metagRoot

F464074

General Info

Members	Datasets	Scaffolds	Average Seq Length
563	265	563	224

Family's Representative Sequence

Representative Sequence	3300038443\|Ga0395901_0346772\|Ga0395901_0346772_530_1264
Length	244
Sequence	MSSPTGADSARLKQREKRPQSILFDVDGLLITTGGAGTRSWRWAFDELYGIPADIGEFTESGMTDPVVGRLTFTAVIGHEPSAEELARVVSHYLMRLPEEVAQSPGYRVLAGVEELLPRLCRDGFLLGITTGAVEAAAHIKLARANLNRFFSFGGYGSDSADRGELTRKAIARAGEILGAPLDPHRTLVVGDTPKDIAAAHAARAIGVGVASGHYSEDDLREAGADYVLASLEEELPGTAEAVA

Samples

	Sample ID	Description	Type	Environment
1	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
2	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
3	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
4	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
5	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
6	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
7	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
8	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
9	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
12	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
13	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
14	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
15	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
20	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
21	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
22	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
23	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
24	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
25	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
26	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
27	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
28	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
29	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
30	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
31	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
32	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
33	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
34	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
35	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
36	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
37	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
38	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
39	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
40	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
41	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
42	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
43	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
44	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
45	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
46	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
47	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
48	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
49	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
50	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
51	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
52	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
53	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
54	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
55	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
56	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
57	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
58	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
59	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
61	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
63	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
64	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
65	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
66	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
67	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
68	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
69	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
70	3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Metagenome	Rhizosphere
71	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
72	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
73	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
74	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
75	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
76	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
77	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
78	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
79	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
80	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
81	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
82	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
83	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
84	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
126	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
128	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
129	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
130	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
131	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
132	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
133	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
134	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
135	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
136	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
137	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
138	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
139	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
140	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
141	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
142	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
143	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
144	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
145	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
146	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
147	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
148	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
149	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
150	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
151	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
152	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
153	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
154	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
155	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
156	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
157	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
158	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
159	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
160	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
161	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
162	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
163	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
164	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
165	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
166	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
167	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
168	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
169	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
170	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
171	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
172	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
173	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
174	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
175	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
176	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
177	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
178	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
179	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
180	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
181	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
182	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
183	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
184	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
185	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
186	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
187	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
188	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
189	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
190	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
191	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
192	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
193	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
194	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
195	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
196	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
197	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
198	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
199	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
200	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
201	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
202	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
203	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
204	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
205	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
206	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
207	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
208	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
209	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
210	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
211	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
212	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
213	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
214	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
215	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
216	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
217	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
218	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
219	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
220	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
221	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
222	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
232	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
234	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
