 Ga0070701_10167403 3300005438 Unclassified 1277
32 Ga0070711_100002087 3300005439 Bacteria 11293
33 Ga0070705_100432741 3300005440 Archaea 982
34 Ga0070700_100091121 3300005441 Unclassified 1989
35 Ga0070694_100070587 3300005444 Bacteria 2405
36 Ga0070663_100184932 3300005455 Unclassified 1619
37 Ga0070678_100045254 3300005456 Bacteria 3147
38 Ga0070662_100136356 3300005457 Bacteria 1898
39 Ga0070662_100261048 3300005457 Bacteria 1395
40 Ga0070681_10302969 3300005458 Bacteria 1507
41 Ga0068867_100034920 3300005459 Bacteria 3646
42 Ga0070707_100001529 3300005468 Bacteria 22508
43 Ga0070679_100036800 3300005530 Bacteria 4857
44 Ga0070679_100079858 3300005530 Bacteria 3261
45 Ga0070679_100157019 3300005530 Unclassified 2249
46 Ga0070679_100270707 3300005530 Bacteria 1653
47 Ga0070684_100382847 3300005535 Bacteria 1296
48 Ga0070697_100337964 3300005536 Bacteria 1299
49 Ga0068853_100099945 3300005539 Bacteria 2563
50 Ga0068853_100472522 3300005539 Bacteria 1181
51 Ga0070686_100102752 3300005544 Bacteria 1933
52 Ga0070695_100000393 3300005545 Bacteria 22683
53 Ga0070696_100207395 3300005546 Bacteria 1466
54 Ga0070693_100116362 3300005547 Unclassified 1652
55 Ga0070704_100365573 3300005549 Unclassified 1222
56 Ga0068855_100040162 3300005563 Bacteria 5554
57 Ga0070664_100618136 3300005564 Bacteria 1006
58 Ga0068857_100583235 3300005577 Bacteria 1055
59 Ga0068854_100253198 3300005578 Bacteria 1407
60 Ga0068856_100067085 3300005614 Bacteria 3545
61 Ga0068859_100480103 3300005617 Archaea 1338
62 Ga0068864_100241633 3300005618 Bacteria 1673
63 Ga0068861_100197183 3300005719 Bacteria 1687
64 Ga0068870_10116039 3300005840 Unclassified 1535
65 Ga0068870_10563988 3300005840 Unclassified 769
66 Ga0068863_100206049 3300005841 Bacteria 1893
67 Ga0068858_100118152 3300005842 Bacteria 2479
68 Ga0068860_100635763 3300005843 Bacteria 1074
69 Ga0081539_10000452 3300005985 Bacteria 87416
70 Ga0070717_10020080 3300006028 Bacteria 5250
71 Ga0070717_10035780 3300006028 Bacteria 4023
72 Ga0070717_10050261 3300006028 Bacteria 3425
73 Ga0075432_10117033 3300006058 Bacteria 998
74 Ga0070715_10008398 3300006163 Bacteria 3596
75 Ga0070716_100033263 3300006173 Bacteria 2818
76 Ga0068871_100064871 3300006358 Bacteria 2990
77 Ga0075434_100004162 3300006871 Bacteria 12965
78 Ga0068865_100159879 3300006881 Bacteria 1717
79 Ga0068865_100161828 3300006881 Bacteria 1708
80 Ga0097620_100480106 3300006931 Archaea 1338
81 Ga0097620_101017534 3300006931 Bacteria 910
82 Ga0105240_10080227 3300009093 Bacteria 4014
83 Ga0111539_10129457 3300009094 Bacteria 2955
84 Ga0111539_10417988 3300009094 Bacteria 1562
85 Ga0111539_10435949 3300009094 Bacteria 1526
86 Ga0105245_10116191 3300009098 Bacteria 2495
87 Ga0105245_10126474 3300009098 Bacteria 2393
88 Ga0105245_10159326 3300009098 Bacteria 2140
89 Ga0105245_10460277 3300009098 Bacteria 1282
90 Ga0105243_10064215 3300009148 Bacteria 2945
91 Ga0105243_10298539 3300009148 Bacteria 1459
92 Ga0105242_10036840 3300009176 Bacteria 3927
93 Ga0105248_10052290 3300009177 Bacteria 4584
94 Ga0105248_10172047 3300009177 Bacteria 2441
95 Ga0105248_11150368 3300009177 Unclassified 877
96 Ga0105237_10026012 3300009545 Bacteria 5982
97 Ga0105238_10456885 3300009551 Unclassified 1274
98 Ga0105249_10318177 3300009553 Bacteria 1567
99 Ga0105239_10205963 3300010375 Bacteria 2204
100 Ga0157371_10040626 3300013102 Bacteria 3321
101 Ga0157369_10421336 3300013105 Bacteria 1384
102 Ga0157374_10057521 3300013296 Bacteria 3632
103 Ga0157374_10161448 3300013296 Bacteria 2183
104 Ga0157378_10333925 3300013297 Bacteria 1476
105 Ga0163162_10200975 3300013306 Bacteria 2122
106 Ga0157372_10010768 3300013307 Bacteria 9736
107 Ga0157372_10021043 3300013307 Bacteria 7044
108 Ga0157372_10024334 3300013307 Bacteria 6576
109 Ga0157372_10040888 3300013307 Bacteria 5124
110 Ga0157372_10316420 3300013307 Bacteria 1817
111 Ga0157372_10538827 3300013307 Bacteria 1361
112 Ga0157372_10857721 3300013307 Bacteria 1054
113 Ga0157375_10361331 3300013308 Bacteria 1618
114 Ga0163163_10472068 3300014325 Bacteria 1315
115 Ga0182008_10130111 3300014497 Bacteria 1255
116 Ga0157379_10122474 3300014968 Bacteria 2340
117 Ga0206354_11692940 3300020081 Bacteria 1097
118 Ga0224712_10009473 3300022467 Bacteria 2937
119 Ga0207692_10016984 3300025898 Bacteria 3236
120 Ga0207692_10129437 3300025898 Bacteria 1423
121 Ga0207692_10467422 3300025898 Bacteria 796
122 Ga0207685_10038831 3300025905 Bacteria 1763
123 Ga0207645_10058818 3300025907 Bacteria 2454
124 Ga0207643_10010675 3300025908 Bacteria 4950
125 Ga0207643_10153494 3300025908 Archaea 1382
126 Ga0207695_10171399 3300025913 Bacteria 2096
127 Ga0207693_10000222 3300025915 Bacteria 51803
128 Ga0207693_10000964 3300025915 Bacteria 25831
129 Ga0207693_10496888 3300025915 Unclassified 952
130 Ga0207663_10316814 3300025916 Bacteria 1171
131 Ga0207662_10030248 3300025918 Bacteria 3141
132 Ga0207657_10007527 3300025919 Bacteria 11158
133 Ga0207657_10029136 3300025919 Bacteria 5029
134 Ga0207657_10118569 3300025919 Bacteria 2179
135 Ga0207652_10053007 3300025921 Bacteria 3483
136 Ga0207646_10044724 3300025922 Bacteria 3974
137 Ga0207646_10368398 3300025922 Bacteria 1298
138 Ga0207694_10590108 3300025924 Bacteria 934
139 Ga0207659_10048518 3300025926 Bacteria 3008
140 Ga0207687_10085999 3300025927 Bacteria 2282
141 Ga0207687_10194538 3300025927 Bacteria 1581
142 Ga0207664_10011283 3300025929 Bacteria 6339
143 Ga0207664_10273897 3300025929 Unclassified 1479
144 Ga0207644_10117838 3300025931 Bacteria 2017
145 Ga0207690_10073400 3300025932 Bacteria 2366
146 Ga0207706_10038724 3300025933 Bacteria 4229
147 Ga0207706_10061709 3300025933 Bacteria 3301
148 Ga0207686_10241583 3300025934 Bacteria 1314
149 Ga0207704_10050240 3300025938 Bacteria 2514
150 Ga0207665_10001958 3300025939 Bacteria 13849
151 Ga0207665_10229542 3300025939 Unclassified 1364
152 Ga0207691_10027573 3300025940 Bacteria 5324
153 Ga0207689_10235375 3300025942 Bacteria 1514
154 Ga0207679_10159838 3300025945 Bacteria 1844
155 Ga0207651_10069472 3300025960 Bacteria 2487
156 Ga0207668_10168626 3300025972 Bacteria 1715
157 Ga0207640_10210709 3300025981 Bacteria 1480
158 Ga0207640_10758419 3300025981 Bacteria 837
159 Ga0207677_10288921 3300026023 Bacteria 1349
160 Ga0207703_10341391 3300026035 Unclassified 1376
161 Ga0207678_10147770 3300026067 Bacteria 2006
162 Ga0207678_10223209 3300026067 Bacteria 1613
163 Ga0207678_10465517 3300026067 Archaea 1100
164 Ga0207678_10560765 3300026067 Unclassified 999
165 Ga0207708_10020388 3300026075 Bacteria 5000
166 Ga0207708_10676558 3300026075 Bacteria 880
167 Ga0207641_10282139 3300026088 Bacteria 1563
168 Ga0207674_10020017 3300026116 Bacteria 7239
169 Ga0207683_10156570 3300026121 Bacteria 2058
170 Ga0207428_10219443 3300027907 Unclassified 1426
171 Ga0207428_10228593 3300027907 Bacteria 1393
172 Ga0265318_10005350 3300028577 Bacteria 6032
173 Ga0265338_10016515 3300028800 Bacteria 8024
174 Ga0265338_10194858 3300028800 Bacteria 1532
175 Ga0265324_10052628 3300029957 Bacteria 1398
176 Ga0265320_10021603 3300031240 Bacteria 3458
177 Ga0373959_0027481 3300034820 Unclassified 1131
178 Ga0373939_0112090 3300035114 Unclassified 951
179 Ga0373955_0072758 3300035172 Bacteria 1926
180 Ga0373931_0057328 3300035691 Bacteria 2089
181 Ga0373933_0034837 3300035724 Bacteria 2937
182 Ga0373947_0162612 3300035725 Bacteria 1445
183 Ga0373937_0003744 3300036401 Bacteria 12853
184 Ga0373937_0097838 3300036401 Bacteria 2722
185 Ga0395900_0503700 3300037418 Bacteria 1161
186 Ga0395900_0765882 3300037418 Bacteria 895
187 Ga0395898_0196217 3300037466 Bacteria 1928
188 Ga0242420_066492 3300038996 Unclassified 727
189 Ga0436360_0135256 3300039438 Bacteria 6477
190 Ga0451853_0860905 3300041512 Bacteria 971
191 Ga0439458_0148239 3300042157 Bacteria 628
