F463995

General Info

Members Datasets Scaffolds Average Seq Length
562 331 1124 219

Family's Representative Sequence

Representative Sequence 3300053079|Ga0500610_0065372|Ga0500610_0065372_368_1084
Length 238
Sequence MVQKRNPPPLPPGAPLKSAKARPATSQSAKPQPVAGGVPPKRRGRPRAYEPDVALARALDVFWKDGFAATSLDDLSAATGMNRPSLYGAFGDKRELYKKSYESYRNRARTRMGEVFAADMPLRPMLMRIYGIALDMYLSGEDGPRGCFTVMTATSEAVFDPDIRAMVVSGLVEMDRFFARLFGIAKERGELPPSADPQVLANLASATIHTIAIRARAQVPRAELEAIVNGAADVMLRG

Samples

Sample ID Description Type Environment
1 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
140 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
141 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
181 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
311 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
312 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
313 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
314 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
315 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
320 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
321 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
322 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
323 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
324 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
325 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
326 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
327 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
328 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
329 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
330 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
331 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 0.53
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.36
Nodule 3.02
Rhizoplane 9.96
Rhizosphere 71.71
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500610_0065372 3300053079 Bacteria 1897
2 rootH1_10043864 3300003323 Bacteria 2797
3 JGI25404J52841_10055678 3300003659 Bacteria 830
4 Ga0070676_10076555 3300005328 Bacteria 2020
5 Ga0068869_100004434 3300005334 Bacteria 8728
6 Ga0068869_100433611 3300005334 Bacteria 1086
7 Ga0070666_10217477 3300005335 Bacteria 1347
8 Ga0070680_100109248 3300005336 Bacteria 2301
9 Ga0070680_100152098 3300005336 Bacteria 1943
10 Ga0070689_100120041 3300005340 Bacteria 2099
11 Ga0070661_100132010 3300005344 Bacteria 1877
12 Ga0070668_100115016 3300005347 Bacteria 2144
13 Ga0070668_100517913 3300005347 Bacteria 1034
14 Ga0070668_100534408 3300005347 Bacteria 1019
15 Ga0070675_100297684 3300005354 Bacteria 1421
16 Ga0070673_100004785 3300005364 Bacteria 8598
17 Ga0070688_100316990 3300005365 Bacteria 1132
18 Ga0070688_100433850 3300005365 Bacteria 979
19 Ga0070667_100277341 3300005367 Bacteria 1505
20 Ga0070667_100400237 3300005367 Bacteria 1250
21 Ga0070667_100606621 3300005367 Bacteria 1009
22 Ga0070709_10001211 3300005434 Bacteria 14149
23 Ga0070709_10135759 3300005434 Bacteria 1685
24 Ga0070714_100013779 3300005435 Bacteria 6482
25 Ga0070714_100092522 3300005435 Bacteria 2650
26 Ga0070714_100451156 3300005435 Bacteria 1222
27 Ga0070714_100971718 3300005435 Bacteria 826
28 Ga0070713_100035405 3300005436 Bacteria 4019
29 Ga0070713_100168113 3300005436 Bacteria 1962
30 Ga0070710_10003695 3300005437 Bacteria 7235
31 Ga0070711_100006816 3300005439 Bacteria 6917