238	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
240	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
241	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
242	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
243	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
244	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
245	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
247	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
254	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
255	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
256	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
257	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
258	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
259	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
260	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
261	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
262	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
263	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
264	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
265	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.82
Metatranscriptomes	0.18
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.36
Nodule	0
Rhizoplane	9.24
Rhizosphere	90.41
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1000015	3300001977	Bacteria	16109
2	JGI25407J50210_10016608	3300003373	Bacteria	1907
3	JGI25407J50210_10021877	3300003373	Bacteria	1662
4	Ga0070658_10000934	3300005327	Bacteria	25019
5	Ga0070658_10043238	3300005327	Bacteria	3640
6	Ga0070658_10501730	3300005327	Bacteria	1048
7	Ga0070676_10038219	3300005328	Bacteria	2772
8	Ga0070683_100081660	3300005329	Bacteria	3027
9	Ga0070670_100142333	3300005331	Bacteria	2074
10	Ga0070677_10000007	3300005333	Bacteria	74721
11	Ga0068869_100048730	3300005334	Bacteria	3065
12	Ga0070666_10151484	3300005335	Bacteria	1618
13	Ga0070666_10285617	3300005335	Bacteria	1173
14	Ga0070680_100001855	3300005336	Bacteria	15493
15	Ga0070680_100006862	3300005336	Bacteria	8684
16	Ga0070680_100071815	3300005336	Bacteria	2845
17	Ga0070680_100091186	3300005336	Bacteria	2523
18	Ga0070682_100302920	3300005337	Bacteria	1174
19	Ga0068868_100004176	3300005338	Bacteria	10099
20	Ga0068868_100113705	3300005338	Bacteria	2202
21	Ga0070660_100005733	3300005339	Bacteria	8600
22	Ga0070660_100013628	3300005339	Bacteria	5841
23	Ga0070660_100152950	3300005339	Bacteria	1856
24	Ga0070660_100348007	3300005339	Bacteria	1220
25	Ga0070660_100373176	3300005339	Bacteria	1177
26	Ga0070691_10344012	3300005341	Bacteria	826
27	Ga0070668_100135579	3300005347	Bacteria	1980
28	Ga0070674_100000001	3300005356	Bacteria	277173
29	Ga0070674_100000026	3300005356	Bacteria	77168
30	Ga0070674_100002750	3300005356	Bacteria	9724
31	Ga0070673_100002141	3300005364	Bacteria	11965
32	Ga0070659_100077795	3300005366	Bacteria	2646
33	Ga0070659_100211536	3300005366	Bacteria	1598
34	Ga0070667_100237984	3300005367	Bacteria	1625
35	Ga0070667_100359537	3300005367	Bacteria	1319
36	Ga0070667_100876028	3300005367	Bacteria	835
37	Ga0070709_10225314	3300005434	Bacteria	1339
38	Ga0070714_100093293	3300005435	Bacteria	2640
39	Ga0070714_100220842	3300005435	Bacteria	1741
40	Ga0070713_100000061	3300005436	Bacteria	68662
41	Ga0070713_100491856	3300005436	Bacteria	1157
42	Ga0070713_100524403	3300005436	Bacteria	1120
43	Ga0070710_10303411	3300005437	Bacteria	1043
44	Ga0070711_100008534	3300005439	Bacteria	6280
45	Ga0070711_100061938	3300005439	Bacteria	2606
46	Ga0070711_100186108	3300005439	Bacteria	1592
47	Ga0070711_100314583	3300005439	Bacteria	1249
48	Ga0070711_100541964	3300005439	Bacteria	964
49	Ga0070700_100048270	3300005441	Bacteria	2638
50	Ga0070700_100147404	3300005441	Bacteria	1606
51	Ga0070708_100459787	3300005445	Unclassified	1201
52	Ga0070678_100152316	3300005456	Bacteria	1864
53	Ga0070662_100252964	3300005457	Bacteria	1417
54	Ga0070681_10001085	3300005458	Bacteria	23213
55	Ga0070681_10002068	3300005458	Bacteria	18207
56	Ga0070681_10019014	3300005458	Bacteria	6875
57	Ga0070681_10171434	3300005458	Bacteria	2092
58	Ga0070681_10190448	3300005458	Bacteria	1971
59	Ga0070681_10211039	3300005458	Bacteria	1858
60	Ga0068867_100000246	3300005459	Bacteria	35737
61	Ga0068867_100233082	3300005459	Bacteria	1489
62	Ga0068867_100345379	3300005459	Bacteria	1240
63	Ga0070707_100020070	3300005468	Bacteria	6302
64	Ga0070698_100174397	3300005471	Bacteria	2090
65	Ga0070698_100225807	3300005471	Bacteria	1806
66	Ga0070699_100416938	3300005518	Bacteria	1215
67	Ga0070679_100000306	3300005530	Bacteria	41768
68	Ga0070679_100018146	3300005530	Bacteria	6823
69	Ga0070679_100081554	3300005530	Bacteria	3224
70	Ga0070679_100317292	3300005530	Bacteria	1508
71	Ga0070679_100424400	3300005530	Unclassified	1275
72	Ga0070684_100188777	3300005535	Bacteria	1875
73	Ga0070684_100401371	3300005535	Bacteria	1264
74	Ga0070686_100063556	3300005544	Bacteria	2391
75	Ga0070693_100018373	3300005547	Bacteria	3651
76	Ga0070665_100224310	3300005548	Bacteria	1880
77	Ga0070704_100077547	3300005549	Bacteria	2434
78	Ga0068855_100003430	3300005563	Bacteria	19392
79	Ga0068855_100027470	3300005563	Bacteria	6806
80	Ga0068855_100056716	3300005563	Bacteria	4594
81	Ga0068855_100098936	3300005563	Bacteria	3360
82	Ga0068856_100026694	3300005614	Bacteria	5631
83	Ga0068856_100091968	3300005614	Bacteria	3018
84	Ga0068856_100483625	3300005614	Bacteria	1259
85	Ga0068852_100494634	3300005616	Bacteria	1217
86	Ga0068866_10000006	3300005718	Bacteria	176129
87	Ga0068866_10000234	3300005718	Bacteria	26134
88	Ga0068866_10062302	3300005718	Bacteria	1940
89	Ga0068866_10140050	3300005718	Unclassified	1387
90	Ga0068861_100203822	3300005719	Unclassified	1662
91	Ga0068861_100220106	3300005719	Bacteria	1604
92	Ga0068861_100469883	3300005719	Bacteria	1131
93	Ga0068861_100519819	3300005719	Bacteria	1079
94	Ga0068860_100021006	3300005843	Bacteria	6326
95	Ga0081455_10098723	3300005937	Bacteria	2350
96	Ga0081455_10110329	3300005937	Bacteria	2187
97	Ga0081538_10000112	3300005981	Bacteria	81614
98	Ga0081540_1000733	3300005983	Bacteria	30225
99	Ga0081540_1009607	3300005983	Bacteria	6652
100	Ga0070717_10617476	3300006028	Bacteria	984
101	Ga0070715_10000003	3300006163	Bacteria	345282
102	Ga0070715_10176899	3300006163	Bacteria	1067
103	Ga0070716_100037546	3300006173	Bacteria	2678
104	Ga0070712_100252231	3300006175	Bacteria	1410
105	Ga0070712_100422922	3300006175	Bacteria	1104
106	Ga0075428_100102774	3300006844	Bacteria	3117
107	Ga0075428_101306980	3300006844	Unclassified	763
108	Ga0075430_100079612	3300006846	Unclassified	2745
109	Ga0075431_100010590	3300006847	Bacteria	9273
110	Ga0075431_100073969	3300006847	Bacteria	3516
111	Ga0068865_100267958	3300006881	Bacteria	1355
112	Ga0075436_100698370	3300006914	Bacteria	751
113	Ga0105240_10599493	3300009093	Bacteria	1213
114	Ga0105240_10786266	3300009093	Bacteria	1032
115	Ga0111539_10450121	3300009094	Bacteria	1499
116	Ga0111539_10593920	3300009094	Bacteria	1289
117	Ga0111539_10681842	3300009094	Bacteria	1196
118	Ga0105245_10000049	3300009098	Bacteria	128277
119	Ga0105245_10001823	3300009098	Bacteria	19389
120	Ga0105245_10029566	3300009098	Bacteria	4843
121	Ga0114129_10007822	3300009147	Bacteria	15209
122	Ga0114129_10055679	3300009147	Bacteria	5542
123	Ga0114129_10321796	3300009147	Bacteria	2056
124	Ga0105243_10154136	3300009148	Unclassified	1974
125	Ga0105241_10033253	3300009174	Bacteria	3870
126	Ga0105242_10000398	3300009176	Bacteria	34481
127	Ga0105242_10014838	3300009176	Bacteria	6035
128	Ga0105242_10148821	3300009176	Bacteria	2040
129	Ga0105237_10078260	3300009545	Bacteria	3296
130	Ga0105238_10007177	3300009551	Bacteria	11144
131	Ga0105238_10851365	3300009551	Unclassified	929
132	Ga0105249_10027692	3300009553	Bacteria	5114
133	Ga0105249_10311175	3300009553	Bacteria	1583
134	Ga0105239_10014659	3300010375	Bacteria	8693
135	Ga0105239_10095546	3300010375	Bacteria	3283
136	Ga0105239_10415241	3300010375	Bacteria	1524
137	Ga0105246_10002549	3300011119	Bacteria	11008
138	Ga0157335_1004012	3300012492	Unclassified	971
139	Ga0157371_10075907	3300013102	Bacteria	2380
140	Ga0157370_10037719	3300013104	Bacteria	4681
141	Ga0157370_10405716	3300013104	Bacteria	1254
142	Ga0157369_10194121	3300013105	Bacteria	2133
143	Ga0157369_10871225	3300013105	Bacteria	924
144	Ga0157374_10004554	3300013296	Bacteria	11630
145	Ga0157374_10371815	3300013296	Bacteria	1423
146	Ga0157374_10643213	3300013296	Bacteria	1072
147	Ga0163162_11174538	3300013306	Bacteria	871
148	Ga0157372_10014701	3300013307	Bacteria	8376
149	Ga0157372_10153595	3300013307	Bacteria	2658
150	Ga0157375_10003759	3300013308	Bacteria	13161
151	Ga0157375_10121481	3300013308	Bacteria	2722
152	Ga0157375_10173081	3300013308	Bacteria	2307
153	Ga0163163_10006317	3300014325	Bacteria	10347
154	Ga0157377_10010792	3300014745	Bacteria	4534
155	Ga0157377_10133049	3300014745	Bacteria	1521
156	Ga0157379_10020475	3300014968	Bacteria	5849
157	Ga0157379_10285928	3300014968	Bacteria	1501
158	Ga0157376_10003914	3300014969	Bacteria	10295
159	Ga0163161_10236937	3300017792	Bacteria	1418
160	Ga0206353_10014688	3300020082	Bacteria	15094
161	Ga0207682_10000007	3300025893	Bacteria	88967
162	Ga0207642_10000001	3300025899	Bacteria	714030
163	Ga0207642_10000003	3300025899	Bacteria	650651
164	Ga0207642_10000004	3300025899	Bacteria	407822
165	Ga0207642_10000022	3300025899	Bacteria	54810
166	Ga0207642_10017519	3300025899	Unclassified	2727
167	Ga0207642_10029023	3300025899	Bacteria	2286
168	Ga0207688_10003838	3300025901	Bacteria	8204
169	Ga0207680_10281489	3300025903	Bacteria	1155
170	Ga0207685_10000003	3300025905	Bacteria	344527
171	Ga0207699_10230664	3300025906	Bacteria	1268
172	Ga0207645_10039622	3300025907	Bacteria	3019
173	Ga0207705_10005819	3300025909	Bacteria	9182
174	Ga0207705_10026100	3300025909	Bacteria	4169
175	Ga0207705_10040098	3300025909	Bacteria	3357
176	Ga0207705_10408383	3300025909	Bacteria	1051
177	Ga0207654_10081555	3300025911	Bacteria	1948
178	Ga0207707_10000270	3300025912	Bacteria	55930
179	Ga0207707_10031073	3300025912	Bacteria	4672
180	Ga0207707_10066201	3300025912	Bacteria	3146
181	Ga0207707_10116602	3300025912	Bacteria	2334
182	Ga0207707_10172662	3300025912	Bacteria	1889
183	Ga0207693_10005370	3300025915	Bacteria	10708
184	Ga0207693_10362833	3300025915	Bacteria	1133
185	Ga0207663_10006177	3300025916	Bacteria	6105
186	Ga0207663_10041601	3300025916	Bacteria	2802
187	Ga0207663_10072500	3300025916	Bacteria	2226
188	Ga0207663_10190826	3300025916	Bacteria	1471
189	Ga0207660_10002517	3300025917	Bacteria	12045
190	Ga0207660_10060830	3300025917	Bacteria	2717
191	Ga0207660_10155748	3300025917	Bacteria	1759