192 Ga0466969_0000637 3300044656 Bacteria 18936
193 Ga0466969_0039771 3300044656 Bacteria 2360
194 Ga0466965_0080819 3300044683 Bacteria 1643
195 Ga0466965_0087826 3300044683 Bacteria 1578
196 Ga0466966_0013112 3300044684 Bacteria 5487
197 Ga0466961_0010766 3300044693 Bacteria 5843
198 Ga0466961_0045910 3300044693 Bacteria 2795
199 Ga0466961_0248080 3300044693 Bacteria 1093
200 Ga0466963_0012929 3300044694 Bacteria 5116
201 Ga0466963_0015084 3300044694 Bacteria 4777
202 Ga0466963_0020542 3300044694 Bacteria 4152
203 Ga0466963_0073392 3300044694 Bacteria 2306
204 Ga0466963_0083865 3300044694 Bacteria 2161
205 Ga0466963_0176794 3300044694 Bacteria 1489
206 Ga0466964_0003548 3300044706 Bacteria 5699
207 Ga0466964_0009930 3300044706 Unclassified 3586
208 Ga0466964_0010506 3300044706 Bacteria 3492
209 Ga0466964_0010904 3300044706 Bacteria 3434
210 Ga0466964_0014950 3300044706 Bacteria 2956
211 Ga0466964_0015067 3300044706 Bacteria 2944
212 Ga0466964_0015472 3300044706 Bacteria 2904
213 Ga0466971_0013046 3300044719 Bacteria 3645
214 Ga0466971_0023427 3300044719 Bacteria 2752
215 Ga0466971_0035497 3300044719 Bacteria 2235
216 Ga0466971_0176297 3300044719 Bacteria 1004
217 Ga0466968_0001416 3300044735 Bacteria 8599
218 Ga0466968_0007287 3300044735 Bacteria 4203
219 Ga0466968_0011733 3300044735 Bacteria 3418
220 Ga0466968_0028113 3300044735 Bacteria 2318
221 Ga0466968_0052029 3300044735 Bacteria 1751
222 Ga0466968_0189179 3300044735 Bacteria 960
223 Ga0466970_0005839 3300044765 Bacteria 6128
224 Ga0466970_0084493 3300044765 Bacteria 1718
225 Ga0466970_0170980 3300044765 Bacteria 1204
226 Ga0466970_0242525 3300044765 Bacteria 1009
227 Ga0466957_0007567 3300044842 Bacteria 6140
228 Ga0466957_0010736 3300044842 Bacteria 5266
229 Ga0466957_0036525 3300044842 Bacteria 2954
230 Ga0466957_0070261 3300044842 Bacteria 2163
231 Ga0466957_0096056 3300044842 Bacteria 1862
232 Ga0466957_0140205 3300044842 Bacteria 1557
233 Ga0466959_0002503 3300045049 Bacteria 11770
234 Ga0466959_0009993 3300045049 Bacteria 6762
235 Ga0466959_0016330 3300045049 Bacteria 5423
236 Ga0466959_0033624 3300045049 Bacteria 3792
237 Ga0466959_0040433 3300045049 Bacteria 3444
238 Ga0466958_0001766 3300045836 Bacteria 10466
239 Ga0466958_0004817 3300045836 Bacteria 7181
240 Ga0466958_0006747 3300045836 Bacteria 6268
241 Ga0466958_0010503 3300045836 Bacteria 5187
242 Ga0466958_0040015 3300045836 Bacteria 2817
243 Ga0466958_0121933 3300045836 Bacteria 1633
244 Ga0466958_0145518 3300045836 Bacteria 1493
245 Ga0466958_0310712 3300045836 Bacteria 1012
246 Ga0466967_0002062 3300045976 Bacteria 12283
247 Ga0466967_0008127 3300045976 Bacteria 7657
248 Ga0466967_0020238 3300045976 Bacteria 5373
249 Ga0466967_0041042 3300045976 Bacteria 3986
250 Ga0466967_0044450 3300045976 Bacteria 3853
251 Ga0466967_0046505 3300045976 Bacteria 3779
252 Ga0466967_0061147 3300045976 Bacteria 3340
253 Ga0466967_0076473 3300045976 Unclassified 3011
254 Ga0466967_0192833 3300045976 Bacteria 1926
255 Ga0466967_0201217 3300045976 Bacteria 1886
256 Ga0466967_0210857 3300045976 Bacteria 1842
257 Ga0466967_0335292 3300045976 Bacteria 1461
258 Ga0466967_0423871 3300045976 Bacteria 1297
259 Ga0466967_0457436 3300045976 Bacteria 1248
260 Ga0466967_0658856 3300045976 Bacteria 1035
261 Ga0495592_0000716 3300046454 Bacteria 23196
262 Ga0495592_0001615 3300046454 Bacteria 15792
263 Ga0495603_0003662 3300046455 Bacteria 9143
264 Ga0495603_0009298 3300046455 Bacteria 5943
265 Ga0495629_0446076 3300046459 Bacteria 876
266 Ga0495651_0000001 3300046462 Bacteria 210544
267 Ga0495653_0000668 3300046463 Bacteria 26201
268 Ga0495605_0209106 3300046474 Bacteria 848
269 Ga0495664_0192399 3300046477 Bacteria 1236
270 Ga0495584_0190142 3300046491 Bacteria 1043
271 Ga0495608_0000448 3300046511 Bacteria 28730
272 Ga0495608_0014736 3300046511 Bacteria 5426
273 Ga0495608_0151664 3300046511 Bacteria 1477
274 Ga0495608_0222502 3300046511 Bacteria 1184
275 Ga0495618_0000834 3300046514 Bacteria 21394
276 Ga0495620_0061324 3300046515 Bacteria 1565
277 Ga0495628_0000500 3300046516 Bacteria 35932
278 Ga0495628_0206293 3300046516 Unclassified 1479
279 Ga0495630_0036819 3300046517 Bacteria 3657
280 Ga0495630_0150174 3300046517 Bacteria 1772
281 Ga0495631_0178454 3300046518 Bacteria 910
282 Ga0495637_0060923 3300046520 Bacteria 1548
283 Ga0495663_0044930 3300046525 Bacteria 1353
284 Ga0495652_0000015 3300046529 Bacteria 222624
285 Ga0495652_0193831 3300046529 Bacteria 1548
286 Ga0495586_0241981 3300046535 Bacteria 1028
287 Ga0495587_0000036 3300046536 Bacteria 117570
288 Ga0495587_0018976 3300046536 Bacteria 4262
289 Ga0495587_0028126 3300046536 Unclassified 3421
290 Ga0495645_0000039 3300046543 Bacteria 94569
291 Ga0495645_0028883 3300046543 Unclassified 4030
292 Ga0495645_0227708 3300046543 Bacteria 1250
293 Ga0495667_0029214 3300046559 Bacteria 3710
294 Ga0495667_0039488 3300046559 Bacteria 3138
295 Ga0495656_0069810 3300046615 Bacteria 1557
296 Ga0495668_0044973 3300046616 Bacteria 2454
297 Ga0495611_0032628 3300046648 Bacteria 2296
298 Ga0495635_0154982 3300046663 Bacteria 1559
299 Ga0495635_0222272 3300046663 Bacteria 1277
300 Ga0495588_0125034 3300046674 Unclassified 1356
301 Ga0495657_0004500 3300046675 Bacteria 11143
302 Ga0495657_0121803 3300046675 Bacteria 1642
303 Ga0495599_0000055 3300046678 Bacteria 79065
304 Ga0495599_0000409 3300046678 Bacteria 24585
305 Ga0495599_0341172 3300046678 Unclassified 899
306 Ga0495623_0000445 3300046679 Bacteria 27187
307 Ga0495623_0019915 3300046679 Bacteria 4337
308 Ga0495646_0001458 3300046680 Bacteria 14066
309 Ga0495647_0040949 3300046681 Unclassified 1762
310 Ga0495624_0064031 3300046690 Bacteria 2298
311 Ga0495624_0145321 3300046690 Bacteria 1452
312 Ga0495624_0155129 3300046690 Bacteria 1400
313 Ga0495670_0253804 3300046691 Bacteria 938
314 Ga0495671_0045157 3300046692 Bacteria 2207
315 Ga0495604_0000004 3300047317 Bacteria 456385
316 Ga0495604_0149452 3300047317 Bacteria 1661
317 Ga0495674_0104353 3300047319 Bacteria 2409
318 Ga0495676_0031300 3300047321 Bacteria 4502
319 Ga0495676_0076429 3300047321 Bacteria 2557
320 Ga0495676_0415274 3300047321 Bacteria 891
321 Ga0495680_0003419 3300047322 Bacteria 15661
322 Ga0495680_0009194 3300047322 Bacteria 8912
323 Ga0495675_0000250 3300047444 Bacteria 38818
324 Ga0495675_0164707 3300047444 Bacteria 1364
325 Ga0495684_0039575 3300047471 Bacteria 3614
326 Ga0495684_0525865 3300047471 Bacteria 809
327 Ga0495602_0000159 3300048088 Bacteria 62801
328 Ga0495602_0007762 3300048088 Bacteria 11216
329 Ga0495615_0020032 3300048090 Bacteria 1494
330 Ga0496100_0093553 3300048903 Bacteria 2057
331 Ga0496101_0026881 3300048904 Bacteria 4002
332 Ga0496101_0142525 3300048904 Unclassified 1827
333 Ga0496101_0156312 3300048904 Bacteria 1747
334 Ga0496102_0015662 3300048905 Bacteria 6605
335 Ga0496102_0494403 3300048905 Unclassified 1145
336 Ga0496103_0026651 3300048906 Bacteria 3499
337 Ga0496103_0103679 3300048906 Bacteria 1802
338 Ga0496103_0189562 3300048906 Bacteria 1322
339 Ga0496103_0306492 3300048906 Bacteria 1022
340 Ga0496104_0002848 3300048907 Bacteria 14912
341 Ga0496104_0183707 3300048907 Unclassified 2001
342 Ga0496105_0005081 3300048908 Bacteria 9971
343 Ga0496105_0047041 3300048908 Bacteria 3560
344 Ga0496105_0051132 3300048908 Bacteria 3414
345 Ga0496105_0102248 3300048908 Bacteria 2366
346 Ga0496105_0442569 3300048908 Bacteria 1027
347 Ga0496106_0105410 3300048909 Bacteria 2190
348 Ga0496106_0128064 3300048909 Bacteria 1989
349 Ga0496106_0245722 3300048909 Bacteria 1430
350 Ga0496107_0018279 3300048910 Bacteria 4934
351 Ga0496107_0089569 3300048910 Bacteria 2247
352 Ga0496107_0091469 3300048910 Bacteria 2224
353 Ga0496107_0173973 3300048910 Unclassified 1598
354 Ga0496108_0006665 3300048911 Bacteria 9352
355 Ga0496108_0012105 3300048911 Bacteria 7014