32 Ga0070711_100021623 3300005439 Bacteria 4162
33 Ga0070711_100379481 3300005439 Bacteria 1143
34 Ga0070663_100068857 3300005455 Bacteria 2570
35 Ga0070678_100023004 3300005456 Bacteria 4144
36 Ga0070678_100056538 3300005456 Bacteria 2870
37 Ga0070662_100211718 3300005457 Bacteria 1543
38 Ga0068867_100537097 3300005459 Bacteria 1011
39 Ga0070685_10179825 3300005466 Bacteria 1361
40 Ga0070684_100013257 3300005535 Bacteria 6641
41 Ga0068853_100278504 3300005539 Bacteria 1542
42 Ga0068853_100421955 3300005539 Bacteria 1251
43 Ga0068853_101090876 3300005539 Bacteria 770
44 Ga0070672_100120156 3300005543 Bacteria 2150
45 Ga0070686_100142897 3300005544 Bacteria 1668
46 Ga0070696_100207075 3300005546 Bacteria 1467
47 Ga0070665_100016387 3300005548 Bacteria 7432
48 Ga0070665_100018344 3300005548 Bacteria 7014
49 Ga0070665_100059824 3300005548 Bacteria 3819
50 Ga0070665_100230855 3300005548 Bacteria 1850
51 Ga0068855_100099047 3300005563 Bacteria 3358
52 Ga0070664_100193063 3300005564 Bacteria 1815
53 Ga0070664_100230872 3300005564 Bacteria 1658
54 Ga0070702_100284394 3300005615 Bacteria 1137
55 Ga0068852_100030085 3300005616 Bacteria 4466
56 Ga0068852_100147513 3300005616 Bacteria 2184
57 Ga0068864_100033735 3300005618 Bacteria 4352
58 Ga0068866_10114361 3300005718 Bacteria 1511
59 Ga0068861_100226420 3300005719 Bacteria 1583
60 Ga0068851_10236229 3300005834 Bacteria 1032
61 Ga0068863_100335601 3300005841 Bacteria 1470
62 Ga0068858_100384181 3300005842 Bacteria 1347
63 Ga0068858_100443025 3300005842 Bacteria 1251
64 Ga0068860_100096471 3300005843 Bacteria 2818
65 Ga0068860_100373519 3300005843 Bacteria 1407
66 Ga0068862_100244953 3300005844 Bacteria 1631
67 Ga0081538_10014803 3300005981 Bacteria 6080
68 Ga0081540_1001652 3300005983 Bacteria 18969
69 Ga0081540_1004900 3300005983 Bacteria 10082
70 Ga0081540_1013865 3300005983 Bacteria 5210
71 Ga0081540_1094899 3300005983 Bacteria 1302
72 Ga0081539_10019199 3300005985 Bacteria 4690
73 Ga0070717_10000460 3300006028 Bacteria 25862
74 Ga0070717_10004118 3300006028 Bacteria 10482
75 Ga0070717_10083613 3300006028 Bacteria 2684
76 Ga0070717_10406438 3300006028 Bacteria 1224
77 Ga0075365_10002534 3300006038 Bacteria 9011
78 Ga0075368_10103813 3300006042 Bacteria 1169
79 Ga0075363_100022562 3300006048 Bacteria 3183
80 Ga0075363_100082428 3300006048 Bacteria 1761
81 Ga0075364_10084168 3300006051 Bacteria 2106
82 Ga0070715_10062758 3300006163 Bacteria 1636
83 Ga0070716_100060472 3300006173 Bacteria 2188
84 Ga0070716_100331163 3300006173 Bacteria 1071
85 Ga0075367_10015720 3300006178 Bacteria 4119
86 Ga0075367_10143361 3300006178 Bacteria 1480
87 Ga0075367_10445584 3300006178 Bacteria 820
88 Ga0075369_10059783 3300006186 Bacteria 1661
89 Ga0075369_10200972 3300006186 Bacteria 920
90 Ga0075370_10043459 3300006353 Bacteria 2540
91 Ga0075370_10276889 3300006353 Bacteria 996
92 Ga0068871_100563591 3300006358 Bacteria 1033
93 Ga0075428_100165992 3300006844 Bacteria 2395
94 Ga0075434_100187174 3300006871 Bacteria 2090
95 Ga0068865_100393182 3300006881 Bacteria 1134
96 Ga0068865_100530703 3300006881 Bacteria 986
97 Ga0099825_1052051 3300006941 Bacteria 853
98 Ga0099824_1006568 3300006942 Bacteria 15882
99 Ga0099822_1004807 3300006943 Bacteria 17628
100 Ga0105250_10157594 3300009092 Bacteria 947
101 Ga0105240_10157372 3300009093 Bacteria 2701
102 Ga0105240_10337508 3300009093 Bacteria 1713