192	Ga0207657_10011538	3300025919	Bacteria	8771
193	Ga0207657_10055165	3300025919	Bacteria	3434
194	Ga0207657_10255482	3300025919	Bacteria	1396
195	Ga0207657_10503964	3300025919	Bacteria	948
196	Ga0207652_10000251	3300025921	Bacteria	55866
197	Ga0207652_10018256	3300025921	Bacteria	5752
198	Ga0207652_10040359	3300025921	Bacteria	3964
199	Ga0207652_10204805	3300025921	Bacteria	1776
200	Ga0207646_10026800	3300025922	Bacteria	5257
201	Ga0207681_10087213	3300025923	Bacteria	2220
202	Ga0207694_10003513	3300025924	Bacteria	12440
203	Ga0207687_10000012	3300025927	Bacteria	370729
204	Ga0207687_10002016	3300025927	Bacteria	13927
205	Ga0207687_10352640	3300025927	Bacteria	1199
206	Ga0207700_10000016	3300025928	Bacteria	202434
207	Ga0207700_10586158	3300025928	Bacteria	992
208	Ga0207690_10012525	3300025932	Bacteria	5075
209	Ga0207690_10152442	3300025932	Bacteria	1714
210	Ga0207686_10000322	3300025934	Bacteria	34436
211	Ga0207686_10091146	3300025934	Bacteria	2013
212	Ga0207686_10116364	3300025934	Bacteria	1812
213	Ga0207709_10056748	3300025935	Unclassified	2425
214	Ga0207709_10105285	3300025935	Bacteria	1874
215	Ga0207669_10000002	3300025937	Bacteria	377651
216	Ga0207669_10000041	3300025937	Bacteria	67085
217	Ga0207704_10089894	3300025938	Bacteria	2013
218	Ga0207665_10025680	3300025939	Unclassified	3888
219	Ga0207689_10017336	3300025942	Bacteria	6095
220	Ga0207661_10087318	3300025944	Bacteria	2590
221	Ga0207661_10109187	3300025944	Bacteria	2337
222	Ga0207667_10004513	3300025949	Bacteria	17060
223	Ga0207667_10186384	3300025949	Bacteria	2130
224	Ga0207667_10324386	3300025949	Bacteria	1572
225	Ga0207651_10000172	3300025960	Bacteria	28069
226	Ga0207712_10000003	3300025961	Bacteria	615314
227	Ga0207712_10059553	3300025961	Bacteria	2703
228	Ga0207712_10438787	3300025961	Bacteria	1105
229	Ga0207668_10245948	3300025972	Bacteria	1450
230	Ga0207640_10004533	3300025981	Bacteria	7541
231	Ga0207640_10042098	3300025981	Bacteria	2910
232	Ga0207658_10215440	3300025986	Bacteria	1612
233	Ga0207658_10738164	3300025986	Bacteria	891
234	Ga0207677_10116935	3300026023	Bacteria	1997
235	Ga0207708_10047893	3300026075	Bacteria	3253
236	Ga0207708_10479351	3300026075	Bacteria	1040
237	Ga0207708_10552664	3300026075	Unclassified	971
238	Ga0207702_10001991	3300026078	Bacteria	19831
239	Ga0207702_10328217	3300026078	Unclassified	1459
240	Ga0207648_10000783	3300026089	Bacteria	35821
241	Ga0207648_10617344	3300026089	Bacteria	1000
242	Ga0207675_100572112	3300026118	Bacteria	1131
243	Ga0207683_10040970	3300026121	Bacteria	4043
244	Ga0207683_10119320	3300026121	Bacteria	2366
245	Ga0207698_10046126	3300026142	Bacteria	3288
246	Ga0207428_10010456	3300027907	Bacteria	8287
247	Ga0268264_10010113	3300028381	Bacteria	7807
248	Ga0316576_10348853	3300031727	Bacteria	1101
249	Ga0316578_10065920	3300031728	Bacteria	2139
250	Ga0316577_10307353	3300031733	Bacteria	898
251	Ga0307409_100112119	3300031995	Bacteria	2289
252	Ga0373926_0088052	3300035083	Bacteria	1153
253	Ga0373944_0022267	3300035089	Bacteria	1840
254	Ga0373945_0024561	3300035116	Bacteria	2089
255	Ga0373954_0233354	3300035118	Bacteria	905
256	Ga0373957_0152888	3300035120	Bacteria	948
257	Ga0373943_0022625	3300035170	Bacteria	2915
258	Ga0373943_0123061	3300035170	Bacteria	1380
259	Ga0373935_0114000	3300035692	Bacteria	1798
260	Ga0373935_0285140	3300035692	Bacteria	1163
261	Ga0373933_0131921	3300035724	Bacteria	1572
262	Ga0373947_0024750	3300035725	Bacteria	3500
263	Ga0373937_0006399	3300036401	Bacteria	10162
264	Ga0373937_0046858	3300036401	Bacteria	3954
265	Ga0373937_0060080	3300036401	Bacteria	3493
266	Ga0373937_0552434	3300036401	Bacteria	1094
267	Ga0316584_0006063	3300036712	Bacteria	8169
268	Ga0373925_0004969	3300037068	Bacteria	9985
269	Ga0395899_0019264	3300037312	Bacteria	5186
270	Ga0395899_0388015	3300037312	Bacteria	927
271	Ga0395900_0020881	3300037418	Bacteria	6691
272	Ga0395900_0062936	3300037418	Bacteria	3813
273	Ga0395900_0083778	3300037418	Bacteria	3276
274	Ga0395898_0003605	3300037466	Bacteria	17244
275	Ga0395898_0006312	3300037466	Bacteria	12666
276	Ga0395898_0143910	3300037466	Bacteria	2282
277	Ga0395905_0014086	3300037471	Bacteria	7645
278	Ga0395905_0066122	3300037471	Unclassified	3385
279	Ga0395905_0543463	3300037471	Unclassified	1063
280	Ga0395901_0034168	3300038443	Bacteria	5250
281	Ga0395901_0062527	3300038443	Bacteria	3874
282	Ga0395901_0132070	3300038443	Bacteria	2624
283	Ga0395901_0213510	3300038443	Unclassified	2019
284	Ga0395901_0346772	3300038443	Bacteria	1533
285	Ga0395901_0569455	3300038443	Bacteria	1146
286	Ga0395901_0838526	3300038443	Bacteria	905
287	Ga0439439_0020967	3300041406	Bacteria	1626
288	Ga0439452_041283	3300042010	Bacteria	1086
289	Ga0439434_0020870	3300042435	Unclassified	1968
290	Ga0466963_0000025	3300044694	Bacteria	51171
291	Ga0466957_0252371	3300044842	Unclassified	1173
292	Ga0495592_0001399	3300046454	Bacteria	16721
293	Ga0495592_0002851	3300046454	Bacteria	12277
294	Ga0495592_0022941	3300046454	Bacteria	4749
295	Ga0495592_0045817	3300046454	Bacteria	3262
296	Ga0495592_0172763	3300046454	Bacteria	1478
297	Ga0495592_0356229	3300046454	Bacteria	937
298	Ga0495603_0000054	3300046455	Bacteria	49027
299	Ga0495603_0000431	3300046455	Bacteria	23265
300	Ga0495603_0131051	3300046455	Bacteria	1460
301	Ga0495629_0004923	3300046459	Bacteria	10027
302	Ga0495629_0009927	3300046459	Bacteria	6947
303	Ga0495629_0025267	3300046459	Bacteria	4225
304	Ga0495629_0029409	3300046459	Bacteria	3896
305	Ga0495629_0053774	3300046459	Bacteria	2816
306	Ga0495629_0076617	3300046459	Bacteria	2335
307	Ga0495641_0262515	3300046461	Bacteria	777
308	Ga0495651_0000097	3300046462	Bacteria	64676
309	Ga0495651_0018086	3300046462	Bacteria	5457
310	Ga0495651_0181444	3300046462	Bacteria	1489
311	Ga0495651_0235843	3300046462	Bacteria	1257
312	Ga0495653_0003612	3300046463	Bacteria	12475
313	Ga0495653_0011134	3300046463	Bacteria	7356
314	Ga0495653_0040546	3300046463	Bacteria	3639
315	Ga0495580_0060447	3300046472	Bacteria	2662
316	Ga0495582_0000082	3300046473	Bacteria	48118
317	Ga0495582_0005792	3300046473	Bacteria	6884
318	Ga0495639_0002352	3300046475	Bacteria	8264
319	Ga0495639_0033218	3300046475	Unclassified	2304
320	Ga0495662_0000727	3300046476	Bacteria	15735
321	Ga0495662_0002179	3300046476	Bacteria	9848
322	Ga0495662_0144580	3300046476	Bacteria	1171
323	Ga0495662_0144724	3300046476	Bacteria	1170
324	Ga0495594_0005831	3300046499	Bacteria	6327
325	Ga0495594_0032770	3300046499	Bacteria	2822
326	Ga0495608_0001079	3300046511	Bacteria	19249
327	Ga0495608_0002869	3300046511	Bacteria	12337
328	Ga0495608_0020928	3300046511	Bacteria	4493
329	Ga0495608_0045608	3300046511	Bacteria	2920
330	Ga0495608_0393194	3300046511	Bacteria	849
331	Ga0495620_0000158	3300046515	Bacteria	54704
332	Ga0495628_0001325	3300046516	Bacteria	22701
333	Ga0495628_0010085	3300046516	Bacteria	8037
334	Ga0495628_0086318	3300046516	Bacteria	2433
335	Ga0495628_0090637	3300046516	Bacteria	2367
336	Ga0495628_0100581	3300046516	Bacteria	2232
337	Ga0495630_0008554	3300046517	Bacteria	7343
338	Ga0495630_0011576	3300046517	Bacteria	6389
339	Ga0495630_0295700	3300046517	Bacteria	1237
340	Ga0495644_0152921	3300046523	Bacteria	883
341	Ga0495666_0045528	3300046526	Bacteria	2116
342	Ga0495652_0000023	3300046529	Bacteria	168049
343	Ga0495652_0001520	3300046529	Bacteria	25446
344	Ga0495652_0022568	3300046529	Bacteria	5584
345	Ga0495652_0054592	3300046529	Bacteria	3402
346	Ga0495665_0030061	3300046531	Bacteria	2907
347	Ga0495665_0234885	3300046531	Bacteria	946
348	Ga0495640_0006895	3300046533	Bacteria	8948
349	Ga0495586_0070148	3300046535	Bacteria	1913
350	Ga0495587_0000886	3300046536	Bacteria	19796
351	Ga0495587_0007418	3300046536	Bacteria	7102
352	Ga0495587_0140627	3300046536	Bacteria	1378
353	Ga0495587_0304955	3300046536	Bacteria	890
354	Ga0495587_0317867	3300046536	Bacteria	870
355	Ga0495598_0014796	3300046537	Bacteria	1957
356	Ga0495645_0000054	3300046543	Bacteria	84855
357	Ga0495645_0000186	3300046543	Bacteria	44324
358	Ga0495645_0018715	3300046543	Bacteria	4979
359	Ga0495645_0256951	3300046543	Bacteria	1159
360	Ga0495645_0313878	3300046543	Bacteria	1020
361	Ga0495667_0000053	3300046559	Bacteria	105370
362	Ga0495667_0004413	3300046559	Bacteria	9489
363	Ga0495667_0011319	3300046559	Bacteria	6039
364	Ga0495656_0004485	3300046615	Bacteria	4783
365	Ga0495668_0134819	3300046616	Bacteria	1351
366	Ga0495634_0000616	3300046642	Bacteria	34537
367	Ga0495634_0022292	3300046642	Bacteria	4463
368	Ga0495634_0030812	3300046642	Bacteria	3699
369	Ga0495635_0021508	3300046663	Bacteria	4496
370	Ga0495657_0008004	3300046675	Bacteria	8106
371	Ga0495657_0008769	3300046675	Bacteria	7710
372	Ga0495657_0009152	3300046675	Bacteria	7523
373	Ga0495599_0000344	3300046678	Bacteria	27562
374	Ga0495599_0445358	3300046678	Bacteria	767
375	Ga0495623_0000648	3300046679	Bacteria	23078
376	Ga0495623_0231971	3300046679	Bacteria	1046
377	Ga0495646_0067480	3300046680	Bacteria	2114
378	Ga0495646_0074807	3300046680	Bacteria	1987
379	Ga0495647_0003218	3300046681	Bacteria	5226
380	Ga0495647_0013505	3300046681	Bacteria	2830
381	Ga0495647_0019705	3300046681	Bacteria	2415
382	Ga0495647_0116766	3300046681	Bacteria	1119
383	Ga0495658_0000070	3300046683	Bacteria	52450
384	Ga0495658_0010633	3300046683	Bacteria	4606
385	Ga0495669_0000545	3300046684	Bacteria	16848
386	Ga0495613_0100308	3300046689	Bacteria	2091
387	Ga0495624_0035103	3300046690	Bacteria	3238
388	Ga0495624_0152496	3300046690	Bacteria	1413
389	Ga0495670_0002998	3300046691	Bacteria	8330
390	Ga0495600_0011743	3300046809	Bacteria	5466
391	Ga0495600_0020863	3300046809	Bacteria	4192
392	Ga0495600_0326492	3300046809	Bacteria	964
393	Ga0495600_0548771	3300046809	Bacteria	706
394	Ga0495581_0004699	3300047315	Bacteria	7887
395	Ga0495581_0006481	3300047315	Bacteria	6790
396	Ga0495581_0054915	3300047315	Bacteria	2299
397	Ga0495604_0000038	3300047317	Bacteria	123703
398	Ga0495604_0000085	3300047317	Bacteria	81234
399	Ga0495674_0002167	3300047319	Bacteria	19285
400	Ga0495674_0006179	3300047319	Bacteria	11491
401	Ga0495674_0028976	3300047319	Bacteria	5043
402	Ga0495674_0082368	3300047319	Bacteria	2759
403	Ga0495676_0033656	3300047321	Bacteria	4312
404	Ga0495676_0100337	3300047321	Bacteria	2143
405	Ga0495680_0000336	3300047322	Bacteria	52443
406	Ga0495680_0000364	3300047322	Bacteria	50773
407	Ga0495680_0003888	3300047322	Bacteria	14454
408	Ga0495680_0006854	3300047322	Bacteria	10525
409	Ga0495680_0007408	3300047322	Bacteria	10065
410	Ga0495680_0459443	3300047322	Bacteria	870
411	Ga0495675_0000041	3300047444	Bacteria	86087
412	Ga0495675_0141811	3300047444	Bacteria	1489