356 Ga0496108_0053682 3300048911 Bacteria 3380
357 Ga0496109_0001361 3300048912 Bacteria 20257
358 Ga0496109_0016734 3300048912 Bacteria 6415
359 Ga0496109_0041910 3300048912 Bacteria 4146
360 Ga0496109_0074499 3300048912 Bacteria 3120
361 Ga0496109_0098106 3300048912 Bacteria 2716
362 Ga0496109_0193438 3300048912 Bacteria 1911
363 Ga0496110_0000487 3300048913 Bacteria 26963
364 Ga0496110_0062401 3300048913 Bacteria 3291
365 Ga0496110_0199579 3300048913 Bacteria 1817
366 Ga0496111_0001213 3300048914 Bacteria 14401
367 Ga0496111_0187559 3300048914 Bacteria 1537
368 Ga0496112_0049024 3300048915 Bacteria 4139
369 Ga0496112_0094139 3300048915 Bacteria 2966
370 Ga0496112_0100175 3300048915 Bacteria 2867
371 Ga0496112_0211397 3300048915 Bacteria 1897
372 Ga0496113_0117502 3300048916 Bacteria 2076
373 Ga0496113_0480954 3300048916 Bacteria 997
374 Ga0496114_0047139 3300048917 Bacteria 3584
375 Ga0496114_0049632 3300048917 Bacteria 3492
376 Ga0496114_0160166 3300048917 Bacteria 1956
377 Ga0496115_0056592 3300048918 Bacteria 3152
378 Ga0496115_0100246 3300048918 Bacteria 2374
379 Ga0496115_0589701 3300048918 Archaea 885
380 Ga0501031_0007415 3300049568 Bacteria 7146
381 Ga0501031_0008294 3300049568 Bacteria 6758
382 Ga0501031_0050008 3300049568 Bacteria 2724
383 Ga0501031_0051499 3300049568 Bacteria 2681
384 Ga0501031_0216908 3300049568 Bacteria 1246
385 Ga0501032_0010947 3300049569 Bacteria 6522
386 Ga0501032_0017625 3300049569 Bacteria 5013
387 Ga0501032_0430662 3300049569 Bacteria 846
388 Ga0501033_0000751 3300049570 Bacteria 29835
389 Ga0501033_0044434 3300049570 Bacteria 3307
390 Ga0501033_0134242 3300049570 Bacteria 1791
391 Ga0501033_0162341 3300049570 Bacteria 1608
392 Ga0501033_0163632 3300049570 Bacteria 1600
393 Ga0501034_0002274 3300049571 Bacteria 23567
394 Ga0501036_0007550 3300049572 Bacteria 8871
395 Ga0501036_0022004 3300049572 Bacteria 5361
396 Ga0501036_0117499 3300049572 Bacteria 2246
397 Ga0501036_0134004 3300049572 Bacteria 2091
398 Ga0501036_0144351 3300049572 Bacteria 2008
399 Ga0501036_0181541 3300049572 Bacteria 1771
400 Ga0501037_0011098 3300049573 Bacteria 6630
401 Ga0501037_0042151 3300049573 Bacteria 3354
402 Ga0501037_0099608 3300049573 Bacteria 2099
403 Ga0501037_0323827 3300049573 Bacteria 1067
404 Ga0501038_0014252 3300049574 Bacteria 7242
405 Ga0501038_0078267 3300049574 Bacteria 2790
406 Ga0501038_0128577 3300049574 Bacteria 2082
407 Ga0501038_0280576 3300049574 Bacteria 1311
408 Ga0501039_0003170 3300049575 Bacteria 12299
409 Ga0501039_0007034 3300049575 Bacteria 8565
410 Ga0501039_0009041 3300049575 Bacteria 7590
411 Ga0501039_0036725 3300049575 Bacteria 3781
412 Ga0501040_0000081 3300049576 Bacteria 46641
413 Ga0501040_0005626 3300049576 Bacteria 8099
414 Ga0501040_0016666 3300049576 Bacteria 4868
415 Ga0501040_0020799 3300049576 Bacteria 4375
416 Ga0501040_0142529 3300049576 Bacteria 1688
417 Ga0501040_0172820 3300049576 Bacteria 1530
418 Ga0501040_0209778 3300049576 Bacteria 1385
419 Ga0501040_0289018 3300049576 Bacteria 1171
420 Ga0501041_0000083 3300049577 Bacteria 37197
421 Ga0501041_0019999 3300049577 Bacteria 3999
422 Ga0501041_0046972 3300049577 Bacteria 2627
423 Ga0501041_0089562 3300049577 Bacteria 1899
424 Ga0501042_0000488 3300049578 Bacteria 20567
425 Ga0501042_0006467 3300049578 Bacteria 7609
426 Ga0501042_0030812 3300049578 Bacteria 3792
427 Ga0501042_0096918 3300049578 Bacteria 2119
428 Ga0501043_0052770 3300049579 Bacteria 3193
429 Ga0501043_0066087 3300049579 Bacteria 2840
430 Ga0501043_0532191 3300049579 Bacteria 875
431 Ga0501046_0000510 3300049580 Bacteria 38530
432 Ga0501046_0013681 3300049580 Bacteria 6861
433 Ga0501046_0070511 3300049580 Bacteria 2717
434 Ga0501046_0070725 3300049580 Bacteria 2712
435 Ga0501046_0075180 3300049580 Bacteria 2620
436 Ga0501046_0288625 3300049580 Unclassified 1200
437 Ga0501047_0017519 3300049581 Bacteria 6861
438 Ga0501048_0001274 3300049582 Bacteria 19096
439 Ga0501048_0007663 3300049582 Bacteria 8184
440 Ga0501048_0010808 3300049582 Bacteria 6805
441 Ga0501048_0022993 3300049582 Bacteria 4556
442 Ga0501048_0093571 3300049582 Bacteria 2120
443 Ga0501048_0259986 3300049582 Bacteria 1233
444 Ga0501048_0264313 3300049582 Bacteria 1222
445 Ga0501067_0015926 3300049583 Bacteria 4159
446 Ga0501067_0021321 3300049583 Bacteria 3585
447 Ga0501067_0054241 3300049583 Bacteria 2221
448 Ga0501068_0000266 3300049584 Bacteria 25796
449 Ga0501068_0095264 3300049584 Bacteria 1840
450 Ga0501068_0098491 3300049584 Bacteria 1810
451 Ga0501069_0026234 3300049585 Bacteria 3190
452 Ga0501069_0128911 3300049585 Bacteria 1448
453 Ga0501069_0298481 3300049585 Unclassified 944
454 Ga0501070_0002030 3300049586 Bacteria 17801
455 Ga0501070_0026233 3300049586 Bacteria 4891
456 Ga0501070_0127988 3300049586 Bacteria 2098
457 Ga0501071_0000179 3300049587 Bacteria 28005
458 Ga0501071_0015212 3300049587 Bacteria 5278
459 Ga0501071_0046574 3300049587 Bacteria 3114
460 Ga0501071_0181291 3300049587 Bacteria 1578
461 Ga0501071_0196163 3300049587 Bacteria 1515
462 Ga0501072_0000870 3300049588 Bacteria 22145
463 Ga0501072_0001737 3300049588 Bacteria 16233
464 Ga0501072_0042320 3300049588 Bacteria 3578
465 Ga0501072_0043731 3300049588 Bacteria 3521
466 Ga0501072_0234555 3300049588 Bacteria 1461
467 Ga0501072_0305619 3300049588 Bacteria 1264
468 Ga0501072_0784819 3300049588 Bacteria 746
469 Ga0501073_0004319 3300049589 Bacteria 10669
470 Ga0501073_0043371 3300049589 Bacteria 3172
471 Ga0501074_0007927 3300049590 Bacteria 7691
472 Ga0501074_0010525 3300049590 Bacteria 6712
473 Ga0501074_0010566 3300049590 Bacteria 6701
474 Ga0501074_0066039 3300049590 Bacteria 2603
475 Ga0501074_0118819 3300049590 Bacteria 1890
476 Ga0501074_0209255 3300049590 Bacteria 1390
477 Ga0501074_0232742 3300049590 Bacteria 1311
478 Ga0501074_0502696 3300049590 Bacteria 859
479 Ga0501075_0000298 3300049591 Bacteria 27595
480 Ga0501075_0001882 3300049591 Bacteria 13848
481 Ga0501075_0076521 3300049591 Bacteria 2531
482 Ga0501075_0121402 3300049591 Bacteria 1988
483 Ga0501076_0005387 3300049592 Bacteria 9194
484 Ga0501076_0005397 3300049592 Bacteria 9187
485 Ga0501076_0009148 3300049592 Bacteria 7296
486 Ga0501076_0030134 3300049592 Bacteria 4225
487 Ga0501076_0114771 3300049592 Bacteria 2179
488 Ga0501076_0195982 3300049592 Bacteria 1649
489 Ga0501077_0000718 3300049593 Bacteria 20025
490 Ga0501077_0029055 3300049593 Bacteria 3514
491 Ga0501077_0053641 3300049593 Bacteria 2559
492 Ga0501077_0093304 3300049593 Bacteria 1908
493 Ga0501079_0001566 3300049741 Bacteria 16231
494 Ga0501079_0066175 3300049741 Bacteria 2788
495 Ga0501079_0094574 3300049741 Bacteria 2315
496 Ga0501079_0145329 3300049741 Bacteria 1848
497 Ga0501079_0151966 3300049741 Bacteria 1804
498 Ga0501079_0243477 3300049741 Bacteria 1405
499 Ga0501079_0293315 3300049741 Bacteria 1272
500 Ga0501079_0377727 3300049741 Bacteria 1111
501 Ga0501080_0000450 3300049742 Bacteria 31992
502 Ga0501080_0086353 3300049742 Bacteria 2915
503 Ga0501080_0222737 3300049742 Bacteria 1726
504 Ga0501080_0291151 3300049742 Bacteria 1482
505 Ga0501081_0000447 3300049743 Bacteria 22828
506 Ga0501081_0001529 3300049743 Bacteria 14201
507 Ga0501081_0014636 3300049743 Bacteria 5176
508 Ga0501081_0025411 3300049743 Bacteria 3983
509 Ga0501081_0113712 3300049743 Bacteria 1922
510 Ga0501081_0152810 3300049743 Bacteria 1659
511 Ga0501081_0271038 3300049743 Bacteria 1241
512 Ga0501083_0008619 3300049744 Bacteria 7195
513 Ga0501083_0021582 3300049744 Bacteria 4472
514 Ga0501083_0197713 3300049744 Bacteria 1311
515 Ga0501083_0377192 3300049744 Unclassified 922
516 Ga0501035_0015755 3300049822 Bacteria 6977
517 Ga0501035_0052097 3300049822 Bacteria 3662
518 Ga0501035_0080313 3300049822 Bacteria 2880
519 Ga0501035_0293341 3300049822 Bacteria 1372
520 Ga0501044_0014722 3300049823 Bacteria 8433