103 Ga0105245_10092689 3300009098 Bacteria 2782
104 Ga0105245_10750626 3300009098 Bacteria 1012
105 Ga0105247_10115701 3300009101 Bacteria 1731
106 Ga0105247_10127710 3300009101 Bacteria 1654
107 Ga0105247_10127723 3300009101 Bacteria 1654
108 Ga0114129_10606903 3300009147 Bacteria 1417
109 Ga0105243_10031625 3300009148 Bacteria 4080
110 Ga0105243_10648791 3300009148 Bacteria 1023
111 Ga0105242_10458867 3300009176 Bacteria 1203
112 Ga0105242_10465020 3300009176 Bacteria 1195
113 Ga0105248_10189544 3300009177 Bacteria 2317
114 Ga0105237_10191747 3300009545 Bacteria 2044
115 Ga0105238_10351208 3300009551 Bacteria 1464
116 Ga0105239_10056839 3300010375 Bacteria 4291
117 Ga0105239_10173053 3300010375 Bacteria 2415
118 Ga0105239_10210150 3300010375 Bacteria 2181
119 Ga0105239_10693736 3300010375 Bacteria 1164
120 Ga0105239_11421992 3300010375 Bacteria 801
121 Ga0105246_11120899 3300011119 Bacteria 720
122 Ga0157370_10036558 3300013104 Bacteria 4764
123 Ga0157370_10055624 3300013104 Bacteria 3769
124 Ga0157370_10775448 3300013104 Bacteria 873
125 Ga0157369_10017917 3300013105 Bacteria 7950
126 Ga0157369_10838023 3300013105 Bacteria 944
127 Ga0157378_10004048 3300013297 Bacteria 12950
128 Ga0157378_10562164 3300013297 Bacteria 1147
129 Ga0163162_10066394 3300013306 Bacteria 3656
130 Ga0163162_10271680 3300013306 Bacteria 1827
131 Ga0163162_10511526 3300013306 Bacteria 1331
132 Ga0163162_10599962 3300013306 Bacteria 1227
133 Ga0163162_10734508 3300013306 Bacteria 1107
134 Ga0157372_10086873 3300013307 Bacteria 3548
135 Ga0157372_10625579 3300013307 Bacteria 1254
136 Ga0157375_10175202 3300013308 Bacteria 2294
137 Ga0157375_10273955 3300013308 Bacteria 1850
138 Ga0157375_10491762 3300013308 Bacteria 1391
139 Ga0157375_10970594 3300013308 Bacteria 991
140 Ga0163163_10268775 3300014325 Bacteria 1756
141 Ga0157380_10205344 3300014326 Bacteria 1751
142 Ga0157379_10226634 3300014968 Bacteria 1694
143 Ga0157379_10238973 3300014968 Bacteria 1647
144 Ga0157376_10439597 3300014969 Bacteria 1270
145 Ga0157376_11061364 3300014969 Bacteria 835
146 Ga0163161_10411357 3300017792 Bacteria 1086
147 Ga0163161_10522568 3300017792 Bacteria 969
148 Ga0206356_11359968 3300020070 Bacteria 874
149 Ga0206356_11398113 3300020070 Bacteria 2899
150 Ga0206353_10135456 3300020082 Bacteria 939
151 Ga0213874_10018686 3300021377 Bacteria 1876
152 Ga0209677_101932 3300025253 Bacteria 8283
153 Ga0209148_1009752 3300025254 Bacteria 1852
154 Ga0209233_1009040 3300025261 Bacteria 3049
155 Ga0209455_1001771 3300025272 Bacteria 9150
156 Ga0209455_1002109 3300025272 Bacteria 7927
157 Ga0209758_1007904 3300025297 Bacteria 7063
158 Ga0207692_10001892 3300025898 Bacteria 7957
159 Ga0207642_10026207 3300025899 Bacteria 2370
160 Ga0207642_10034696 3300025899 Bacteria 2148
161 Ga0207642_10135025 3300025899 Bacteria 1293
162 Ga0207688_10052507 3300025901 Bacteria 2284
163 Ga0207699_10000886 3300025906 Bacteria 14295
164 Ga0207699_10130047 3300025906 Bacteria 1641
165 Ga0207645_10180234 3300025907 Bacteria 1386
166 Ga0207645_10361579 3300025907 Bacteria 972
167 Ga0207645_10371739 3300025907 Bacteria 958
168 Ga0207695_10839938 3300025913 Bacteria 798
169 Ga0207693_10064641 3300025915 Bacteria 2866
170 Ga0207693_10102344 3300025915 Bacteria 2246
171 Ga0207693_10105153 3300025915 Bacteria 2214
172 Ga0207663_10012467 3300025916 Bacteria 4597