413	Ga0495679_007063	3300047446	Bacteria	4738
414	Ga0495685_021031	3300047447	Bacteria	2243
415	Ga0495673_0077711	3300047469	Unclassified	1382
416	Ga0495684_0018696	3300047471	Bacteria	5338
417	Ga0495684_0030704	3300047471	Bacteria	4126
418	Ga0495684_0037529	3300047471	Bacteria	3716
419	Ga0495593_0028080	3300047673	Bacteria	3092
420	Ga0495602_0004638	3300048088	Bacteria	14343
421	Ga0495602_0072020	3300048088	Bacteria	2949
422	Ga0495602_0131387	3300048088	Bacteria	1996
423	Ga0495602_0284343	3300048088	Bacteria	1217
424	Ga0495602_0360204	3300048088	Bacteria	1047
425	Ga0495614_0003290	3300048089	Bacteria	7226
426	Ga0496100_0000004	3300048903	Bacteria	321778
427	Ga0496100_0016461	3300048903	Bacteria	4343
428	Ga0496101_0000007	3300048904	Bacteria	321778
429	Ga0496101_0004462	3300048904	Bacteria	8820
430	Ga0496101_0027774	3300048904	Bacteria	3945
431	Ga0496102_0005468	3300048905	Bacteria	10773
432	Ga0496102_0005858	3300048905	Bacteria	10458
433	Ga0496102_0026528	3300048905	Bacteria	5169
434	Ga0496103_0006899	3300048906	Bacteria	6784
435	Ga0496103_0015560	3300048906	Bacteria	4530
436	Ga0496104_0000003	3300048907	Bacteria	669219
437	Ga0496104_0004031	3300048907	Bacteria	12737
438	Ga0496105_0000003	3300048908	Bacteria	713251
439	Ga0496105_0141180	3300048908	Bacteria	1982
440	Ga0496105_0360457	3300048908	Bacteria	1160
441	Ga0496105_0494005	3300048908	Bacteria	961
442	Ga0496106_0000004	3300048909	Bacteria	279896
443	Ga0496106_0010708	3300048909	Bacteria	6778
444	Ga0496106_0341196	3300048909	Unclassified	1203
445	Ga0496107_0000001	3300048910	Bacteria	321778
446	Ga0496107_0005067	3300048910	Bacteria	8978
447	Ga0496107_0023211	3300048910	Bacteria	4385
448	Ga0496107_0197570	3300048910	Bacteria	1495
449	Ga0496108_0000002	3300048911	Bacteria	700890
450	Ga0496108_0000202	3300048911	Bacteria	55115
451	Ga0496108_0012578	3300048911	Bacteria	6894
452	Ga0496108_0018506	3300048911	Bacteria	5704
453	Ga0496109_0000001	3300048912	Bacteria	700852
454	Ga0496109_0000131	3300048912	Bacteria	76860
455	Ga0496109_0032687	3300048912	Bacteria	4678
456	Ga0496109_0090011	3300048912	Bacteria	2838
457	Ga0496109_0251083	3300048912	Bacteria	1666
458	Ga0496110_0000228	3300048913	Bacteria	36482
459	Ga0496110_0037056	3300048913	Bacteria	4237
460	Ga0496110_0054320	3300048913	Bacteria	3523
461	Ga0496110_0498861	3300048913	Bacteria	1108
462	Ga0496111_0009891	3300048914	Bacteria	6373
463	Ga0496111_0016107	3300048914	Bacteria	5148
464	Ga0496111_0016627	3300048914	Bacteria	5073
465	Ga0496111_0370660	3300048914	Bacteria	1059
466	Ga0496112_0000002	3300048915	Bacteria	782039
467	Ga0496112_0008151	3300048915	Bacteria	9362
468	Ga0496112_0030614	3300048915	Bacteria	5210
469	Ga0496112_0258030	3300048915	Bacteria	1693
470	Ga0496112_0287831	3300048915	Bacteria	1589
471	Ga0496113_0000187	3300048916	Bacteria	28120
472	Ga0496113_0017926	3300048916	Bacteria	4923
473	Ga0496113_0041939	3300048916	Bacteria	3379
474	Ga0496113_0050814	3300048916	Bacteria	3092
475	Ga0496113_0430261	3300048916	Bacteria	1060
476	Ga0496114_0006943	3300048917	Bacteria	8920
477	Ga0496115_0038181	3300048918	Bacteria	3809
478	Ga0501031_0240787	3300049568	Bacteria	1176
479	Ga0501032_0000097	3300049569	Bacteria	74345
480	Ga0501032_0013188	3300049569	Bacteria	5881
481	Ga0501033_0000148	3300049570	Bacteria	67792
482	Ga0501033_0014702	3300049570	Bacteria	5941
483	Ga0501034_0000664	3300049571	Bacteria	52408
484	Ga0501036_0000062	3300049572	Bacteria	71065
485	Ga0501036_0006502	3300049572	Bacteria	9495
486	Ga0501036_0017449	3300049572	Bacteria	6000
487	Ga0501037_0002089	3300049573	Bacteria	14480
488	Ga0501037_0013318	3300049573	Bacteria	6061
489	Ga0501038_0000105	3300049574	Bacteria	70723
490	Ga0501038_0210293	3300049574	Unclassified	1556
491	Ga0501039_0026437	3300049575	Bacteria	4460
492	Ga0501039_0575216	3300049575	Bacteria	883
493	Ga0501040_0042578	3300049576	Bacteria	3093
494	Ga0501040_0072142	3300049576	Unclassified	2384
495	Ga0501041_0026731	3300049577	Bacteria	3473
496	Ga0501041_0031470	3300049577	Bacteria	3206
497	Ga0501042_0005176	3300049578	Bacteria	8382
498	Ga0501042_0048511	3300049578	Bacteria	3028
499	Ga0501043_0000117	3300049579	Bacteria	73761
500	Ga0501043_0094073	3300049579	Bacteria	2356
501	Ga0501046_0003133	3300049580	Bacteria	15271
502	Ga0501046_0012363	3300049580	Bacteria	7271
503	Ga0501046_0026657	3300049580	Bacteria	4720
504	Ga0501047_0000338	3300049581	Bacteria	53312
505	Ga0501048_0007705	3300049582	Bacteria	8161
506	Ga0501048_0028145	3300049582	Bacteria	4081
507	Ga0501048_0054351	3300049582	Unclassified	2844
508	Ga0501067_0001444	3300049583	Bacteria	12913
509	Ga0501068_0037714	3300049584	Bacteria	2893
510	Ga0501069_0016810	3300049585	Bacteria	3930
511	Ga0501070_0016060	3300049586	Bacteria	6292
512	Ga0501070_0039707	3300049586	Bacteria	3924
513	Ga0501070_0045856	3300049586	Bacteria	3635
514	Ga0501071_0011900	3300049587	Bacteria	5877
515	Ga0501071_0420019	3300049587	Unclassified	1022
516	Ga0501073_0012030	3300049589	Bacteria	6319
517	Ga0501074_0017107	3300049590	Bacteria	5260
518	Ga0501075_0085299	3300049591	Bacteria	2393
519	Ga0501076_0025922	3300049592	Bacteria	4539
520	Ga0501077_0011583	3300049593	Bacteria	5510
521	Ga0501079_0002250	3300049741	Bacteria	13922
522	Ga0501079_0578444	3300049741	Bacteria	883
523	Ga0501080_0037646	3300049742	Bacteria	4517
524	Ga0501080_0331062	3300049742	Bacteria	1377
525	Ga0501081_0025396	3300049743	Bacteria	3984
526	Ga0501081_0390153	3300049743	Bacteria	1030
527	Ga0501035_0000209	3300049822	Bacteria	70373
528	Ga0501035_0052829	3300049822	Bacteria	3635
529	Ga0501044_0000241	3300049823	Bacteria	69307
530	Ga0501044_0108214	3300049823	Unclassified	2790
531	Ga0501045_0001964	3300049824	Bacteria	13883
532	Ga0501045_0004336	3300049824	Bacteria	9780
533	Ga0501045_0092661	3300049824	Unclassified	2234
534	nmdc:mga05p37_27011_c1	3300050507	Bacteria	6986
535	nmdc:mga05p37_402911_c1	3300050507	Bacteria	1597
536	nmdc:mga0qj67_388471_c1	3300050509	Unclassified	1127
537	nmdc:mga06r32_160278_c1	3300050510	Bacteria	2232
538	nmdc:mga06r32_24414_c1	3300050510	Bacteria	5611
539	nmdc:mga08y16_6742_c1	3300050511	Bacteria	12042
540	nmdc:mga0a205_1_c2	3300050515	Bacteria	266330
541	Ga0495601_0000385	3300053077	Bacteria	23352
542	Ga0495601_0001834	3300053077	Bacteria	11795
543	Ga0495601_0142335	3300053077	Bacteria	1564
544	Ga0495601_0406350	3300053077	Bacteria	882
545	Ga0495612_0000024	3300053078	Bacteria	115718
546	Ga0495612_0009779	3300053078	Bacteria	3886
547	Ga0495612_0014406	3300053078	Bacteria	3179
548	Ga0495612_0102206	3300053078	Bacteria	1221
549	Ga0495612_0178076	3300053078	Bacteria	933
550	Ga0495595_0000262	3300053084	Bacteria	20924
551	Ga0495595_0097702	3300053084	Bacteria	1415
552	Ga0495595_0140873	3300053084	Bacteria	1183
553	Ga0495619_0000060	3300053085	Bacteria	89377
554	Ga0495619_0004736	3300053085	Bacteria	8656
555	Ga0495619_0005900	3300053085	Bacteria	7761
556	Ga0495619_0041328	3300053085	Bacteria	3015
557	Ga0495619_0127293	3300053085	Bacteria	1749
558	Ga0500566_0030339	3300053094	Bacteria	3153
559	Ga0500641_0004844	3300053096	Bacteria	4767
560	Ga0501084_0000665	3300054114	Bacteria	26214
561	Ga0530510_0008608	3300061734	Bacteria	7127
562	Ga0530510_0139216	3300061734	Unclassified	1787
563	Ga0530510_0295390	3300061734	Bacteria	1212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005436	Ga0070713_100491856	Ga0070713_1004918562	163
2	3300048914	Ga0496111_0370660	Ga0496111_0370660_557_1048	163
3	3300005535	Ga0070684_100188777	Ga0070684_1001887772	197
4	3300005563	Ga0068855_100027470	Ga0068855_1000274702	197
5	3300009093	Ga0105240_10599493	Ga0105240_105994932	197
6	3300013104	Ga0157370_10037719	Ga0157370_100377193	197
7	3300025949	Ga0207667_10324386	Ga0207667_103243862	197
8	3300046454	Ga0495592_0356229	Ga0495592_0356229_89_763	197
9	3300046529	Ga0495652_0000023	Ga0495652_0000023_44615_45289	197
10	3300046536	Ga0495587_0317867	Ga0495587_0317867_136_810	197
11	3300046680	Ga0495646_0074807	Ga0495646_0074807_333_1007	197
12	3300047319	Ga0495674_0082368	Ga0495674_0082368_841_1515	197
13	3300053077	Ga0495601_0142335	Ga0495601_0142335_276_950	197
14	3300053078	Ga0495612_0000024	Ga0495612_0000024_39620_40294	197
15	3300005563	Ga0068855_100056716	Ga0068855_1000567164	198
16	3300044842	Ga0466957_0252371	Ga0466957_0252371_29_631	200
17	3300005458	Ga0070681_10211039	Ga0070681_102110392	201
18	3300005530	Ga0070679_100081554	Ga0070679_1000815543	201
19	3300025912	Ga0207707_10172662	Ga0207707_101726622	201
20	3300025921	Ga0207652_10018256	Ga0207652_100182566	201
21	3300049587	Ga0501071_0420019	Ga0501071_0420019_207_830	201
22	3300005336	Ga0070680_100006862	Ga0070680_1000068623	204
23	3300005458	Ga0070681_10001085	Ga0070681_1000108519	204
24	3300005530	Ga0070679_100000306	Ga0070679_10000030657	204
25	3300025912	Ga0207707_10000270	Ga0207707_1000027019	204
26	3300025917	Ga0207660_10002517	Ga0207660_1000251713	204
27	3300025921	Ga0207652_10000251	Ga0207652_1000025119	204
28	3300037418	Ga0395900_0083778	Ga0395900_0083778_347_1021	205
29	3300038443	Ga0395901_0132070	Ga0395901_0132070_876_1550	205
30	3300044694	Ga0466963_0000025	Ga0466963_0000025_21447_22127	205
31	3300047446	Ga0495679_007063	Ga0495679_007063_2267_2929	206
32	3300046455	Ga0495603_0000054	Ga0495603_0000054_17795_18475	207
33	3300053085	Ga0495619_0005900	Ga0495619_0005900_3280_3960	207
34	3300005614	Ga0068856_100026694	Ga0068856_1000266943	208
35	3300026078	Ga0207702_10001991	Ga0207702_1000199116	208
36	3300014968	Ga0157379_10020475	Ga0157379_100204753	210
37	3300035118	Ga0373954_0233354	Ga0373954_0233354_35_715	211
38	3300036401	Ga0373937_0060080	Ga0373937_0060080_2284_2964	211
39	3300005458	Ga0070681_10019014	Ga0070681_100190141	212
40	3300025912	Ga0207707_10031073	Ga0207707_100310736	212
41	3300026075	Ga0207708_10552664	Ga0207708_105526641	212
42	3300005614	Ga0068856_100483625	Ga0068856_1004836252	213
43	3300026078	Ga0207702_10328217	Ga0207702_103282172	213
44	3300046616	Ga0495668_0134819	Ga0495668_0134819_418_1104	214
45	3300009098	Ga0105245_10000049	Ga0105245_10000049114	215
46	3300010375	Ga0105239_10415241	Ga0105239_104152412	215
47	3300025927	Ga0207687_10000012	Ga0207687_10000012378	215
48	3300009094	Ga0111539_10593920	Ga0111539_105939202	216
49	3300048907	Ga0496104_0000003	Ga0496104_0000003_573575_574255	216
50	3300048908	Ga0496105_0000003	Ga0496105_0000003_611866_612546	216
51	3300013308	Ga0157375_10003759	Ga0157375_100037599	217
52	3300046454	Ga0495592_0045817	Ga0495592_0045817_877_1530	217
53	3300046461	Ga0495641_0262515	Ga0495641_0262515_76_732	217
54	3300046516	Ga0495628_0090637	Ga0495628_0090637_675_1331	217
55	3300031727	Ga0316576_10348853	Ga0316576_103488532	218