521 Ga0501044_0106019 3300049823 Bacteria 2823
522 Ga0501044_0211897 3300049823 Bacteria 1891
523 Ga0501045_0002012 3300049824 Bacteria 13738
524 Ga0501045_0003128 3300049824 Bacteria 11316
525 Ga0501045_0013233 3300049824 Bacteria 5821
526 Ga0501045_0049421 3300049824 Bacteria 3066
527 Ga0501045_0090156 3300049824 Bacteria 2265
528 Ga0501045_0337607 3300049824 Bacteria 1121
529 nmdc:mga08y16_158838_c1 3300050511 Bacteria 2349
530 nmdc:mga08y16_303386_c1 3300050511 Unclassified 1646
531 nmdc:mga0n895_3482_c1 3300050512 Bacteria 12703
532 Ga0495601_0000183 3300053077 Bacteria 33204
533 Ga0495601_0086561 3300053077 Bacteria 2013
534 Ga0495601_0092174 3300053077 Bacteria 1951
535 Ga0495601_0120211 3300053077 Unclassified 1705
536 Ga0495601_0134664 3300053077 Bacteria 1610
537 Ga0495655_0044131 3300053083 Bacteria 1152
538 Ga0495595_0055077 3300053084 Bacteria 1851
539 Ga0495595_0305455 3300053084 Unclassified 800
540 Ga0495619_0001430 3300053085 Bacteria 15694
541 Ga0495619_0082017 3300053085 Bacteria 2173
542 Ga0495619_0153962 3300053085 Unclassified 1586
543 Ga0501084_0008560 3300054114 Bacteria 8459
544 Ga0501084_0067535 3300054114 Bacteria 2992
545 Ga0501084_0116557 3300054114 Bacteria 2245
546 Ga0501084_0128113 3300054114 Bacteria 2136
547 Ga0501084_0254413 3300054114 Bacteria 1482
548 Ga0501084_0268144 3300054114 Bacteria 1441
549 Ga0590075_044865 3300059424 Bacteria 1132
550 Ga0501082_0002126 3300060353 Bacteria 17424
551 Ga0501082_0002732 3300060353 Bacteria 15414
552 Ga0501082_0005344 3300060353 Bacteria 11152
553 Ga0501082_0087914 3300060353 Bacteria 2681
554 Ga0501082_0159404 3300060353 Bacteria 1960
555 Ga0466962_0057707 3300061719 Bacteria 1853
556 Ga0466962_0060228 3300061719 Bacteria 1812
557 Ga0466962_0069754 3300061719 Bacteria 1678
558 Ga0530510_0002824 3300061734 Bacteria 11945
559 Ga0530510_0002903 3300061734 Bacteria 11747
560 Ga0530510_0006456 3300061734 Bacteria 8166
561 Ga0530510_0014787 3300061734 Bacteria 5510
562 Ga0530510_0062373 3300061734 Bacteria 2698
563 Ga0530510_0604464 3300061734 Bacteria 834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10168626 Ga0207668_101686262 189
2 3300038996 Ga0242420_066492 Ga0242420_066492_124_702 192
3 3300042157 Ga0439458_0148239 Ga0439458_0148239_16_597 193
4 3300048905 Ga0496102_0494403 Ga0496102_0494403_22_609 195
5 3300049568 Ga0501031_0051499 Ga0501031_0051499_789_1481 196
6 3300049569 Ga0501032_0017625 Ga0501032_0017625_3465_4157 196
7 3300049570 Ga0501033_0163632 Ga0501033_0163632_572_1264 196
8 3300049571 Ga0501034_0002274 Ga0501034_0002274_963_1655 196
9 3300049572 Ga0501036_0181541 Ga0501036_0181541_572_1264 196
10 3300049573 Ga0501037_0042151 Ga0501037_0042151_2283_2975 196
11 3300049574 Ga0501038_0280576 Ga0501038_0280576_411_1103 196
12 3300049575 Ga0501039_0036725 Ga0501039_0036725_1761_2453 196
13 3300049576 Ga0501040_0000081 Ga0501040_0000081_41597_42289 196
14 3300049577 Ga0501041_0089562 Ga0501041_0089562_419_1111 196
15 3300049578 Ga0501042_0000488 Ga0501042_0000488_14973_15665 196
16 3300049580 Ga0501046_0000510 Ga0501046_0000510_8024_8716 196
17 3300049582 Ga0501048_0010808 Ga0501048_0010808_4896_5588 196
18 3300049583 Ga0501067_0015926 Ga0501067_0015926_962_1654 196
19 3300049584 Ga0501068_0098491 Ga0501068_0098491_572_1264 196
20 3300049585 Ga0501069_0026234 Ga0501069_0026234_68_760 196
21 3300049586 Ga0501070_0127988 Ga0501070_0127988_868_1560 196
22 3300049587 Ga0501071_0196163 Ga0501071_0196163_380_1072 196
23 3300049588 Ga0501072_0001737 Ga0501072_0001737_6788_7480 196
24 3300049590 Ga0501074_0232742 Ga0501074_0232742_209_901 196
25 3300049591 Ga0501075_0001882 Ga0501075_0001882_10874_11566 196
26 3300049592 Ga0501076_0005387 Ga0501076_0005387_4896_5588 196
27 3300049593 Ga0501077_0029055 Ga0501077_0029055_2042_2734 196
28 3300049741 Ga0501079_0094574 Ga0501079_0094574_789_1481 196
29 3300049742 Ga0501080_0291151 Ga0501080_0291151_380_1072 196
30 3300049743 Ga0501081_0001529 Ga0501081_0001529_508_1200 196
31 3300049744 Ga0501083_0197713 Ga0501083_0197713_411_1103 196
32 3300049822 Ga0501035_0052097 Ga0501035_0052097_2303_2995 196
33 3300049823 Ga0501044_0014722 Ga0501044_0014722_6396_7088 196
34 3300049824 Ga0501045_0002012 Ga0501045_0002012_3139_3831 196
35 3300054114 Ga0501084_0254413 Ga0501084_0254413_411_1103 196
36 3300060353 Ga0501082_0002126 Ga0501082_0002126_3337_4029 196
37 3300061734 Ga0530510_0002903 Ga0530510_0002903_8985_9677 196
38 3300005842 Ga0068858_100118152 Ga0068858_1001181525 210
39 3300009177 Ga0105248_10052290 Ga0105248_100522906 210
40 3300013297 Ga0157378_10333925 Ga0157378_103339252 210
41 3300013308 Ga0157375_10361331 Ga0157375_103613312 210
42 3300026067 Ga0207678_10223209 Ga0207678_102232091 210
43 3300046515 Ga0495620_0061324 Ga0495620_0061324_538_1188 210
44 3300046520 Ga0495637_0060923 Ga0495637_0060923_712_1362 210
45 3300046616 Ga0495668_0044973 Ga0495668_0044973_1563_2213 210
46 3300046691 Ga0495670_0253804 Ga0495670_0253804_61_711 210
47 3300046692 Ga0495671_0045157 Ga0495671_0045157_1433_2083 210
48 3300048090 Ga0495615_0020032 Ga0495615_0020032_572_1222 210
49 3300028577 Ga0265318_10005350 Ga0265318_100053508 216
50 3300031240 Ga0265320_10021603 Ga0265320_100216035 216
51 3300048912 Ga0496109_0098106 Ga0496109_0098106_2051_2701 216
52 3300005327 Ga0070658_10016021 Ga0070658_100160214 217
53 3300005329 Ga0070683_100041457 Ga0070683_1000414573 217
54 3300005329 Ga0070683_100193260 Ga0070683_1001932602 217
55 3300005337 Ga0070682_100121089 Ga0070682_1001210891 217
56 3300005337 Ga0070682_100209279 Ga0070682_1002092792 217
57 3300005339 Ga0070660_100141658 Ga0070660_1001416583 217
58 3300005339 Ga0070660_100438926 Ga0070660_1004389262 217
59 3300005355 Ga0070671_100174569 Ga0070671_1001745692 217
60 3300005435 Ga0070714_100014293 Ga0070714_1000142936 217
61 3300005435 Ga0070714_100060585 Ga0070714_1000605853 217
62 3300005435 Ga0070714_100063992 Ga0070714_1000639922 217
63 3300005435 Ga0070714_100528531 Ga0070714_1005285312 217
64 3300005437 Ga0070710_10006454 Ga0070710_100064546 217
65 3300005437 Ga0070710_10174144 Ga0070710_101741441 217
66 3300005437 Ga0070710_10417852 Ga0070710_104178522 217
67 3300005439 Ga0070711_100002087 Ga0070711_10000208713 217
68 3300005468 Ga0070707_100001529 Ga0070707_1000015294 217
69 3300005530 Ga0070679_100036800 Ga0070679_1000368003 217
70 3300005530 Ga0070679_100079858 Ga0070679_1000798582 217
71 3300005530 Ga0070679_100270707 Ga0070679_1002707072 217
72 3300005536 Ga0070697_100337964 Ga0070697_1003379642 217
73 3300005545 Ga0070695_100000393 Ga0070695_1000003936 217
74 3300005549 Ga0070704_100365573 Ga0070704_1003655731 217
75 3300005614 Ga0068856_100067085 Ga0068856_1000670854 217
76 3300006028 Ga0070717_10020080 Ga0070717_100200806 217
77 3300006028 Ga0070717_10035780 Ga0070717_100357803 217
78 3300006028 Ga0070717_10050261 Ga0070717_100502612 217
79 3300006058 Ga0075432_10117033 Ga0075432_101170332 217
80 3300006163 Ga0070715_10008398 Ga0070715_100083985 217
81 3300006173 Ga0070716_100033263 Ga0070716_1000332632 217
82 3300006871 Ga0075434_100004162 Ga0075434_1000041622 217
83 3300006881 Ga0068865_100161828 Ga0068865_1001618281 217
84 3300009093 Ga0105240_10080227 Ga0105240_100802272 217
85 3300009094 Ga0111539_10435949 Ga0111539_104359492 217
86 3300009098 Ga0105245_10116191 Ga0105245_101161912 217
87 3300009098 Ga0105245_10126474 Ga0105245_101264743 217
88 3300009098 Ga0105245_10460277 Ga0105245_104602772 217
89 3300009177 Ga0105248_11150368 Ga0105248_111503681 217
90 3300009545 Ga0105237_10026012 Ga0105237_100260125 217
91 3300013105 Ga0157369_10421336 Ga0157369_104213362 217
92 3300013296 Ga0157374_10057521 Ga0157374_100575212 217
93 3300013306 Ga0163162_10200975 Ga0163162_102009752 217
94 3300013307 Ga0157372_10021043 Ga0157372_1002104310 217