173 Ga0207663_10026684 3300025916 Bacteria 3356
174 Ga0207663_10252512 3300025916 Bacteria 1299
175 Ga0207660_10141268 3300025917 Bacteria 1841
176 Ga0207657_10042093 3300025919 Bacteria 4033
177 Ga0207649_10119335 3300025920 Bacteria 1776
178 Ga0207652_10765876 3300025921 Bacteria 858
179 Ga0207681_10172623 3300025923 Bacteria 1640
180 Ga0207650_10015306 3300025925 Bacteria 5339
181 Ga0207659_10641898 3300025926 Bacteria 907
182 Ga0207687_10031351 3300025927 Bacteria 3591
183 Ga0207687_10044681 3300025927 Bacteria 3058
184 Ga0207700_10047736 3300025928 Bacteria 3175
185 Ga0207700_10111056 3300025928 Bacteria 2206
186 Ga0207700_10152324 3300025928 Bacteria 1912
187 Ga0207664_10008367 3300025929 Bacteria 7210
188 Ga0207664_10356372 3300025929 Bacteria 1295
189 Ga0207664_10502140 3300025929 Bacteria 1086
190 Ga0207690_10194463 3300025932 Bacteria 1536
191 Ga0207706_10065555 3300025933 Bacteria 3198
192 Ga0207706_10069245 3300025933 Bacteria 3103
193 Ga0207706_10390120 3300025933 Bacteria 1208
194 Ga0207686_10215198 3300025934 Bacteria 1384
195 Ga0207709_10100124 3300025935 Bacteria 1914
196 Ga0207709_10349584 3300025935 Bacteria 1115
197 Ga0207670_10053670 3300025936 Bacteria 2717
198 Ga0207665_10079668 3300025939 Bacteria 2252
199 Ga0207665_10139295 3300025939 Bacteria 1728
200 Ga0207691_10028828 3300025940 Bacteria 5195
201 Ga0207691_10742600 3300025940 Bacteria 826
202 Ga0207711_10044711 3300025941 Bacteria 3782
203 Ga0207689_10025913 3300025942 Bacteria 4910
204 Ga0207689_10054011 3300025942 Bacteria 3309
205 Ga0207689_10704926 3300025942 Bacteria 851
206 Ga0207661_10209179 3300025944 Bacteria 1718
207 Ga0207679_10338834 3300025945 Bacteria 1307
208 Ga0207679_10876169 3300025945 Bacteria 820
209 Ga0207667_10692131 3300025949 Bacteria 1022
210 Ga0207651_10010736 3300025960 Bacteria 5090
211 Ga0207712_10280978 3300025961 Bacteria 1359
212 Ga0207668_10036096 3300025972 Bacteria 3297
213 Ga0207668_10234102 3300025972 Bacteria 1482
214 Ga0207668_10403284 3300025972 Bacteria 1156
215 Ga0207668_10516269 3300025972 Bacteria 1030
216 Ga0207640_10150410 3300025981 Bacteria 1710
217 Ga0207677_10960157 3300026023 Bacteria 773
218 Ga0207703_10270270 3300026035 Bacteria 1540
219 Ga0207703_10417931 3300026035 Bacteria 1247
220 Ga0207703_11009205 3300026035 Bacteria 798
221 Ga0207639_10301123 3300026041 Bacteria 1417
222 Ga0207639_10436980 3300026041 Bacteria 1186
223 Ga0207639_10534217 3300026041 Bacteria 1075
224 Ga0207678_10022693 3300026067 Bacteria 5496
225 Ga0207678_10047955 3300026067 Bacteria 3693
226 Ga0207678_10163900 3300026067 Bacteria 1898
227 Ga0207678_10172287 3300026067 Bacteria 1848
228 Ga0207678_10178109 3300026067 Bacteria 1815
229 Ga0207678_10235345 3300026067 Bacteria 1568
230 Ga0207678_10649382 3300026067 Bacteria 927
231 Ga0207678_10658707 3300026067 Bacteria 920
232 Ga0207708_10061905 3300026075 Bacteria 2858
233 Ga0207641_10687123 3300026088 Bacteria 1007
234 Ga0207648_10053433 3300026089 Bacteria 3531
235 Ga0207676_10039180 3300026095 Bacteria 3623
236 Ga0207676_10172900 3300026095 Bacteria 1884
237 Ga0207675_100062787 3300026118 Bacteria 3471
238 Ga0207675_100154057 3300026118 Bacteria 2189
239 Ga0207675_100605940 3300026118 Bacteria 1098
240 Ga0207683_10055863 3300026121 Bacteria 3462
241 Ga0207683_10065545 3300026121 Bacteria 3203
242 Ga0207683_10570049 3300026121 Bacteria 1047
243 Ga0207698_10110250 3300026142 Bacteria 2305