56	3300031728	Ga0316578_10065920	Ga0316578_100659203	218
57	3300031733	Ga0316577_10307353	Ga0316577_103073532	218
58	3300036712	Ga0316584_0006063	Ga0316584_0006063_2146_2844	218
59	3300037312	Ga0395899_0019264	Ga0395899_0019264_818_1489	220
60	3300037418	Ga0395900_0020881	Ga0395900_0020881_3841_4512	220
61	3300037466	Ga0395898_0006312	Ga0395898_0006312_1209_1880	220
62	3300037471	Ga0395905_0014086	Ga0395905_0014086_5140_5811	220
63	3300038443	Ga0395901_0838526	Ga0395901_0838526_176_847	220
64	3300046684	Ga0495669_0000545	Ga0495669_0000545_1076_1738	220
65	3300047322	Ga0495680_0000364	Ga0495680_0000364_42880_43542	220
66	3300048908	Ga0496105_0494005	Ga0496105_0494005_186_857	220
67	3300005341	Ga0070691_10344012	Ga0070691_103440121	221
68	3300005436	Ga0070713_100000061	Ga0070713_10000006118	221
69	3300005719	Ga0068861_100469883	Ga0068861_1004698832	221
70	3300006175	Ga0070712_100422922	Ga0070712_1004229222	221
71	3300006881	Ga0068865_100267958	Ga0068865_1002679581	221
72	3300012492	Ga0157335_1004012	Ga0157335_10040121	221
73	3300025899	Ga0207642_10029023	Ga0207642_100290231	221
74	3300025915	Ga0207693_10362833	Ga0207693_103628332	221
75	3300025919	Ga0207657_10255482	Ga0207657_102554822	221
76	3300025928	Ga0207700_10000016	Ga0207700_1000001694	221
77	3300026118	Ga0207675_100572112	Ga0207675_1005721122	221
78	3300046459	Ga0495629_0004923	Ga0495629_0004923_1919_2584	221
79	3300046459	Ga0495629_0029409	Ga0495629_0029409_2295_2960	221
80	3300046462	Ga0495651_0018086	Ga0495651_0018086_3097_3762	221
81	3300046642	Ga0495634_0022292	Ga0495634_0022292_602_1267	221
82	3300046691	Ga0495670_0002998	Ga0495670_0002998_7387_8067	221
83	3300047321	Ga0495676_0100337	Ga0495676_0100337_801_1466	221
84	3300048088	Ga0495602_0072020	Ga0495602_0072020_125_790	221
85	3300049586	Ga0501070_0039707	Ga0501070_0039707_1758_2423	221
86	3300049743	Ga0501081_0390153	Ga0501081_0390153_178_843	221
87	3300053094	Ga0500566_0030339	Ga0500566_0030339_1913_2578	221
88	3300053096	Ga0500641_0004844	Ga0500641_0004844_2330_2995	221
89	3300005347	Ga0070668_100135579	Ga0070668_1001355793	222
90	3300005445	Ga0070708_100459787	Ga0070708_1004597872	222
91	3300005457	Ga0070662_100252964	Ga0070662_1002529642	222
92	3300005468	Ga0070707_100020070	Ga0070707_1000200702	222
93	3300005471	Ga0070698_100174397	Ga0070698_1001743972	222
94	3300005518	Ga0070699_100416938	Ga0070699_1004169382	222
95	3300005719	Ga0068861_100220106	Ga0068861_1002201062	222
96	3300005719	Ga0068861_100519819	Ga0068861_1005198192	222
97	3300006844	Ga0075428_101306980	Ga0075428_1013069801	222
98	3300009094	Ga0111539_10450121	Ga0111539_104501211	222
99	3300009094	Ga0111539_10681842	Ga0111539_106818421	222
100	3300009147	Ga0114129_10007822	Ga0114129_1000782211	222
101	3300009147	Ga0114129_10055679	Ga0114129_100556792	222
102	3300013296	Ga0157374_10643213	Ga0157374_106432131	222
103	3300025922	Ga0207646_10026800	Ga0207646_100268007	222
104	3300025972	Ga0207668_10245948	Ga0207668_102459482	222
105	3300027907	Ga0207428_10010456	Ga0207428_100104561	222
106	3300031995	Ga0307409_100112119	Ga0307409_1001121192	222
107	3300035692	Ga0373935_0114000	Ga0373935_0114000_871_1545	222
108	3300037418	Ga0395900_0062936	Ga0395900_0062936_1622_2332	222
109	3300037466	Ga0395898_0003605	Ga0395898_0003605_11473_12183	222
110	3300037471	Ga0395905_0066122	Ga0395905_0066122_739_1449	222
111	3300038443	Ga0395901_0034168	Ga0395901_0034168_3973_4683	222
112	3300038443	Ga0395901_0346772	Ga0395901_0346772_530_1264	222
113	3300041406	Ga0439439_0020967	Ga0439439_0020967_843_1514	222
114	3300042010	Ga0439452_041283	Ga0439452_041283_62_733	222
115	3300042435	Ga0439434_0020870	Ga0439434_0020870_1066_1737	222
116	3300046454	Ga0495592_0022941	Ga0495592_0022941_2472_3140	222
117	3300046459	Ga0495629_0025267	Ga0495629_0025267_1213_1881	222
118	3300046462	Ga0495651_0235843	Ga0495651_0235843_518_1186	222
119	3300046475	Ga0495639_0033218	Ga0495639_0033218_410_1078	222
120	3300046476	Ga0495662_0144724	Ga0495662_0144724_213_881	222
121	3300046499	Ga0495594_0032770	Ga0495594_0032770_1474_2154	222
122	3300046511	Ga0495608_0002869	Ga0495608_0002869_7784_8452	222
123	3300046559	Ga0495667_0004413	Ga0495667_0004413_3036_3704	222
124	3300046642	Ga0495634_0000616	Ga0495634_0000616_6225_6893	222
125	3300046680	Ga0495646_0067480	Ga0495646_0067480_10_678	222
126	3300046681	Ga0495647_0116766	Ga0495647_0116766_177_845	222
127	3300046689	Ga0495613_0100308	Ga0495613_0100308_145_813	222
128	3300047315	Ga0495581_0054915	Ga0495581_0054915_727_1395	222
129	3300047319	Ga0495674_0002167	Ga0495674_0002167_3911_4579	222
130	3300047322	Ga0495680_0006854	Ga0495680_0006854_2013_2681	222
131	3300047469	Ga0495673_0077711	Ga0495673_0077711_29_697	222
132	3300047471	Ga0495684_0018696	Ga0495684_0018696_2328_2996	222
133	3300048910	Ga0496107_0197570	Ga0496107_0197570_601_1272	222
134	3300049568	Ga0501031_0240787	Ga0501031_0240787_124_813	222
135	3300049569	Ga0501032_0013188	Ga0501032_0013188_3099_3800	222
136	3300049570	Ga0501033_0014702	Ga0501033_0014702_4588_5289	222
137	3300049572	Ga0501036_0006502	Ga0501036_0006502_5715_6416	222
138	3300049572	Ga0501036_0017449	Ga0501036_0017449_1458_2147	222
139	3300049573	Ga0501037_0013318	Ga0501037_0013318_3571_4272	222
140	3300049574	Ga0501038_0210293	Ga0501038_0210293_75_776	222
141	3300049575	Ga0501039_0026437	Ga0501039_0026437_1123_1812	222
142	3300049575	Ga0501039_0575216	Ga0501039_0575216_75_776	222
143	3300049576	Ga0501040_0042578	Ga0501040_0042578_993_1682	222
144	3300049576	Ga0501040_0072142	Ga0501040_0072142_75_776	222
145	3300049577	Ga0501041_0026731	Ga0501041_0026731_2665_3366	222
146	3300049577	Ga0501041_0031470	Ga0501041_0031470_1869_2558	222
147	3300049578	Ga0501042_0005176	Ga0501042_0005176_191_880	222
148	3300049579	Ga0501043_0094073	Ga0501043_0094073_1122_1811	222
149	3300049580	Ga0501046_0012363	Ga0501046_0012363_4688_5389	222
150	3300049580	Ga0501046_0026657	Ga0501046_0026657_1224_1913	222
151	3300049582	Ga0501048_0028145	Ga0501048_0028145_2292_2981	222
152	3300049582	Ga0501048_0054351	Ga0501048_0054351_270_971	222
153	3300049585	Ga0501069_0016810	Ga0501069_0016810_2774_3475	222
154	3300049586	Ga0501070_0016060	Ga0501070_0016060_2196_2897	222
155	3300049587	Ga0501071_0011900	Ga0501071_0011900_318_1007	222
156	3300049589	Ga0501073_0012030	Ga0501073_0012030_4264_4965	222
157	3300049590	Ga0501074_0017107	Ga0501074_0017107_1629_2318	222
158	3300049591	Ga0501075_0085299	Ga0501075_0085299_976_1665	222
159	3300049592	Ga0501076_0025922	Ga0501076_0025922_3462_4151	222
160	3300049593	Ga0501077_0011583	Ga0501077_0011583_3455_4156	222
161	3300049741	Ga0501079_0002250	Ga0501079_0002250_2037_2726	222
162	3300049741	Ga0501079_0578444	Ga0501079_0578444_75_776	222
163	3300049742	Ga0501080_0037646	Ga0501080_0037646_2665_3366	222
164	3300049743	Ga0501081_0025396	Ga0501081_0025396_221_910	222
165	3300049822	Ga0501035_0052829	Ga0501035_0052829_236_937	222
166	3300049823	Ga0501044_0108214	Ga0501044_0108214_125_826	222
167	3300049824	Ga0501045_0004336	Ga0501045_0004336_3199_3888	222
168	3300049824	Ga0501045_0092661	Ga0501045_0092661_1481_2182	222
169	3300050507	nmdc:mga05p37_27011_c1	nmdc:mga05p37_27011_c1_220_912	222
170	3300050511	nmdc:mga08y16_6742_c1	nmdc:mga08y16_6742_c1_8106_8798	222
171	3300053077	Ga0495601_0406350	Ga0495601_0406350_104_772	222
172	3300053078	Ga0495612_0102206	Ga0495612_0102206_499_1167	222
173	3300053085	Ga0495619_0127293	Ga0495619_0127293_745_1413	222
174	3300054114	Ga0501084_0000665	Ga0501084_0000665_12392_13081	222
175	3300061734	Ga0530510_0008608	Ga0530510_0008608_1521_2210	222
176	3300061734	Ga0530510_0139216	Ga0530510_0139216_1012_1713	222
177	3300005336	Ga0070680_100091186	Ga0070680_1000911862	223
178	3300005356	Ga0070674_100000001	Ga0070674_10000000182	223
179	3300005435	Ga0070714_100093293	Ga0070714_1000932933	223
180	3300005441	Ga0070700_100147404	Ga0070700_1001474041	223
181	3300005535	Ga0070684_100401371	Ga0070684_1004013712	223
182	3300005718	Ga0068866_10000234	Ga0068866_1000023421	223
183	3300005937	Ga0081455_10110329	Ga0081455_101103292	223
184	3300005983	Ga0081540_1000733	Ga0081540_10007335	223
185	3300009147	Ga0114129_10321796	Ga0114129_103217963	223
186	3300009176	Ga0105242_10148821	Ga0105242_101488212	223
187	3300009551	Ga0105238_10851365	Ga0105238_108513652	223
188	3300025899	Ga0207642_10000022	Ga0207642_1000002259	223
189	3300025934	Ga0207686_10091146	Ga0207686_100911462	223
190	3300025937	Ga0207669_10000002	Ga0207669_10000002267	223
191	3300025944	Ga0207661_10087318	Ga0207661_100873182	223
192	3300026089	Ga0207648_10617344	Ga0207648_106173442	223
193	3300036401	Ga0373937_0006399	Ga0373937_0006399_6717_7388	223
194	3300037312	Ga0395899_0388015	Ga0395899_0388015_240_917	223
195	3300037466	Ga0395898_0143910	Ga0395898_0143910_1365_2045	223
196	3300037471	Ga0395905_0543463	Ga0395905_0543463_209_889	223
197	3300038443	Ga0395901_0062527	Ga0395901_0062527_1250_1933	223
198	3300038443	Ga0395901_0213510	Ga0395901_0213510_1157_1837	223
199	3300038443	Ga0395901_0569455	Ga0395901_0569455_128_805	223
200	3300046459	Ga0495629_0053774	Ga0495629_0053774_1390_2061	223
201	3300046511	Ga0495608_0045608	Ga0495608_0045608_950_1621	223
202	3300046511	Ga0495608_0393194	Ga0495608_0393194_33_707	223
203	3300046529	Ga0495652_0022568	Ga0495652_0022568_2892_3563	223
204	3300046543	Ga0495645_0018715	Ga0495645_0018715_1157_1828	223
205	3300046615	Ga0495656_0004485	Ga0495656_0004485_2193_2870	223
206	3300046809	Ga0495600_0548771	Ga0495600_0548771_25_696	223
207	3300048088	Ga0495602_0284343	Ga0495602_0284343_425_1096	223
208	3300048908	Ga0496105_0360457	Ga0496105_0360457_295_966	223
209	3300048912	Ga0496109_0251083	Ga0496109_0251083_593_1264	223
210	3300048913	Ga0496110_0054320	Ga0496110_0054320_1977_2648	223
211	3300048914	Ga0496111_0016627	Ga0496111_0016627_2983_3654	223
212	3300048915	Ga0496112_0258030	Ga0496112_0258030_835_1506	223
213	3300048916	Ga0496113_0430261	Ga0496113_0430261_325_996	223
214	3300050507	nmdc:mga05p37_402911_c1	nmdc:mga05p37_402911_c1_807_1493	223
215	3300053078	Ga0495612_0014406	Ga0495612_0014406_2293_2970	223
216	3300053084	Ga0495595_0140873	Ga0495595_0140873_249_920	223
217	3300053085	Ga0495619_0004736	Ga0495619_0004736_4993_5664	223
218	3300005327	Ga0070658_10000934	Ga0070658_1000093415	224
219	3300005327	Ga0070658_10501730	Ga0070658_105017302	224
220	3300005328	Ga0070676_10038219	Ga0070676_100382193	224
221	3300005331	Ga0070670_100142333	Ga0070670_1001423333	224
222	3300005334	Ga0068869_100048730	Ga0068869_1000487303	224
223	3300005335	Ga0070666_10151484	Ga0070666_101514842	224
224	3300005335	Ga0070666_10285617	Ga0070666_102856171	224