95 3300013307 Ga0157372_10316420 Ga0157372_103164202 217
96 3300013307 Ga0157372_10538827 Ga0157372_105388271 217
97 3300013307 Ga0157372_10857721 Ga0157372_108577211 217
98 3300014497 Ga0182008_10130111 Ga0182008_101301112 217
99 3300022467 Ga0224712_10009473 Ga0224712_100094732 217
100 3300025898 Ga0207692_10016984 Ga0207692_100169842 217
101 3300025898 Ga0207692_10129437 Ga0207692_101294372 217
102 3300025898 Ga0207692_10467422 Ga0207692_104674221 217
103 3300025905 Ga0207685_10038831 Ga0207685_100388312 217
104 3300025913 Ga0207695_10171399 Ga0207695_101713992 217
105 3300025915 Ga0207693_10000222 Ga0207693_100002226 217
106 3300025915 Ga0207693_10000964 Ga0207693_100009647 217
107 3300025919 Ga0207657_10007527 Ga0207657_1000752712 217
108 3300025921 Ga0207652_10053007 Ga0207652_100530073 217
109 3300025922 Ga0207646_10044724 Ga0207646_100447242 217
110 3300025927 Ga0207687_10194538 Ga0207687_101945382 217
111 3300025929 Ga0207664_10011283 Ga0207664_100112834 217
112 3300025929 Ga0207664_10273897 Ga0207664_102738972 217
113 3300025931 Ga0207644_10117838 Ga0207644_101178382 217
114 3300025932 Ga0207690_10073400 Ga0207690_100734002 217
115 3300025939 Ga0207665_10001958 Ga0207665_100019585 217
116 3300025945 Ga0207679_10159838 Ga0207679_101598382 217
117 3300026088 Ga0207641_10282139 Ga0207641_102821392 217
118 3300028800 Ga0265338_10016515 Ga0265338_100165156 217
119 3300028800 Ga0265338_10194858 Ga0265338_101948582 217
120 3300029957 Ga0265324_10052628 Ga0265324_100526282 217
121 3300035172 Ga0373955_0072758 Ga0373955_0072758_502_1173 217
122 3300035691 Ga0373931_0057328 Ga0373931_0057328_1387_2043 217
123 3300035724 Ga0373933_0034837 Ga0373933_0034837_150_821 217
124 3300035725 Ga0373947_0162612 Ga0373947_0162612_211_867 217
125 3300036401 Ga0373937_0003744 Ga0373937_0003744_3819_4490 217
126 3300036401 Ga0373937_0097838 Ga0373937_0097838_2049_2705 217
127 3300037418 Ga0395900_0503700 Ga0395900_0503700_93_749 217
128 3300037418 Ga0395900_0765882 Ga0395900_0765882_41_697 217
129 3300037466 Ga0395898_0196217 Ga0395898_0196217_419_1075 217
130 3300041512 Ga0451853_0860905 Ga0451853_0860905_191_862 217
131 3300044656 Ga0466969_0000637 Ga0466969_0000637_16020_16676 217
132 3300044656 Ga0466969_0039771 Ga0466969_0039771_1577_2233 217
133 3300044683 Ga0466965_0080819 Ga0466965_0080819_939_1595 217
134 3300044683 Ga0466965_0087826 Ga0466965_0087826_162_818 217
135 3300044684 Ga0466966_0013112 Ga0466966_0013112_2460_3116 217
136 3300044693 Ga0466961_0010766 Ga0466961_0010766_3927_4583 217
137 3300044693 Ga0466961_0045910 Ga0466961_0045910_1509_2165 217
138 3300044693 Ga0466961_0248080 Ga0466961_0248080_195_851 217
139 3300044694 Ga0466963_0012929 Ga0466963_0012929_4258_4914 217
140 3300044694 Ga0466963_0015084 Ga0466963_0015084_4099_4755 217
141 3300044694 Ga0466963_0020542 Ga0466963_0020542_680_1336 217
142 3300044694 Ga0466963_0073392 Ga0466963_0073392_383_1039 217
143 3300044694 Ga0466963_0083865 Ga0466963_0083865_1434_2090 217
144 3300044694 Ga0466963_0176794 Ga0466963_0176794_171_827 217
145 3300044706 Ga0466964_0003548 Ga0466964_0003548_3382_4038 217
146 3300044706 Ga0466964_0009930 Ga0466964_0009930_2770_3426 217
147 3300044706 Ga0466964_0010506 Ga0466964_0010506_915_1574 217
148 3300044706 Ga0466964_0010904 Ga0466964_0010904_763_1461 217
149 3300044706 Ga0466964_0014950 Ga0466964_0014950_597_1253 217
150 3300044706 Ga0466964_0015067 Ga0466964_0015067_959_1615 217
151 3300044706 Ga0466964_0015472 Ga0466964_0015472_1155_1811 217
152 3300044719 Ga0466971_0013046 Ga0466971_0013046_2469_3125 217
153 3300044719 Ga0466971_0023427 Ga0466971_0023427_98_754 217
154 3300044719 Ga0466971_0035497 Ga0466971_0035497_1462_2118 217
155 3300044719 Ga0466971_0176297 Ga0466971_0176297_41_697 217
156 3300044735 Ga0466968_0001416 Ga0466968_0001416_2994_3650 217
157 3300044735 Ga0466968_0007287 Ga0466968_0007287_1266_1922 217
158 3300044735 Ga0466968_0011733 Ga0466968_0011733_1790_2446 217
159 3300044735 Ga0466968_0028113 Ga0466968_0028113_606_1262 217
160 3300044735 Ga0466968_0052029 Ga0466968_0052029_461_1132 217
161 3300044735 Ga0466968_0189179 Ga0466968_0189179_142_798 217
162 3300044765 Ga0466970_0005839 Ga0466970_0005839_311_967 217
163 3300044765 Ga0466970_0084493 Ga0466970_0084493_327_983 217
164 3300044765 Ga0466970_0170980 Ga0466970_0170980_299_955 217
165 3300044765 Ga0466970_0242525 Ga0466970_0242525_280_951 217
166 3300044842 Ga0466957_0007567 Ga0466957_0007567_2713_3369 217
167 3300044842 Ga0466957_0010736 Ga0466957_0010736_2034_2690 217
168 3300044842 Ga0466957_0036525 Ga0466957_0036525_566_1222 217
169 3300044842 Ga0466957_0070261 Ga0466957_0070261_1363_2019 217
170 3300044842 Ga0466957_0096056 Ga0466957_0096056_1116_1772 217
171 3300044842 Ga0466957_0140205 Ga0466957_0140205_170_826 217
172 3300045049 Ga0466959_0002503 Ga0466959_0002503_1890_2546 217
173 3300045049 Ga0466959_0009993 Ga0466959_0009993_1208_1864 217
174 3300045049 Ga0466959_0016330 Ga0466959_0016330_4473_5252 217
175 3300045049 Ga0466959_0033624 Ga0466959_0033624_1502_2158 217
176 3300045049 Ga0466959_0040433 Ga0466959_0040433_1631_2287 217
177 3300045836 Ga0466958_0001766 Ga0466958_0001766_3262_3918 217
178 3300045836 Ga0466958_0004817 Ga0466958_0004817_6212_6868 217
179 3300045836 Ga0466958_0006747 Ga0466958_0006747_1059_1715 217
180 3300045836 Ga0466958_0010503 Ga0466958_0010503_3149_3805 217
181 3300045836 Ga0466958_0040015 Ga0466958_0040015_2036_2692 217
182 3300045836 Ga0466958_0121933 Ga0466958_0121933_555_1211 217
183 3300045836 Ga0466958_0145518 Ga0466958_0145518_206_862 217
184 3300045836 Ga0466958_0310712 Ga0466958_0310712_260_916 217
185 3300045976 Ga0466967_0002062 Ga0466967_0002062_8930_9586 217
186 3300045976 Ga0466967_0008127 Ga0466967_0008127_3520_4176 217
187 3300045976 Ga0466967_0020238 Ga0466967_0020238_3897_4553 217
188 3300045976 Ga0466967_0041042 Ga0466967_0041042_791_1447 217
189 3300045976 Ga0466967_0044450 Ga0466967_0044450_2855_3511 217
190 3300045976 Ga0466967_0046505 Ga0466967_0046505_1607_2263 217
191 3300045976 Ga0466967_0061147 Ga0466967_0061147_765_1421 217
192 3300045976 Ga0466967_0076473 Ga0466967_0076473_2207_2866 217
193 3300045976 Ga0466967_0192833 Ga0466967_0192833_215_892 217
194 3300045976 Ga0466967_0201217 Ga0466967_0201217_1123_1779 217
195 3300045976 Ga0466967_0210857 Ga0466967_0210857_572_1228 217
196 3300045976 Ga0466967_0335292 Ga0466967_0335292_110_766 217
197 3300045976 Ga0466967_0423871 Ga0466967_0423871_429_1085 217
198 3300045976 Ga0466967_0457436 Ga0466967_0457436_508_1164 217
199 3300045976 Ga0466967_0658856 Ga0466967_0658856_228_884 217
200 3300046454 Ga0495592_0000716 Ga0495592_0000716_16957_17628 217
201 3300046454 Ga0495592_0001615 Ga0495592_0001615_11184_11840 217
202 3300046455 Ga0495603_0003662 Ga0495603_0003662_8166_8822 217
203 3300046455 Ga0495603_0009298 Ga0495603_0009298_3326_3979 217
204 3300046459 Ga0495629_0446076 Ga0495629_0446076_79_735 217
205 3300046462 Ga0495651_0000001 Ga0495651_0000001_132325_132996 217
206 3300046463 Ga0495653_0000668 Ga0495653_0000668_2936_3607 217
207 3300046474 Ga0495605_0209106 Ga0495605_0209106_29_685 217
208 3300046477 Ga0495664_0192399 Ga0495664_0192399_136_792 217
209 3300046491 Ga0495584_0190142 Ga0495584_0190142_167_823 217
210 3300046511 Ga0495608_0000448 Ga0495608_0000448_17319_17990 217
211 3300046511 Ga0495608_0014736 Ga0495608_0014736_4263_4919 217
212 3300046511 Ga0495608_0151664 Ga0495608_0151664_396_1052 217
213 3300046511 Ga0495608_0222502 Ga0495608_0222502_200_856 217
214 3300046514 Ga0495618_0000834 Ga0495618_0000834_12961_13632 217
215 3300046516 Ga0495628_0000500 Ga0495628_0000500_26241_26912 217
216 3300046516 Ga0495628_0206293 Ga0495628_0206293_704_1360 217
217 3300046517 Ga0495630_0036819 Ga0495630_0036819_55_711 217