244 Ga0207698_10494432 3300026142 Bacteria 1189
245 Ga0209589_1000005 3300027357 Bacteria 530958
246 Ga0209489_100005 3300027361 Bacteria 530958
247 Ga0209700_100006 3300027363 Bacteria 530958
248 Ga0209813_10057957 3300027866 Bacteria 1230
249 Ga0209813_10173277 3300027866 Bacteria 785
250 Ga0207428_10243834 3300027907 Bacteria 1342
251 Ga0268266_10002736 3300028379 Bacteria 18448
252 Ga0268266_10019352 3300028379 Bacteria 5797
253 Ga0268266_10036101 3300028379 Bacteria 4205
254 Ga0268266_10076554 3300028379 Bacteria 2908
255 Ga0268266_10171032 3300028379 Bacteria 1972
256 Ga0268264_10397567 3300028381 Bacteria 1323
257 Ga0307517_10000098 3300028786 Bacteria 126044
258 Ga0307517_10413380 3300028786 Bacteria 710
259 Ga0307515_10122545 3300028794 Bacteria 2931
260 Ga0307515_10235023 3300028794 Bacteria 1616
261 Ga0265330_10015800 3300031235 Bacteria 3488
262 Ga0265340_10011584 3300031247 Bacteria 4682
263 Ga0307513_10058753 3300031456 Bacteria 4085
264 Ga0307513_10109297 3300031456 Bacteria 2763
265 Ga0307408_100763520 3300031548 Bacteria 874
266 Ga0307508_10096049 3300031616 Bacteria 2555
267 Ga0307413_10147115 3300031824 Bacteria 1637
268 Ga0307406_10219843 3300031901 Bacteria 1411
269 Ga0307409_100114549 3300031995 Bacteria 2268
270 Ga0307510_10002468 3300033180 Bacteria 21021
271 Ga0373930_0029391 3300034816 Bacteria 1123
272 Ga0373938_0007473 3300034957 Bacteria 1924
273 Ga0373944_0059473 3300035089 Bacteria 1223
274 Ga0373951_0023835 3300035091 Bacteria 1415
275 Ga0373923_0008176 3300035111 Bacteria 3717
276 Ga0373936_0038660 3300035113 Bacteria 1908
277 Ga0373955_0001757 3300035172 Bacteria 9300
278 Ga0373942_0088260 3300035207 Bacteria 931
279 Ga0373931_0021752 3300035691 Bacteria 3220
280 Ga0373927_0093174 3300035695 Bacteria 1957
281 Ga0373927_0109205 3300035695 Bacteria 1802
282 Ga0373927_0387748 3300035695 Bacteria 921
283 Ga0373933_0000026 3300035724 Bacteria 90309
284 Ga0373933_0003184 3300035724 Bacteria 9168
285 Ga0373947_0204459 3300035725 Bacteria 1293
286 Ga0373947_0299777 3300035725 Bacteria 1071
287 Ga0373937_0016121 3300036401 Bacteria 6629
288 Ga0373937_0115770 3300036401 Bacteria 2496
289 Ga0373925_0309392 3300037068 Bacteria 1277
290 Ga0373925_0845433 3300037068 Bacteria 754
291 Ga0395899_0170629 3300037312 Bacteria 1532
292 Ga0395899_0218466 3300037312 Bacteria 1321
293 Ga0395900_0040725 3300037418 Bacteria 4788
294 Ga0395898_0048210 3300037466 Bacteria 4179
295 Ga0436364_0004220 3300037853 Unclassified 702
296 Ga0436364_1092211 3300037853 Bacteria 2223
297 Ga0395901_0054662 3300038443 Bacteria 4150
298 Ga0395901_0221244 3300038443 Bacteria 1979
299 Ga0395901_0978851 3300038443 Bacteria 823
300 Ga0436365_1219019 3300039437 Bacteria 6385
301 Ga0436365_1243424 3300039437 Bacteria 1786
302 Ga0436365_1394139 3300039437 Bacteria 2904
303 Ga0436365_1732587 3300039437 Bacteria 2273
304 Ga0436360_0584942 3300039438 Bacteria 2638
305 Ga0436363_1602813 3300039450 Bacteria 2383
306 Ga0451807_1462804 3300041486 Bacteria 843
307 Ga0451845_0368407 3300041501 Bacteria 867
308 Ga0451849_1019899 3300041505 Bacteria 873
309 Ga0466961_0038795 3300044693 Bacteria 3055
310 Ga0466971_0126717 3300044719 Bacteria 1184
311 Ga0466957_0126687 3300044842 Bacteria 1632
312 Ga0466957_0275833 3300044842 Bacteria 1124
313 Ga0466959_0533221 3300045049 Bacteria 792