225	3300005336	Ga0070680_100001855	Ga0070680_1000018553	224
226	3300005337	Ga0070682_100302920	Ga0070682_1003029202	224
227	3300005338	Ga0068868_100004176	Ga0068868_1000041769	224
228	3300005338	Ga0068868_100113705	Ga0068868_1001137052	224
229	3300005339	Ga0070660_100005733	Ga0070660_1000057336	224
230	3300005339	Ga0070660_100373176	Ga0070660_1003731761	224
231	3300005366	Ga0070659_100211536	Ga0070659_1002115363	224
232	3300005367	Ga0070667_100359537	Ga0070667_1003595372	224
233	3300005367	Ga0070667_100876028	Ga0070667_1008760281	224
234	3300005434	Ga0070709_10225314	Ga0070709_102253142	224
235	3300005435	Ga0070714_100220842	Ga0070714_1002208422	224
236	3300005436	Ga0070713_100524403	Ga0070713_1005244032	224
237	3300005437	Ga0070710_10303411	Ga0070710_103034111	224
238	3300005439	Ga0070711_100061938	Ga0070711_1000619382	224
239	3300005439	Ga0070711_100186108	Ga0070711_1001861082	224
240	3300005439	Ga0070711_100314583	Ga0070711_1003145831	224
241	3300005439	Ga0070711_100541964	Ga0070711_1005419641	224
242	3300005456	Ga0070678_100152316	Ga0070678_1001523162	224
243	3300005458	Ga0070681_10002068	Ga0070681_1000206810	224
244	3300005458	Ga0070681_10171434	Ga0070681_101714343	224
245	3300005459	Ga0068867_100233082	Ga0068867_1002330821	224
246	3300005471	Ga0070698_100225807	Ga0070698_1002258073	224
247	3300005530	Ga0070679_100018146	Ga0070679_1000181463	224
248	3300005530	Ga0070679_100317292	Ga0070679_1003172922	224
249	3300005530	Ga0070679_100424400	Ga0070679_1004244002	224
250	3300005544	Ga0070686_100063556	Ga0070686_1000635561	224
251	3300005548	Ga0070665_100224310	Ga0070665_1002243101	224
252	3300005549	Ga0070704_100077547	Ga0070704_1000775471	224
253	3300005563	Ga0068855_100003430	Ga0068855_10000343016	224
254	3300005563	Ga0068855_100098936	Ga0068855_1000989363	224
255	3300005616	Ga0068852_100494634	Ga0068852_1004946341	224
256	3300005718	Ga0068866_10062302	Ga0068866_100623022	224
257	3300005937	Ga0081455_10098723	Ga0081455_100987232	224
258	3300005983	Ga0081540_1009607	Ga0081540_10096078	224
259	3300006028	Ga0070717_10617476	Ga0070717_106174761	224
260	3300006163	Ga0070715_10176899	Ga0070715_101768992	224
261	3300006173	Ga0070716_100037546	Ga0070716_1000375463	224
262	3300006175	Ga0070712_100252231	Ga0070712_1002522312	224
263	3300009093	Ga0105240_10786266	Ga0105240_107862662	224
264	3300009098	Ga0105245_10001823	Ga0105245_1000182315	224
265	3300009098	Ga0105245_10029566	Ga0105245_100295665	224
266	3300009174	Ga0105241_10033253	Ga0105241_100332533	224
267	3300009176	Ga0105242_10000398	Ga0105242_1000039811	224
268	3300009176	Ga0105242_10014838	Ga0105242_100148388	224
269	3300009545	Ga0105237_10078260	Ga0105237_100782604	224
270	3300009551	Ga0105238_10007177	Ga0105238_100071778	224
271	3300009553	Ga0105249_10027692	Ga0105249_100276923	224
272	3300009553	Ga0105249_10311175	Ga0105249_103111752	224
273	3300010375	Ga0105239_10014659	Ga0105239_100146593	224
274	3300010375	Ga0105239_10095546	Ga0105239_100955462	224
275	3300011119	Ga0105246_10002549	Ga0105246_100025498	224
276	3300013102	Ga0157371_10075907	Ga0157371_100759072	224
277	3300013105	Ga0157369_10871225	Ga0157369_108712251	224
278	3300013296	Ga0157374_10004554	Ga0157374_100045546	224
279	3300013307	Ga0157372_10014701	Ga0157372_100147017	224
280	3300013308	Ga0157375_10121481	Ga0157375_101214813	224
281	3300013308	Ga0157375_10173081	Ga0157375_101730813	224
282	3300014325	Ga0163163_10006317	Ga0163163_100063176	224
283	3300014745	Ga0157377_10010792	Ga0157377_100107923	224
284	3300014745	Ga0157377_10133049	Ga0157377_101330492	224
285	3300014968	Ga0157379_10285928	Ga0157379_102859282	224
286	3300014969	Ga0157376_10003914	Ga0157376_100039146	224
287	3300020082	Ga0206353_10014688	Ga0206353_100146883	224
288	3300025901	Ga0207688_10003838	Ga0207688_100038383	224
289	3300025903	Ga0207680_10281489	Ga0207680_102814891	224
290	3300025906	Ga0207699_10230664	Ga0207699_102306642	224
291	3300025907	Ga0207645_10039622	Ga0207645_100396223	224
292	3300025909	Ga0207705_10040098	Ga0207705_100400983	224
293	3300025909	Ga0207705_10408383	Ga0207705_104083832	224
294	3300025911	Ga0207654_10081555	Ga0207654_100815553	224
295	3300025912	Ga0207707_10066201	Ga0207707_100662013	224
296	3300025915	Ga0207693_10005370	Ga0207693_100053705	224
297	3300025916	Ga0207663_10041601	Ga0207663_100416011	224
298	3300025916	Ga0207663_10072500	Ga0207663_100725002	224
299	3300025916	Ga0207663_10190826	Ga0207663_101908262	224
300	3300025917	Ga0207660_10155748	Ga0207660_101557482	224
301	3300025919	Ga0207657_10011538	Ga0207657_100115385	224
302	3300025921	Ga0207652_10204805	Ga0207652_102048052	224
303	3300025924	Ga0207694_10003513	Ga0207694_100035133	224
304	3300025927	Ga0207687_10002016	Ga0207687_100020168	224
305	3300025927	Ga0207687_10352640	Ga0207687_103526401	224
306	3300025928	Ga0207700_10586158	Ga0207700_105861581	224
307	3300025932	Ga0207690_10012525	Ga0207690_100125257	224
308	3300025934	Ga0207686_10000322	Ga0207686_1000032221	224
309	3300025934	Ga0207686_10116364	Ga0207686_101163641	224
310	3300025935	Ga0207709_10105285	Ga0207709_101052852	224
311	3300025938	Ga0207704_10089894	Ga0207704_100898943	224
312	3300025939	Ga0207665_10025680	Ga0207665_100256802	224
313	3300025942	Ga0207689_10017336	Ga0207689_100173366	224
314	3300025949	Ga0207667_10004513	Ga0207667_1000451316	224
315	3300025961	Ga0207712_10059553	Ga0207712_100595534	224
316	3300025961	Ga0207712_10438787	Ga0207712_104387871	224
317	3300025981	Ga0207640_10004533	Ga0207640_100045333	224
318	3300025981	Ga0207640_10042098	Ga0207640_100420983	224
319	3300025986	Ga0207658_10738164	Ga0207658_107381641	224
320	3300026023	Ga0207677_10116935	Ga0207677_101169352	224
321	3300026075	Ga0207708_10479351	Ga0207708_104793512	224
322	3300026121	Ga0207683_10040970	Ga0207683_100409704	224
323	3300026142	Ga0207698_10046126	Ga0207698_100461263	224
324	3300035083	Ga0373926_0088052	Ga0373926_0088052_169_849	224
325	3300035089	Ga0373944_0022267	Ga0373944_0022267_265_939	224
326	3300035116	Ga0373945_0024561	Ga0373945_0024561_752_1426	224
327	3300035120	Ga0373957_0152888	Ga0373957_0152888_169_843	224
328	3300035170	Ga0373943_0022625	Ga0373943_0022625_1905_2579	224
329	3300035170	Ga0373943_0123061	Ga0373943_0123061_458_1132	224
330	3300035692	Ga0373935_0285140	Ga0373935_0285140_311_985	224
331	3300035724	Ga0373933_0131921	Ga0373933_0131921_393_1073	224
332	3300035725	Ga0373947_0024750	Ga0373947_0024750_2389_3063	224
333	3300037068	Ga0373925_0004969	Ga0373925_0004969_6085_6759	224
334	3300046454	Ga0495592_0172763	Ga0495592_0172763_669_1343	224
335	3300046455	Ga0495603_0131051	Ga0495603_0131051_301_975	224
336	3300046459	Ga0495629_0009927	Ga0495629_0009927_6064_6738	224
337	3300046462	Ga0495651_0181444	Ga0495651_0181444_305_985	224
338	3300046463	Ga0495653_0011134	Ga0495653_0011134_4197_4877	224
339	3300046463	Ga0495653_0040546	Ga0495653_0040546_283_960	224
340	3300046472	Ga0495580_0060447	Ga0495580_0060447_425_1099	224
341	3300046473	Ga0495582_0005792	Ga0495582_0005792_402_1082	224
342	3300046475	Ga0495639_0002352	Ga0495639_0002352_7034_7714	224
343	3300046476	Ga0495662_0002179	Ga0495662_0002179_8718_9398	224
344	3300046499	Ga0495594_0005831	Ga0495594_0005831_4405_5079	224
345	3300046516	Ga0495628_0100581	Ga0495628_0100581_578_1252	224
346	3300046517	Ga0495630_0008554	Ga0495630_0008554_5964_6638	224
347	3300046526	Ga0495666_0045528	Ga0495666_0045528_1072_1752	224
348	3300046529	Ga0495652_0054592	Ga0495652_0054592_2334_3008	224
349	3300046531	Ga0495665_0030061	Ga0495665_0030061_562_1236	224
350	3300046533	Ga0495640_0006895	Ga0495640_0006895_528_1202	224
351	3300046535	Ga0495586_0070148	Ga0495586_0070148_1004_1678	224
352	3300046536	Ga0495587_0007418	Ga0495587_0007418_2109_2783	224
353	3300046536	Ga0495587_0304955	Ga0495587_0304955_196_870	224
354	3300046559	Ga0495667_0011319	Ga0495667_0011319_2116_2796	224
355	3300046642	Ga0495634_0030812	Ga0495634_0030812_608_1288	224
356	3300046663	Ga0495635_0021508	Ga0495635_0021508_3460_4134	224
357	3300046675	Ga0495657_0008004	Ga0495657_0008004_574_1248	224
358	3300046678	Ga0495599_0445358	Ga0495599_0445358_66_740	224
359	3300046679	Ga0495623_0231971	Ga0495623_0231971_323_997	224
360	3300046681	Ga0495647_0013505	Ga0495647_0013505_1823_2497	224
361	3300046681	Ga0495647_0019705	Ga0495647_0019705_147_821	224
362	3300046683	Ga0495658_0010633	Ga0495658_0010633_1684_2358	224
363	3300046690	Ga0495624_0035103	Ga0495624_0035103_1964_2638	224
364	3300046690	Ga0495624_0152496	Ga0495624_0152496_354_1028	224
365	3300046809	Ga0495600_0020863	Ga0495600_0020863_2352_3026	224
366	3300047315	Ga0495581_0004699	Ga0495581_0004699_1667_2341	224
367	3300047315	Ga0495581_0006481	Ga0495581_0006481_497_1171	224
368	3300047317	Ga0495604_0000038	Ga0495604_0000038_32707_33381	224
369	3300047319	Ga0495674_0006179	Ga0495674_0006179_2189_2863	224
370	3300047319	Ga0495674_0028976	Ga0495674_0028976_823_1497	224
371	3300047321	Ga0495676_0033656	Ga0495676_0033656_2760_3434	224
372	3300047444	Ga0495675_0141811	Ga0495675_0141811_377_1051	224
373	3300047471	Ga0495684_0030704	Ga0495684_0030704_71_745	224
374	3300047471	Ga0495684_0037529	Ga0495684_0037529_1018_1692	224
375	3300047673	Ga0495593_0028080	Ga0495593_0028080_1929_2609	224
376	3300048088	Ga0495602_0131387	Ga0495602_0131387_981_1655	224
377	3300048089	Ga0495614_0003290	Ga0495614_0003290_5689_6363	224
378	3300048903	Ga0496100_0016461	Ga0496100_0016461_3129_3818	224
379	3300048904	Ga0496101_0004462	Ga0496101_0004462_1266_1940	224
380	3300048904	Ga0496101_0027774	Ga0496101_0027774_707_1396	224
381	3300048905	Ga0496102_0005468	Ga0496102_0005468_5301_5975	224
382	3300048905	Ga0496102_0005858	Ga0496102_0005858_6193_6882	224
383	3300048905	Ga0496102_0026528	Ga0496102_0026528_3769_4443	224
384	3300048906	Ga0496103_0006899	Ga0496103_0006899_1809_2483	224
385	3300048906	Ga0496103_0015560	Ga0496103_0015560_3026_3715	224
386	3300048907	Ga0496104_0004031	Ga0496104_0004031_4021_4695	224
387	3300048908	Ga0496105_0141180	Ga0496105_0141180_576_1265	224
388	3300048909	Ga0496106_0010708	Ga0496106_0010708_4961_5635	224
389	3300048909	Ga0496106_0341196	Ga0496106_0341196_174_848	224
390	3300048910	Ga0496107_0005067	Ga0496107_0005067_4062_4751	224
391	3300048910	Ga0496107_0023211	Ga0496107_0023211_2632_3306	224
392	3300048911	Ga0496108_0012578	Ga0496108_0012578_2455_3129	224
393	3300048911	Ga0496108_0018506	Ga0496108_0018506_46_735	224
394	3300048912	Ga0496109_0032687	Ga0496109_0032687_1267_1941	224
395	3300048912	Ga0496109_0090011	Ga0496109_0090011_315_1004	224
396	3300048913	Ga0496110_0000228	Ga0496110_0000228_976_1650	224
397	3300048913	Ga0496110_0037056	Ga0496110_0037056_745_1434	224