218 3300046517 Ga0495630_0150174 Ga0495630_0150174_347_1003 217
219 3300046518 Ga0495631_0178454 Ga0495631_0178454_54_710 217
220 3300046525 Ga0495663_0044930 Ga0495663_0044930_473_1129 217
221 3300046529 Ga0495652_0000015 Ga0495652_0000015_4332_5003 217
222 3300046529 Ga0495652_0193831 Ga0495652_0193831_303_974 217
223 3300046535 Ga0495586_0241981 Ga0495586_0241981_256_999 217
224 3300046536 Ga0495587_0000036 Ga0495587_0000036_78177_78848 217
225 3300046536 Ga0495587_0018976 Ga0495587_0018976_608_1264 217
226 3300046536 Ga0495587_0028126 Ga0495587_0028126_831_1487 217
227 3300046543 Ga0495645_0000039 Ga0495645_0000039_23719_24390 217
228 3300046543 Ga0495645_0028883 Ga0495645_0028883_2475_3131 217
229 3300046543 Ga0495645_0227708 Ga0495645_0227708_92_748 217
230 3300046559 Ga0495667_0029214 Ga0495667_0029214_412_1083 217
231 3300046559 Ga0495667_0039488 Ga0495667_0039488_417_1073 217
232 3300046615 Ga0495656_0069810 Ga0495656_0069810_382_1038 217
233 3300046648 Ga0495611_0032628 Ga0495611_0032628_172_828 217
234 3300046663 Ga0495635_0154982 Ga0495635_0154982_434_1177 217
235 3300046663 Ga0495635_0222272 Ga0495635_0222272_198_854 217
236 3300046674 Ga0495588_0125034 Ga0495588_0125034_25_681 217
237 3300046675 Ga0495657_0004500 Ga0495657_0004500_4244_4915 217
238 3300046675 Ga0495657_0121803 Ga0495657_0121803_52_708 217
239 3300046678 Ga0495599_0000055 Ga0495599_0000055_58112_58783 217
240 3300046678 Ga0495599_0000409 Ga0495599_0000409_11395_12051 217
241 3300046678 Ga0495599_0341172 Ga0495599_0341172_92_748 217
242 3300046679 Ga0495623_0000445 Ga0495623_0000445_22152_22823 217
243 3300046679 Ga0495623_0019915 Ga0495623_0019915_467_1123 217
244 3300046680 Ga0495646_0001458 Ga0495646_0001458_3822_4493 217
245 3300046681 Ga0495647_0040949 Ga0495647_0040949_487_1140 217
246 3300046690 Ga0495624_0064031 Ga0495624_0064031_183_839 217
247 3300046690 Ga0495624_0145321 Ga0495624_0145321_367_1023 217
248 3300046690 Ga0495624_0155129 Ga0495624_0155129_591_1247 217
249 3300047317 Ga0495604_0000004 Ga0495604_0000004_323335_324006 217
250 3300047317 Ga0495604_0149452 Ga0495604_0149452_840_1496 217
251 3300047319 Ga0495674_0104353 Ga0495674_0104353_493_1236 217
252 3300047321 Ga0495676_0031300 Ga0495676_0031300_312_968 217
253 3300047321 Ga0495676_0076429 Ga0495676_0076429_25_678 217
254 3300047321 Ga0495676_0415274 Ga0495676_0415274_83_739 217
255 3300047322 Ga0495680_0003419 Ga0495680_0003419_10039_10710 217
256 3300047322 Ga0495680_0009194 Ga0495680_0009194_8226_8882 217
257 3300047444 Ga0495675_0000250 Ga0495675_0000250_21863_22534 217
258 3300047444 Ga0495675_0164707 Ga0495675_0164707_312_968 217
259 3300047471 Ga0495684_0039575 Ga0495684_0039575_2163_2906 217
260 3300047471 Ga0495684_0525865 Ga0495684_0525865_62_718 217
261 3300048088 Ga0495602_0000159 Ga0495602_0000159_55678_56349 217
262 3300048088 Ga0495602_0007762 Ga0495602_0007762_600_1256 217
263 3300048903 Ga0496100_0093553 Ga0496100_0093553_1364_2020 217
264 3300048904 Ga0496101_0026881 Ga0496101_0026881_592_1248 217
265 3300048904 Ga0496101_0142525 Ga0496101_0142525_404_1060 217
266 3300048904 Ga0496101_0156312 Ga0496101_0156312_51_707 217
267 3300048905 Ga0496102_0015662 Ga0496102_0015662_4140_4796 217
268 3300048906 Ga0496103_0026651 Ga0496103_0026651_2287_2943 217
269 3300048906 Ga0496103_0103679 Ga0496103_0103679_126_782 217
270 3300048906 Ga0496103_0306492 Ga0496103_0306492_201_857 217
271 3300048907 Ga0496104_0002848 Ga0496104_0002848_2756_3412 217
272 3300048908 Ga0496105_0047041 Ga0496105_0047041_777_1433 217
273 3300048908 Ga0496105_0051132 Ga0496105_0051132_149_805 217
274 3300048908 Ga0496105_0102248 Ga0496105_0102248_1296_1952 217
275 3300048909 Ga0496106_0105410 Ga0496106_0105410_916_1572 217
276 3300048910 Ga0496107_0018279 Ga0496107_0018279_1028_1684 217
277 3300048910 Ga0496107_0089569 Ga0496107_0089569_887_1543 217
278 3300048911 Ga0496108_0012105 Ga0496108_0012105_2929_3585 217
279 3300048911 Ga0496108_0053682 Ga0496108_0053682_252_908 217
280 3300048912 Ga0496109_0016734 Ga0496109_0016734_446_1102 217
281 3300048912 Ga0496109_0041910 Ga0496109_0041910_2170_2826 217
282 3300048912 Ga0496109_0074499 Ga0496109_0074499_1820_2476 217
283 3300048912 Ga0496109_0193438 Ga0496109_0193438_970_1626 217
284 3300048913 Ga0496110_0199579 Ga0496110_0199579_953_1609 217
285 3300048915 Ga0496112_0049024 Ga0496112_0049024_50_706 217
286 3300048915 Ga0496112_0094139 Ga0496112_0094139_2243_2899 217
287 3300048915 Ga0496112_0100175 Ga0496112_0100175_841_1497 217
288 3300048915 Ga0496112_0211397 Ga0496112_0211397_668_1324 217
289 3300048916 Ga0496113_0117502 Ga0496113_0117502_944_1600 217
290 3300048917 Ga0496114_0047139 Ga0496114_0047139_2382_3038 217
291 3300048917 Ga0496114_0160166 Ga0496114_0160166_1290_1946 217
292 3300048918 Ga0496115_0056592 Ga0496115_0056592_923_1579 217
293 3300048918 Ga0496115_0100246 Ga0496115_0100246_1575_2231 217
294 3300049583 Ga0501067_0021321 Ga0501067_0021321_2128_2784 217
295 3300049585 Ga0501069_0298481 Ga0501069_0298481_130_786 217
296 3300050512 nmdc:mga0n895_3482_c1 nmdc:mga0n895_3482_c1_10577_11233 217
297 3300053077 Ga0495601_0000183 Ga0495601_0000183_6341_7012 217
298 3300053077 Ga0495601_0086561 Ga0495601_0086561_746_1402 217
299 3300053077 Ga0495601_0092174 Ga0495601_0092174_770_1426 217
300 3300053077 Ga0495601_0120211 Ga0495601_0120211_699_1355 217
301 3300053077 Ga0495601_0134664 Ga0495601_0134664_679_1335 217
302 3300053083 Ga0495655_0044131 Ga0495655_0044131_19_690 217
303 3300053084 Ga0495595_0055077 Ga0495595_0055077_724_1380 217
304 3300053084 Ga0495595_0305455 Ga0495595_0305455_118_774 217
305 3300053085 Ga0495619_0001430 Ga0495619_0001430_2311_2982 217
306 3300053085 Ga0495619_0082017 Ga0495619_0082017_384_1040 217
307 3300053085 Ga0495619_0153962 Ga0495619_0153962_298_954 217
308 3300061719 Ga0466962_0057707 Ga0466962_0057707_1028_1684 217
309 3300061719 Ga0466962_0060228 Ga0466962_0060228_528_1361 217
310 3300061719 Ga0466962_0069754 Ga0466962_0069754_277_933 217
311 3300025915 Ga0207693_10496888 Ga0207693_104968882 218
312 3300025916 Ga0207663_10316814 Ga0207663_103168141 218
313 3300026067 Ga0207678_10560765 Ga0207678_105607651 218
314 3300048907 Ga0496104_0183707 Ga0496104_0183707_990_1646 218
315 3300048908 Ga0496105_0005081 Ga0496105_0005081_8129_8785 218
316 3300048909 Ga0496106_0128064 Ga0496106_0128064_830_1486 218
317 3300048910 Ga0496107_0173973 Ga0496107_0173973_385_1041 218
318 3300048911 Ga0496108_0006665 Ga0496108_0006665_4388_5044 218
319 3300048912 Ga0496109_0001361 Ga0496109_0001361_8056_8712 218
320 3300048913 Ga0496110_0000487 Ga0496110_0000487_8599_9255 218
321 3300048914 Ga0496111_0001213 Ga0496111_0001213_8594_9250 218
322 3300048916 Ga0496113_0480954 Ga0496113_0480954_213_869 218
323 3300048917 Ga0496114_0049632 Ga0496114_0049632_2653_3309 218
324 3300049583 Ga0501067_0054241 Ga0501067_0054241_265_921 218
325 3300006931 Ga0097620_101017534 Ga0097620_1010175341 219
326 3300039438 Ga0436360_0135256 Ga0436360_0135256_4204_4872 220
327 3300026075 Ga0207708_10676558 Ga0207708_106765581 221
328 3300049568 Ga0501031_0008294 Ga0501031_0008294_4639_5304 221
329 3300049570 Ga0501033_0162341 Ga0501033_0162341_423_1088 221
330 3300049573 Ga0501037_0099608 Ga0501037_0099608_675_1340 221
331 3300049574 Ga0501038_0078267 Ga0501038_0078267_623_1288 221
332 3300049575 Ga0501039_0007034 Ga0501039_0007034_3607_4272 221
333 3300049576 Ga0501040_0020799 Ga0501040_0020799_2423_3088 221
334 3300049578 Ga0501042_0030812 Ga0501042_0030812_1455_2120 221
335 3300049579 Ga0501043_0066087 Ga0501043_0066087_1655_2320 221
336 3300049580 Ga0501046_0070511 Ga0501046_0070511_732_1397 221
337 3300049582 Ga0501048_0007663 Ga0501048_0007663_1460_2125 221
338 3300049587 Ga0501071_0015212 Ga0501071_0015212_3097_3762 221
339 3300049588 Ga0501072_0043731 Ga0501072_0043731_2530_3195 221