314 Ga0466958_0064099 3300045836 Bacteria 2241
315 Ga0466967_0070906 3300045976 Bacteria 3119
316 Ga0466967_0385126 3300045976 Bacteria 1362
317 Ga0495592_0036191 3300046454 Bacteria 3718
318 Ga0495603_0130346 3300046455 Bacteria 1464
319 Ga0495629_0070161 3300046459 Bacteria 2445
320 Ga0495629_0180218 3300046459 Bacteria 1464
321 Ga0495629_0313119 3300046459 Bacteria 1074
322 Ga0495638_0032118 3300046460 Bacteria 3368
323 Ga0495638_0213839 3300046460 Bacteria 1081
324 Ga0495651_0000373 3300046462 Bacteria 34587
325 Ga0495651_0072626 3300046462 Bacteria 2613
326 Ga0495651_0125490 3300046462 Bacteria 1880
327 Ga0495653_0010231 3300046463 Bacteria 7677
328 Ga0495650_0189524 3300046471 Bacteria 719
329 Ga0495580_0398061 3300046472 Bacteria 929
330 Ga0495582_0082153 3300046473 Bacteria 1790
331 Ga0495582_0095112 3300046473 Bacteria 1664
332 Ga0495582_0169674 3300046473 Bacteria 1242
333 Ga0495605_0208852 3300046474 Bacteria 848
334 Ga0495662_0264088 3300046476 Bacteria 847
335 Ga0495664_0001335 3300046477 Bacteria 12989
336 Ga0495664_0104300 3300046477 Bacteria 1709
337 Ga0495585_0180907 3300046492 Bacteria 1084
338 Ga0495585_0272589 3300046492 Bacteria 838
339 Ga0495585_0404478 3300046492 Bacteria 657
340 Ga0495594_0094831 3300046499 Bacteria 1675
341 Ga0495596_0170898 3300046500 Bacteria 845
342 Ga0495606_0001505 3300046507 Bacteria 30975
343 Ga0495608_0021698 3300046511 Bacteria 4406
344 Ga0495608_0053458 3300046511 Bacteria 2672
345 Ga0495610_0249070 3300046512 Bacteria 705
346 Ga0495618_0008671 3300046514 Bacteria 6146
347 Ga0495620_0075537 3300046515 Bacteria 1371
348 Ga0495628_0173112 3300046516 Bacteria 1636
349 Ga0495630_0189732 3300046517 Bacteria 1568
350 Ga0495631_0177849 3300046518 Bacteria 912
351 Ga0495632_0104081 3300046519 Bacteria 1336
352 Ga0495643_0111740 3300046522 Bacteria 1389
353 Ga0495644_0186396 3300046523 Bacteria 798
354 Ga0495666_0062897 3300046526 Bacteria 1772
355 Ga0495652_0033452 3300046529 Bacteria 4488
356 Ga0495652_0450414 3300046529 Bacteria 901
357 Ga0495640_0030954 3300046533 Bacteria 3825
358 Ga0495640_0136900 3300046533 Bacteria 1581
359 Ga0495587_0010689 3300046536 Bacteria 5828
360 Ga0495598_0047515 3300046537 Bacteria 1280
361 Ga0495609_0059342 3300046538 Bacteria 1691
362 Ga0495609_0105640 3300046538 Bacteria 1218
363 Ga0495645_0006200 3300046543 Bacteria 8278
364 Ga0495645_0035483 3300046543 Bacteria 3635
365 Ga0495622_0067022 3300046557 Bacteria 1659
366 Ga0495667_0001792 3300046559 Bacteria 14246
367 Ga0495667_0127472 3300046559 Unclassified 1642
368 Ga0495667_0631616 3300046559 Bacteria 666
369 Ga0495656_0078190 3300046615 Bacteria 1486
370 Ga0495656_0244514 3300046615 Bacteria 904
371 Ga0495668_0048244 3300046616 Bacteria 2363
372 Ga0495634_0010551 3300046642 Bacteria 6764
373 Ga0495634_0180731 3300046642 Unclassified 1321
374 Ga0495625_0289395 3300046660 Bacteria 1052
375 Ga0495625_0428973 3300046660 Bacteria 820
376 Ga0495635_0002389 3300046663 Bacteria 12790
377 Ga0495588_0087870 3300046674 Bacteria 1626
378 Ga0495657_0134266 3300046675 Bacteria 1547
379 Ga0495657_0179136 3300046675 Bacteria 1302
380 Ga0495599_0010812 3300046678 Bacteria 5594
381 Ga0495599_0028076 3300046678 Bacteria 3526
382 Ga0495623_0012402 3300046679 Bacteria 5519
383 Ga0495623_0152102 3300046679 Unclassified 1367
384 Ga0495646_0017415 3300046680 Bacteria 4558
385 Ga0495646_0040171 3300046680 Unclassified 2883