398	3300048913	Ga0496110_0498861	Ga0496110_0498861_25_699	224
399	3300048914	Ga0496111_0009891	Ga0496111_0009891_1574_2248	224
400	3300048914	Ga0496111_0016107	Ga0496111_0016107_353_1042	224
401	3300048915	Ga0496112_0008151	Ga0496112_0008151_5410_6084	224
402	3300048915	Ga0496112_0030614	Ga0496112_0030614_63_737	224
403	3300048915	Ga0496112_0287831	Ga0496112_0287831_436_1125	224
404	3300048916	Ga0496113_0000187	Ga0496113_0000187_8756_9430	224
405	3300048916	Ga0496113_0041939	Ga0496113_0041939_1945_2634	224
406	3300048917	Ga0496114_0006943	Ga0496114_0006943_8072_8761	224
407	3300048918	Ga0496115_0038181	Ga0496115_0038181_501_1190	224
408	3300049569	Ga0501032_0000097	Ga0501032_0000097_5248_5940	224
409	3300049570	Ga0501033_0000148	Ga0501033_0000148_64898_65590	224
410	3300049571	Ga0501034_0000664	Ga0501034_0000664_4389_5081	224
411	3300049572	Ga0501036_0000062	Ga0501036_0000062_65749_66441	224
412	3300049573	Ga0501037_0002089	Ga0501037_0002089_1420_2112	224
413	3300049574	Ga0501038_0000105	Ga0501038_0000105_64199_64891	224
414	3300049579	Ga0501043_0000117	Ga0501043_0000117_68445_69137	224
415	3300049580	Ga0501046_0003133	Ga0501046_0003133_9797_10489	224
416	3300049581	Ga0501047_0000338	Ga0501047_0000338_5293_5985	224
417	3300049582	Ga0501048_0007705	Ga0501048_0007705_2404_3096	224
418	3300049584	Ga0501068_0037714	Ga0501068_0037714_1326_2018	224
419	3300049586	Ga0501070_0045856	Ga0501070_0045856_2102_2794	224
420	3300049742	Ga0501080_0331062	Ga0501080_0331062_268_960	224
421	3300049822	Ga0501035_0000209	Ga0501035_0000209_64898_65590	224
422	3300049823	Ga0501044_0000241	Ga0501044_0000241_64133_64825	224
423	3300049824	Ga0501045_0001964	Ga0501045_0001964_4939_5631	224
424	3300053077	Ga0495601_0001834	Ga0495601_0001834_3889_4563	224
425	3300053078	Ga0495612_0178076	Ga0495612_0178076_129_803	224
426	3300053084	Ga0495595_0097702	Ga0495595_0097702_255_929	224
427	3300053085	Ga0495619_0041328	Ga0495619_0041328_1632_2306	224
428	3300003373	JGI25407J50210_10016608	JGI25407J50210_100166081	225
429	3300005327	Ga0070658_10043238	Ga0070658_100432383	225
430	3300005339	Ga0070660_100013628	Ga0070660_1000136287	225
431	3300005339	Ga0070660_100152950	Ga0070660_1001529501	225
432	3300005356	Ga0070674_100002750	Ga0070674_1000027504	225
433	3300005458	Ga0070681_10190448	Ga0070681_101904482	225
434	3300005718	Ga0068866_10140050	Ga0068866_101400502	225
435	3300005719	Ga0068861_100203822	Ga0068861_1002038223	225
436	3300005981	Ga0081538_10000112	Ga0081538_1000011243	225
437	3300006844	Ga0075428_100102774	Ga0075428_1001027744	225
438	3300006846	Ga0075430_100079612	Ga0075430_1000796124	225
439	3300006847	Ga0075431_100010590	Ga0075431_1000105906	225
440	3300006847	Ga0075431_100073969	Ga0075431_1000739693	225
441	3300009148	Ga0105243_10154136	Ga0105243_101541363	225
442	3300013104	Ga0157370_10405716	Ga0157370_104057162	225
443	3300013105	Ga0157369_10194121	Ga0157369_101941213	225
444	3300013307	Ga0157372_10153595	Ga0157372_101535952	225
445	3300025899	Ga0207642_10017519	Ga0207642_100175192	225
446	3300025909	Ga0207705_10026100	Ga0207705_100261002	225
447	3300025912	Ga0207707_10116602	Ga0207707_101166022	225
448	3300025919	Ga0207657_10055165	Ga0207657_100551652	225
449	3300025921	Ga0207652_10040359	Ga0207652_100403594	225
450	3300025935	Ga0207709_10056748	Ga0207709_100567482	225
451	3300025949	Ga0207667_10186384	Ga0207667_101863842	225
452	3300036401	Ga0373937_0046858	Ga0373937_0046858_1816_2493	225
453	3300046454	Ga0495592_0002851	Ga0495592_0002851_2370_3047	225
454	3300046462	Ga0495651_0000097	Ga0495651_0000097_8044_8721	225
455	3300046463	Ga0495653_0003612	Ga0495653_0003612_4050_4727	225
456	3300046511	Ga0495608_0001079	Ga0495608_0001079_15765_16442	225
457	3300046511	Ga0495608_0020928	Ga0495608_0020928_3050_3730	225
458	3300046516	Ga0495628_0001325	Ga0495628_0001325_6461_7138	225
459	3300046529	Ga0495652_0001520	Ga0495652_0001520_7764_8441	225
460	3300046536	Ga0495587_0000886	Ga0495587_0000886_11790_12467	225
461	3300046543	Ga0495645_0000054	Ga0495645_0000054_74926_75603	225
462	3300046543	Ga0495645_0000186	Ga0495645_0000186_29893_30609	225
463	3300046675	Ga0495657_0009152	Ga0495657_0009152_5797_6474	225
464	3300046678	Ga0495599_0000344	Ga0495599_0000344_2539_3216	225
465	3300046679	Ga0495623_0000648	Ga0495623_0000648_453_1130	225
466	3300046809	Ga0495600_0011743	Ga0495600_0011743_3986_4663	225
467	3300047317	Ga0495604_0000085	Ga0495604_0000085_52282_52959	225
468	3300047322	Ga0495680_0003888	Ga0495680_0003888_10121_10798	225
469	3300047444	Ga0495675_0000041	Ga0495675_0000041_74377_75054	225
470	3300048088	Ga0495602_0004638	Ga0495602_0004638_11022_11699	225
471	3300048911	Ga0496108_0000202	Ga0496108_0000202_41938_42624	225
472	3300048912	Ga0496109_0000131	Ga0496109_0000131_43778_44464	225
473	3300048915	Ga0496112_0000002	Ga0496112_0000002_277331_278020	225
474	3300050509	nmdc:mga0qj67_388471_c1	nmdc:mga0qj67_388471_c1_380_1060	225
475	3300050510	nmdc:mga06r32_160278_c1	nmdc:mga06r32_160278_c1_589_1266	225
476	3300050510	nmdc:mga06r32_24414_c1	nmdc:mga06r32_24414_c1_4869_5549	225
477	3300053077	Ga0495601_0000385	Ga0495601_0000385_828_1505	225
478	3300001977	JGI24746J21847_1000015	JGI24746J21847_10000153	226
479	3300003373	JGI25407J50210_10021877	JGI25407J50210_100218772	226
480	3300005329	Ga0070683_100081660	Ga0070683_1000816603	226
481	3300005333	Ga0070677_10000007	Ga0070677_1000000741	226
482	3300005336	Ga0070680_100071815	Ga0070680_1000718152	226
483	3300005339	Ga0070660_100348007	Ga0070660_1003480072	226
484	3300005356	Ga0070674_100000026	Ga0070674_10000002665	226
485	3300005364	Ga0070673_100002141	Ga0070673_10000214112	226
486	3300005366	Ga0070659_100077795	Ga0070659_1000777952	226
487	3300005367	Ga0070667_100237984	Ga0070667_1002379842	226
488	3300005439	Ga0070711_100008534	Ga0070711_1000085345	226
489	3300005441	Ga0070700_100048270	Ga0070700_1000482702	226
490	3300005459	Ga0068867_100000246	Ga0068867_10000024617	226
491	3300005459	Ga0068867_100345379	Ga0068867_1003453792	226
492	3300005547	Ga0070693_100018373	Ga0070693_1000183733	226
493	3300005614	Ga0068856_100091968	Ga0068856_1000919683	226
494	3300005718	Ga0068866_10000006	Ga0068866_10000006143	226
495	3300005843	Ga0068860_100021006	Ga0068860_1000210065	226
496	3300006163	Ga0070715_10000003	Ga0070715_10000003195	226
497	3300006914	Ga0075436_100698370	Ga0075436_1006983701	226
498	3300013296	Ga0157374_10371815	Ga0157374_103718152	226
499	3300013306	Ga0163162_11174538	Ga0163162_111745381	226
500	3300017792	Ga0163161_10236937	Ga0163161_102369372	226
501	3300025893	Ga0207682_10000007	Ga0207682_1000000749	226
502	3300025899	Ga0207642_10000001	Ga0207642_1000000167	226
503	3300025899	Ga0207642_10000003	Ga0207642_1000000367	226
504	3300025899	Ga0207642_10000004	Ga0207642_1000000467	226
505	3300025905	Ga0207685_10000003	Ga0207685_10000003192	226
506	3300025909	Ga0207705_10005819	Ga0207705_100058194	226
507	3300025916	Ga0207663_10006177	Ga0207663_100061775	226
508	3300025917	Ga0207660_10060830	Ga0207660_100608302	226
509	3300025919	Ga0207657_10503964	Ga0207657_105039642	226
510	3300025923	Ga0207681_10087213	Ga0207681_100872133	226
511	3300025932	Ga0207690_10152442	Ga0207690_101524422	226
512	3300025937	Ga0207669_10000041	Ga0207669_1000004120	226
513	3300025944	Ga0207661_10109187	Ga0207661_101091872	226
514	3300025960	Ga0207651_10000172	Ga0207651_1000017225	226
515	3300025961	Ga0207712_10000003	Ga0207712_10000003119	226
516	3300025986	Ga0207658_10215440	Ga0207658_102154402	226
517	3300026075	Ga0207708_10047893	Ga0207708_100478932	226
518	3300026089	Ga0207648_10000783	Ga0207648_1000078324	226
519	3300026121	Ga0207683_10119320	Ga0207683_101193203	226
520	3300028381	Ga0268264_10010113	Ga0268264_100101132	226
521	3300036401	Ga0373937_0552434	Ga0373937_0552434_36_740	226
522	3300046454	Ga0495592_0001399	Ga0495592_0001399_1189_1875	226
523	3300046455	Ga0495603_0000431	Ga0495603_0000431_7602_8291	226
524	3300046459	Ga0495629_0076617	Ga0495629_0076617_482_1165	226
525	3300046473	Ga0495582_0000082	Ga0495582_0000082_43523_44212	226
526	3300046476	Ga0495662_0000727	Ga0495662_0000727_965_1651	226
527	3300046476	Ga0495662_0144580	Ga0495662_0144580_179_862	226
528	3300046515	Ga0495620_0000158	Ga0495620_0000158_40853_41536	226
529	3300046516	Ga0495628_0010085	Ga0495628_0010085_1195_1881	226
530	3300046516	Ga0495628_0086318	Ga0495628_0086318_1499_2185	226
531	3300046517	Ga0495630_0011576	Ga0495630_0011576_1972_2652	226
532	3300046517	Ga0495630_0295700	Ga0495630_0295700_158_841	226
533	3300046523	Ga0495644_0152921	Ga0495644_0152921_135_818	226
534	3300046531	Ga0495665_0234885	Ga0495665_0234885_50_736	226
535	3300046536	Ga0495587_0140627	Ga0495587_0140627_470_1174	226
536	3300046537	Ga0495598_0014796	Ga0495598_0014796_964_1647	226
537	3300046543	Ga0495645_0256951	Ga0495645_0256951_279_959	226
538	3300046543	Ga0495645_0313878	Ga0495645_0313878_169_873	226
539	3300046559	Ga0495667_0000053	Ga0495667_0000053_35863_36567	226
540	3300046675	Ga0495657_0008769	Ga0495657_0008769_2329_3015	226
541	3300046681	Ga0495647_0003218	Ga0495647_0003218_1003_1695	226
542	3300046683	Ga0495658_0000070	Ga0495658_0000070_43545_44234	226
543	3300046809	Ga0495600_0326492	Ga0495600_0326492_100_831	226
544	3300047322	Ga0495680_0000336	Ga0495680_0000336_50695_51375	226
545	3300047322	Ga0495680_0007408	Ga0495680_0007408_7449_8153	226
546	3300047322	Ga0495680_0459443	Ga0495680_0459443_43_747	226
547	3300047447	Ga0495685_021031	Ga0495685_021031_1129_1812	226
548	3300048088	Ga0495602_0360204	Ga0495602_0360204_234_914	226
549	3300048903	Ga0496100_0000004	Ga0496100_0000004_199290_199970	226
550	3300048904	Ga0496101_0000007	Ga0496101_0000007_199290_199970	226
551	3300048909	Ga0496106_0000004	Ga0496106_0000004_160704_161384	226
552	3300048910	Ga0496107_0000001	Ga0496107_0000001_199290_199970	226
553	3300048911	Ga0496108_0000002	Ga0496108_0000002_649424_650104	226
554	3300048912	Ga0496109_0000001	Ga0496109_0000001_649386_650066	226
555	3300048916	Ga0496113_0017926	Ga0496113_0017926_547_1230	226
556	3300048916	Ga0496113_0050814	Ga0496113_0050814_1671_2357	226
557	3300049578	Ga0501042_0048511	Ga0501042_0048511_348_1028	226
558	3300049583	Ga0501067_0001444	Ga0501067_0001444_6706_7392	226
559	3300050515	nmdc:mga0a205_1_c2	nmdc:mga0a205_1_c2_93334_94014	226
560	3300053078	Ga0495612_0009779	Ga0495612_0009779_1762_2445	226
561	3300053084	Ga0495595_0000262	Ga0495595_0000262_19177_19863	226
562	3300053085	Ga0495619_0000060	Ga0495619_0000060_23136_23816	226
563	3300061734	Ga0530510_0295390	Ga0530510_0295390_274_960	226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