340 3300049590 Ga0501074_0010566 Ga0501074_0010566_4585_5250 221
341 3300049591 Ga0501075_0076521 Ga0501075_0076521_489_1154 221
342 3300049592 Ga0501076_0009148 Ga0501076_0009148_5459_6124 221
343 3300049741 Ga0501079_0066175 Ga0501079_0066175_1385_2050 221
344 3300049742 Ga0501080_0086353 Ga0501080_0086353_1522_2187 221
345 3300049743 Ga0501081_0014636 Ga0501081_0014636_3513_4178 221
346 3300049822 Ga0501035_0080313 Ga0501035_0080313_750_1415 221
347 3300049824 Ga0501045_0013233 Ga0501045_0013233_2471_3136 221
348 3300054114 Ga0501084_0116557 Ga0501084_0116557_1355_2020 221
349 3300060353 Ga0501082_0002732 Ga0501082_0002732_6080_6745 221
350 3300061734 Ga0530510_0006456 Ga0530510_0006456_4656_5321 221
351 3300025939 Ga0207665_10229542 Ga0207665_102295422 222
352 3300049569 Ga0501032_0430662 Ga0501032_0430662_23_712 222
353 3300049573 Ga0501037_0323827 Ga0501037_0323827_190_879 222
354 3300049576 Ga0501040_0209778 Ga0501040_0209778_658_1347 222
355 3300049579 Ga0501043_0532191 Ga0501043_0532191_44_733 222
356 3300049580 Ga0501046_0075180 Ga0501046_0075180_1849_2538 222
357 3300049582 Ga0501048_0259986 Ga0501048_0259986_425_1114 222
358 3300049588 Ga0501072_0305619 Ga0501072_0305619_57_746 222
359 3300049590 Ga0501074_0066039 Ga0501074_0066039_496_1185 222
360 3300049741 Ga0501079_0243477 Ga0501079_0243477_425_1114 222
361 3300049743 Ga0501081_0025411 Ga0501081_0025411_2642_3331 222
362 3300049824 Ga0501045_0337607 Ga0501045_0337607_133_822 222
363 3300054114 Ga0501084_0268144 Ga0501084_0268144_401_1090 222
364 3300061734 Ga0530510_0604464 Ga0530510_0604464_52_741 222
365 3300049568 Ga0501031_0007415 Ga0501031_0007415_717_1409 223
366 3300049568 Ga0501031_0216908 Ga0501031_0216908_351_1079 223
367 3300049569 Ga0501032_0010947 Ga0501032_0010947_606_1298 223
368 3300049570 Ga0501033_0000751 Ga0501033_0000751_23385_24077 223
369 3300049570 Ga0501033_0134242 Ga0501033_0134242_524_1252 223
370 3300049572 Ga0501036_0007550 Ga0501036_0007550_2421_3113 223
371 3300049572 Ga0501036_0117499 Ga0501036_0117499_1184_1912 223
372 3300049572 Ga0501036_0144351 Ga0501036_0144351_897_1589 223
373 3300049573 Ga0501037_0011098 Ga0501037_0011098_717_1409 223
374 3300049574 Ga0501038_0014252 Ga0501038_0014252_792_1484 223
375 3300049575 Ga0501039_0003170 Ga0501039_0003170_2312_3004 223
376 3300049576 Ga0501040_0005626 Ga0501040_0005626_5759_6451 223
377 3300049576 Ga0501040_0142529 Ga0501040_0142529_522_1250 223
378 3300049576 Ga0501040_0172820 Ga0501040_0172820_139_831 223
379 3300049576 Ga0501040_0289018 Ga0501040_0289018_374_1111 223
380 3300049577 Ga0501041_0000083 Ga0501041_0000083_737_1429 223
381 3300049577 Ga0501041_0046972 Ga0501041_0046972_1545_2273 223
382 3300049578 Ga0501042_0006467 Ga0501042_0006467_5149_5841 223
383 3300049578 Ga0501042_0096918 Ga0501042_0096918_601_1329 223
384 3300049580 Ga0501046_0013681 Ga0501046_0013681_5712_6404 223
385 3300049580 Ga0501046_0070725 Ga0501046_0070725_447_1175 223
386 3300049581 Ga0501047_0017519 Ga0501047_0017519_5378_6070 223
387 3300049582 Ga0501048_0001274 Ga0501048_0001274_1769_2461 223
388 3300049582 Ga0501048_0093571 Ga0501048_0093571_768_1460 223
389 3300049582 Ga0501048_0264313 Ga0501048_0264313_380_1108 223
390 3300049584 Ga0501068_0000266 Ga0501068_0000266_7259_7951 223
391 3300049584 Ga0501068_0095264 Ga0501068_0095264_650_1378 223
392 3300049585 Ga0501069_0128911 Ga0501069_0128911_416_1108 223
393 3300049586 Ga0501070_0002030 Ga0501070_0002030_11383_12075 223
394 3300049587 Ga0501071_0000179 Ga0501071_0000179_792_1484 223
395 3300049588 Ga0501072_0000870 Ga0501072_0000870_16636_17328 223
396 3300049588 Ga0501072_0234555 Ga0501072_0234555_587_1315 223
397 3300049589 Ga0501073_0004319 Ga0501073_0004319_695_1387 223
398 3300049590 Ga0501074_0010525 Ga0501074_0010525_5363_6055 223
399 3300049590 Ga0501074_0118819 Ga0501074_0118819_612_1340 223
400 3300049591 Ga0501075_0000298 Ga0501075_0000298_19959_20651 223
401 3300049592 Ga0501076_0030134 Ga0501076_0030134_2453_3145 223
402 3300049592 Ga0501076_0114771 Ga0501076_0114771_741_1469 223
403 3300049592 Ga0501076_0195982 Ga0501076_0195982_474_1166 223
404 3300049593 Ga0501077_0000718 Ga0501077_0000718_13578_14270 223
405 3300049741 Ga0501079_0001566 Ga0501079_0001566_14822_15514 223
406 3300049741 Ga0501079_0145329 Ga0501079_0145329_1130_1822 223
407 3300049741 Ga0501079_0151966 Ga0501079_0151966_504_1232 223
408 3300049742 Ga0501080_0000450 Ga0501080_0000450_7251_7943 223
409 3300049742 Ga0501080_0222737 Ga0501080_0222737_470_1162 223
410 3300049743 Ga0501081_0000447 Ga0501081_0000447_2015_2707 223
411 3300049743 Ga0501081_0152810 Ga0501081_0152810_511_1203 223
412 3300049743 Ga0501081_0271038 Ga0501081_0271038_15_707 223
413 3300049744 Ga0501083_0008619 Ga0501083_0008619_5759_6451 223
414 3300049744 Ga0501083_0377192 Ga0501083_0377192_165_902 223
415 3300049822 Ga0501035_0015755 Ga0501035_0015755_941_1633 223
416 3300049822 Ga0501035_0293341 Ga0501035_0293341_27_719 223
417 3300049823 Ga0501044_0211897 Ga0501044_0211897_792_1484 223
418 3300049824 Ga0501045_0003128 Ga0501045_0003128_5759_6451 223
419 3300049824 Ga0501045_0049421 Ga0501045_0049421_725_1453 223
420 3300049824 Ga0501045_0090156 Ga0501045_0090156_712_1404 223
421 3300054114 Ga0501084_0008560 Ga0501084_0008560_7053_7745 223
422 3300054114 Ga0501084_0067535 Ga0501084_0067535_1540_2268 223
423 3300059424 Ga0590075_044865 Ga0590075_044865_260_952 223
424 3300060353 Ga0501082_0005344 Ga0501082_0005344_5643_6335 223
425 3300060353 Ga0501082_0159404 Ga0501082_0159404_792_1520 223
426 3300061734 Ga0530510_0002824 Ga0530510_0002824_9478_10170 223
427 3300061734 Ga0530510_0062373 Ga0530510_0062373_1439_2167 223
428 3300005564 Ga0070664_100618136 Ga0070664_1006181361 226
429 3300049587 Ga0501071_0181291 Ga0501071_0181291_481_1167 226
430 3300049590 Ga0501074_0502696 Ga0501074_0502696_80_766 226
431 3300049741 Ga0501079_0377727 Ga0501079_0377727_208_894 226
432 3300013307 Ga0157372_10010768 Ga0157372_100107685 228
433 3300005327 Ga0070658_10010313 Ga0070658_100103139 229
434 3300005329 Ga0070683_100192959 Ga0070683_1001929591 229
435 3300005331 Ga0070670_100377520 Ga0070670_1003775202 229
436 3300005333 Ga0070677_10351284 Ga0070677_103512841 229
437 3300005336 Ga0070680_100332000 Ga0070680_1003320002 229
438 3300005338 Ga0068868_100004283 Ga0068868_1000042836 229
439 3300005338 Ga0068868_100257198 Ga0068868_1002571982 229
440 3300005339 Ga0070660_100061865 Ga0070660_1000618653 229
441 3300005339 Ga0070660_100195937 Ga0070660_1001959372 229
442 3300005340 Ga0070689_100065489 Ga0070689_1000654892 229
443 3300005343 Ga0070687_100367966 Ga0070687_1003679662 229
444 3300005344 Ga0070661_100581575 Ga0070661_1005815752 229
445 3300005347 Ga0070668_100139945 Ga0070668_1001399452 229
446 3300005347 Ga0070668_100771013 Ga0070668_1007710131 229
447 3300005355 Ga0070671_100287221 Ga0070671_1002872212 229
448 3300005438 Ga0070701_10167403 Ga0070701_101674032 229
449 3300005440 Ga0070705_100432741 Ga0070705_1004327411 229
450 3300005441 Ga0070700_100091121 Ga0070700_1000911212 229
451 3300005444 Ga0070694_100070587 Ga0070694_1000705873 229
452 3300005455 Ga0070663_100184932 Ga0070663_1001849322 229
453 3300005456 Ga0070678_100045254 Ga0070678_1000452544 229
454 3300005457 Ga0070662_100136356 Ga0070662_1001363563 229
455 3300005457 Ga0070662_100261048 Ga0070662_1002610481 229
456 3300005458 Ga0070681_10302969 Ga0070681_103029692 229
457 3300005459 Ga0068867_100034920 Ga0068867_1000349203 229
458 3300005530 Ga0070679_100157019 Ga0070679_1001570192 229
459 3300005535 Ga0070684_100382847 Ga0070684_1003828472 229
460 3300005539 Ga0068853_100099945 Ga0068853_1000999453 229
461 3300005539 Ga0068853_100472522 Ga0068853_1004725222 229
462 3300005544 Ga0070686_100102752 Ga0070686_1001027521 229