386 Ga0495647_0022402 3300046681 Bacteria 2282
387 Ga0495647_0203581 3300046681 Bacteria 869
388 Ga0495669_0001766 3300046684 Bacteria 8833
389 Ga0495669_0171664 3300046684 Bacteria 1032
390 Ga0495613_0177798 3300046689 Bacteria 1508
391 Ga0495624_0107745 3300046690 Bacteria 1714
392 Ga0495624_0170643 3300046690 Bacteria 1327
393 Ga0495604_0002176 3300047317 Bacteria 15730
394 Ga0495604_0066912 3300047317 Bacteria 2731
395 Ga0495604_0275241 3300047317 Bacteria 1139
396 Ga0495674_0007051 3300047319 Bacteria 10750
397 Ga0495672_0017936 3300047320 Bacteria 4718
398 Ga0495672_0209158 3300047320 Bacteria 970
399 Ga0495676_0042756 3300047321 Bacteria 3716
400 Ga0495676_0130566 3300047321 Bacteria 1814
401 Ga0495680_0037491 3300047322 Bacteria 3882
402 Ga0495680_0115768 3300047322 Bacteria 1983
403 Ga0495683_0085478 3300047323 Bacteria 1534
404 Ga0495675_0322871 3300047444 Bacteria 913
405 Ga0495677_0011853 3300047445 Bacteria 3184
406 Ga0495679_133466 3300047446 Bacteria 673
407 Ga0495673_0119020 3300047469 Bacteria 1048
408 Ga0495684_0042325 3300047471 Bacteria 3489
409 Ga0495593_0134530 3300047673 Bacteria 1254
410 Ga0495602_0248467 3300048088 Bacteria 1327
411 Ga0496100_0155839 3300048903 Bacteria 1633
412 Ga0496101_0015393 3300048904 Bacteria 5153
413 Ga0496101_0070671 3300048904 Bacteria 2557
414 Ga0496102_0357586 3300048905 Bacteria 1375
415 Ga0496102_0359417 3300048905 Bacteria 1371
416 Ga0496102_0417931 3300048905 Bacteria 1260
417 Ga0496102_0623578 3300048905 Bacteria 1001
418 Ga0496103_0146953 3300048906 Bacteria 1509
419 Ga0496103_0266068 3300048906 Bacteria 1103
420 Ga0496104_0032323 3300048907 Bacteria 4869
421 Ga0496104_0125848 3300048907 Bacteria 2461
422 Ga0496105_0010969 3300048908 Bacteria 7140
423 Ga0496105_0069854 3300048908 Bacteria 2903
424 Ga0496105_0253935 3300048908 Bacteria 1424
425 Ga0496105_0403072 3300048908 Bacteria 1085
426 Ga0496105_0748244 3300048908 Bacteria 747
427 Ga0496106_0059354 3300048909 Bacteria 2898
428 Ga0496106_0165600 3300048909 Bacteria 1750
429 Ga0496106_0491201 3300048909 Bacteria 986
430 Ga0496107_0025525 3300048910 Bacteria 4184
431 Ga0496107_0161923 3300048910 Bacteria 1658
432 Ga0496107_0198064 3300048910 Bacteria 1493
433 Ga0496107_0270122 3300048910 Bacteria 1266
434 Ga0496107_0386532 3300048910 Bacteria 1041
435 Ga0496107_0793888 3300048910 Bacteria 693
436 Ga0496108_0052446 3300048911 Bacteria 3418
437 Ga0496108_0215225 3300048911 Bacteria 1668
438 Ga0496108_0419093 3300048911 Bacteria 1169
439 Ga0496108_0960779 3300048911 Bacteria 731
440 Ga0496109_0057569 3300048912 Bacteria 3548
441 Ga0496109_0134662 3300048912 Bacteria 2308
442 Ga0496109_0442773 3300048912 Bacteria 1227
443 Ga0496109_0524177 3300048912 Bacteria 1118
444 Ga0496109_0580342 3300048912 Bacteria 1057
445 Ga0496110_0541143 3300048913 Bacteria 1059
446 Ga0496111_0006424 3300048914 Bacteria 7631
447 Ga0496111_0092676 3300048914 Bacteria 2215
448 Ga0496111_0289019 3300048914 Bacteria 1216
449 Ga0496111_0509219 3300048914 Bacteria 885
450 Ga0496112_0014817 3300048915 Bacteria 7250
451 Ga0496112_0015295 3300048915 Bacteria 7155
452 Ga0496112_0032780 3300048915 Bacteria 5044
453 Ga0496112_0460934 3300048915 Bacteria 1208
454 Ga0496112_0564718 3300048915 Bacteria 1071
455 Ga0496113_0181619 3300048916 Bacteria 1668
456 Ga0496113_0187647 3300048916 Bacteria 1640
457 Ga0496113_0246575 3300048916 Bacteria 1425