19

204

0.83 PF13242

Hydrolase_like

HAD-hyrolase-like

163

235

0.83 PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

22

210

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2hcf-assembly1.cif.gz_A	crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution	0.873	6	222
2hcf-assembly1.cif.gz_A	crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution	0.8333	6	222
4uas-assembly2.cif.gz_B	crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate	0.7844	7	222
7ocs-assembly2.cif.gz_B	mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii	0.7777	6	219
2hsz-assembly2.cif.gz_B	crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution	0.7775	6	221

ID	Description	Score	Start	End	Superfamily
2hcfA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9249	6	222	3.40.50.1000
3nasA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9037	98	221	3.40.50.1000
3kbbA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.8832	99	221	3.40.50.1000
af_Q652P6_229_339_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.8794	108	221	3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.8742	96	219	3.40.50.1000

ID	Description	Score	Start	End	GO Terms
AF-A0A2W6BFJ8-F1-model_v4	Glutamate decarboxylase (EC 4.1.1.15)	0.9887	6	226	GO:0004351 GO:0005829 GO:0006538 GO:0030170
AF-A0A7W1N2G3-F1-model_v4	HAD family hydrolase	0.9839	7	226	GO:0005829 GO:0006281 GO:0008967
AF-X1T2G5-F1-model_v4	Hydrolase	0.9822	99	221	GO:0005829 GO:0006281 GO:0008967
AF-A0A6J4RNW6-F1-model_v4	Uncharacterized protein	0.9816	6	225	GO:0006281 GO:0008967
AF-A0A7V8BFP6-F1-model_v4	HAD hydrolase-like protein	0.9756	96	219	GO:0005829 GO:0006281 GO:0008967

Feature Viewer

pLDDT	pTM	Quality
93.79	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F464074

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

19

204

0.83

PF13242

Hydrolase_like

HAD-hyrolase-like

163

235

0.83

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

22

210

0.77

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map