463 3300005546 Ga0070696_100207395 Ga0070696_1002073952 229
464 3300005547 Ga0070693_100116362 Ga0070693_1001163623 229
465 3300005563 Ga0068855_100040162 Ga0068855_1000401621 229
466 3300005577 Ga0068857_100583235 Ga0068857_1005832352 229
467 3300005578 Ga0068854_100253198 Ga0068854_1002531982 229
468 3300005617 Ga0068859_100480103 Ga0068859_1004801032 229
469 3300005618 Ga0068864_100241633 Ga0068864_1002416332 229
470 3300005719 Ga0068861_100197183 Ga0068861_1001971831 229
471 3300005840 Ga0068870_10116039 Ga0068870_101160392 229
472 3300005840 Ga0068870_10563988 Ga0068870_105639881 229
473 3300005841 Ga0068863_100206049 Ga0068863_1002060492 229
474 3300005843 Ga0068860_100635763 Ga0068860_1006357632 229
475 3300005985 Ga0081539_10000452 Ga0081539_1000045241 229
476 3300006358 Ga0068871_100064871 Ga0068871_1000648715 229
477 3300006881 Ga0068865_100159879 Ga0068865_1001598792 229
478 3300006931 Ga0097620_100480106 Ga0097620_1004801062 229
479 3300009094 Ga0111539_10129457 Ga0111539_101294574 229
480 3300009094 Ga0111539_10417988 Ga0111539_104179881 229
481 3300009098 Ga0105245_10159326 Ga0105245_101593262 229
482 3300009148 Ga0105243_10064215 Ga0105243_100642155 229
483 3300009148 Ga0105243_10298539 Ga0105243_102985392 229
484 3300009176 Ga0105242_10036840 Ga0105242_100368404 229
485 3300009177 Ga0105248_10172047 Ga0105248_101720472 229
486 3300009551 Ga0105238_10456885 Ga0105238_104568852 229
487 3300009553 Ga0105249_10318177 Ga0105249_103181773 229
488 3300010375 Ga0105239_10205963 Ga0105239_102059633 229
489 3300013102 Ga0157371_10040626 Ga0157371_100406263 229
490 3300013296 Ga0157374_10161448 Ga0157374_101614484 229
491 3300013307 Ga0157372_10024334 Ga0157372_100243346 229
492 3300013307 Ga0157372_10040888 Ga0157372_100408889 229
493 3300014325 Ga0163163_10472068 Ga0163163_104720682 229
494 3300014968 Ga0157379_10122474 Ga0157379_101224742 229
495 3300020081 Ga0206354_11692940 Ga0206354_116929402 229
496 3300025907 Ga0207645_10058818 Ga0207645_100588182 229
497 3300025908 Ga0207643_10010675 Ga0207643_100106755 229
498 3300025908 Ga0207643_10153494 Ga0207643_101534942 229
499 3300025918 Ga0207662_10030248 Ga0207662_100302482 229
500 3300025919 Ga0207657_10029136 Ga0207657_100291369 229
501 3300025919 Ga0207657_10118569 Ga0207657_101185691 229
502 3300025922 Ga0207646_10368398 Ga0207646_103683982 229
503 3300025924 Ga0207694_10590108 Ga0207694_105901081 229
504 3300025926 Ga0207659_10048518 Ga0207659_100485183 229
505 3300025927 Ga0207687_10085999 Ga0207687_100859992 229
506 3300025933 Ga0207706_10038724 Ga0207706_100387243 229
507 3300025933 Ga0207706_10061709 Ga0207706_100617093 229
508 3300025934 Ga0207686_10241583 Ga0207686_102415832 229
509 3300025938 Ga0207704_10050240 Ga0207704_100502402 229
510 3300025940 Ga0207691_10027573 Ga0207691_100275735 229
511 3300025942 Ga0207689_10235375 Ga0207689_102353752 229
512 3300025960 Ga0207651_10069472 Ga0207651_100694725 229
513 3300025981 Ga0207640_10210709 Ga0207640_102107092 229
514 3300025981 Ga0207640_10758419 Ga0207640_107584192 229
515 3300026023 Ga0207677_10288921 Ga0207677_102889212 229
516 3300026035 Ga0207703_10341391 Ga0207703_103413912 229
517 3300026067 Ga0207678_10147770 Ga0207678_101477703 229
518 3300026067 Ga0207678_10465517 Ga0207678_104655172 229
519 3300026075 Ga0207708_10020388 Ga0207708_100203885 229
520 3300026116 Ga0207674_10020017 Ga0207674_100200175 229
521 3300026121 Ga0207683_10156570 Ga0207683_101565702 229
522 3300027907 Ga0207428_10219443 Ga0207428_102194431 229
523 3300027907 Ga0207428_10228593 Ga0207428_102285932 229
524 3300034820 Ga0373959_0027481 Ga0373959_0027481_224_913 229
525 3300035114 Ga0373939_0112090 Ga0373939_0112090_224_913 229
526 3300048906 Ga0496103_0189562 Ga0496103_0189562_88_777 229
527 3300048908 Ga0496105_0442569 Ga0496105_0442569_112_801 229
528 3300048909 Ga0496106_0245722 Ga0496106_0245722_398_1087 229
529 3300048910 Ga0496107_0091469 Ga0496107_0091469_1256_1945 229
530 3300048913 Ga0496110_0062401 Ga0496110_0062401_1394_2083 229
531 3300048914 Ga0496111_0187559 Ga0496111_0187559_664_1353 229
532 3300048918 Ga0496115_0589701 Ga0496115_0589701_150_839 229
533 3300049568 Ga0501031_0050008 Ga0501031_0050008_1495_2184 229
534 3300049570 Ga0501033_0044434 Ga0501033_0044434_792_1481 229
535 3300049572 Ga0501036_0022004 Ga0501036_0022004_2110_2799 229
536 3300049572 Ga0501036_0134004 Ga0501036_0134004_688_1377 229
537 3300049574 Ga0501038_0128577 Ga0501038_0128577_1236_1925 229
538 3300049575 Ga0501039_0009041 Ga0501039_0009041_3920_4609 229
539 3300049576 Ga0501040_0016666 Ga0501040_0016666_2121_2810 229
540 3300049577 Ga0501041_0019999 Ga0501041_0019999_1954_2643 229
541 3300049579 Ga0501043_0052770 Ga0501043_0052770_47_736 229
542 3300049580 Ga0501046_0288625 Ga0501046_0288625_144_833 229
543 3300049582 Ga0501048_0022993 Ga0501048_0022993_541_1230 229
544 3300049586 Ga0501070_0026233 Ga0501070_0026233_2390_3079 229
545 3300049587 Ga0501071_0046574 Ga0501071_0046574_2131_2820 229
546 3300049588 Ga0501072_0042320 Ga0501072_0042320_2183_2872 229
547 3300049588 Ga0501072_0784819 Ga0501072_0784819_47_736 229
548 3300049589 Ga0501073_0043371 Ga0501073_0043371_879_1568 229
549 3300049590 Ga0501074_0007927 Ga0501074_0007927_4661_5350 229
550 3300049590 Ga0501074_0209255 Ga0501074_0209255_407_1096 229
551 3300049591 Ga0501075_0121402 Ga0501075_0121402_877_1566 229
552 3300049592 Ga0501076_0005397 Ga0501076_0005397_3328_4017 229
553 3300049593 Ga0501077_0053641 Ga0501077_0053641_1860_2549 229
554 3300049593 Ga0501077_0093304 Ga0501077_0093304_248_937 229
555 3300049741 Ga0501079_0293315 Ga0501079_0293315_235_924 229
556 3300049743 Ga0501081_0113712 Ga0501081_0113712_394_1083 229
557 3300049744 Ga0501083_0021582 Ga0501083_0021582_489_1178 229
558 3300049823 Ga0501044_0106019 Ga0501044_0106019_436_1125 229
559 3300050511 nmdc:mga08y16_158838_c1 nmdc:mga08y16_158838_c1_1237_1926 229
560 3300050511 nmdc:mga08y16_303386_c1 nmdc:mga08y16_303386_c1_268_957 229
561 3300054114 Ga0501084_0128113 Ga0501084_0128113_742_1431 229
562 3300060353 Ga0501082_0087914 Ga0501082_0087914_1252_1941 229
563 3300061734 Ga0530510_0014787 Ga0530510_0014787_2199_2888 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10728

DUF2520

Domain of unknown function (DUF2520)

139

255

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d1l-assembly1.cif.gz_B crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis 0.8208 1 220
2i76-assembly1.cif.gz_B crystal structure of protein tm1727 from thermotoga maritima 0.801 5 222
3d1l-assembly1.cif.gz_B crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis 0.7889 1 220
2i76-assembly1.cif.gz_A crystal structure of protein tm1727 from thermotoga maritima 0.7692 5 226
2i76-assembly1.cif.gz_B crystal structure of protein tm1727 from thermotoga maritima 0.7631 5 222
ID Description Score Start End Superfamily
af_O06279_7_172_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8726 4 125 3.40.50.720
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.839 4 127 3.40.50.720
af_P9WPZ9_10_289_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8206 4 62 3.50.50.60
af_O69721_5_180_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8068 2 130 3.40.50.720
3d1lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7766 3 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W0SK36-F1-model_v4 DUF2520 domain-containing protein 0.9752 32 223
AF-A0A7W0S275-F1-model_v4 Uncharacterized protein 0.9736 20 117
AF-A0A538JYS5-F1-model_v4 DUF2520 domain-containing protein 0.9724 3 228
AF-A0A538EIS6-F1-model_v4 DUF2520 domain-containing protein 0.9718 3 219
AF-A0A3N5GNB7-F1-model_v4 DUF2520 domain-containing protein 0.9717 1 217

Feature Viewer

pLDDT pTM Quality
94.74 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map