458 Ga0496114_0017725 3300048917 Bacteria 5753
459 Ga0496114_0066358 3300048917 Bacteria 3025
460 Ga0496114_0244909 3300048917 Bacteria 1577
461 Ga0496114_0310117 3300048917 Bacteria 1394
462 Ga0496115_0079633 3300048918 Bacteria 2667
463 Ga0496115_0107290 3300048918 Bacteria 2293
464 Ga0496115_0138674 3300048918 Bacteria 2006
465 Ga0496115_0331912 3300048918 Bacteria 1242
466 Ga0496116_0158982 3300048919 Bacteria 1243
467 Ga0496117_0136813 3300048920 Bacteria 1474
468 Ga0496117_0436890 3300048920 Bacteria 651
469 Ga0496118_0070751 3300048921 Bacteria 2516
470 Ga0496121_0012479 3300048924 Bacteria 9255
471 Ga0496121_0229473 3300048924 Bacteria 1301
472 Ga0496124_0102594 3300048927 Bacteria 2315
473 Ga0496124_0132105 3300048927 Bacteria 1982
474 Ga0496124_0336040 3300048927 Bacteria 1075
475 Ga0496125_0085784 3300048928 Bacteria 2384
476 Ga0496125_0324704 3300048928 Bacteria 931
477 Ga0496126_0007855 3300048929 Bacteria 11618
478 Ga0496126_0178281 3300048929 Bacteria 1806
479 Ga0496126_0195260 3300048929 Bacteria 1712
480 Ga0496126_0315890 3300048929 Bacteria 1285
481 Ga0496126_0360625 3300048929 Bacteria 1187
482 Ga0496126_0425053 3300048929 Bacteria 1073
483 Ga0496126_0499123 3300048929 Bacteria 973
484 Ga0501031_0000157 3300049568 Bacteria 38675
485 Ga0501032_0002373 3300049569 Bacteria 14704
486 Ga0501033_0000175 3300049570 Bacteria 60845
487 Ga0501034_0006645 3300049571 Bacteria 12413
488 Ga0501036_0000367 3300049572 Bacteria 31733
489 Ga0501037_0007027 3300049573 Bacteria 8219
490 Ga0501038_0000157 3300049574 Bacteria 58169
491 Ga0501039_0003135 3300049575 Bacteria 12366
492 Ga0501040_0243706 3300049576 Bacteria 1282
493 Ga0501046_0000387 3300049580 Bacteria 44269
494 Ga0501047_0006835 3300049581 Bacteria 10719
495 Ga0501048_0000655 3300049582 Bacteria 24936
496 Ga0501067_0000463 3300049583 Bacteria 22150
497 Ga0501068_0008984 3300049584 Bacteria 5575
498 Ga0501068_0413365 3300049584 Bacteria 871
499 Ga0501069_0023462 3300049585 Bacteria 3364
500 Ga0501070_0008624 3300049586 Bacteria 8618
501 Ga0501072_0000658 3300049588 Bacteria 24912
502 Ga0501072_0572151 3300049588 Bacteria 892
503 Ga0501073_0000239 3300049589 Bacteria 36296
504 Ga0501074_0000093 3300049590 Bacteria 42750
505 Ga0501076_0854649 3300049592 Bacteria 750
506 Ga0501079_0004929 3300049741 Bacteria 9897
507 Ga0501080_0000635 3300049742 Bacteria 27889
508 Ga0501083_0000350 3300049744 Bacteria 29150
509 Ga0501035_0000172 3300049822 Bacteria 79203
510 Ga0501044_0001408 3300049823 Bacteria 28203
511 nmdc:mga03n38_1102_c1 3300050490 Bacteria 7459
512 nmdc:mga03n38_43489_c1 3300050490 Bacteria 1968
513 nmdc:mga00v17_5293_c1 3300050491 Bacteria 6799
514 nmdc:mga0yw44_109922_c1 3300050492 Bacteria 1765
515 nmdc:mga0yw44_151822_c1 3300050492 Bacteria 1511
516 nmdc:mga0yw44_16013_c2 3300050492 Bacteria 1692
517 nmdc:mga0yw44_2044_c1 3300050492 Bacteria 8411
518 nmdc:mga0yw44_223837_c1 3300050492 Bacteria 1248
519 nmdc:mga06z11_134021_c1 3300050494 Bacteria 1394
520 nmdc:mga06z11_236518_c1 3300050494 Bacteria 1072
521 nmdc:mga06z11_30429_c1 3300050494 Bacteria 2612
522 nmdc:mga06z11_3791_c1 3300050494 Bacteria 5885
523 nmdc:mga06z11_448983_c1 3300050494 Bacteria 779
524 nmdc:mga06z11_541284_c1 3300050494 Bacteria 707
525 nmdc:mga07m45_156850_c1 3300050496 Bacteria 1321
526 nmdc:mga07m45_268404_c1 3300050496 Bacteria 993
527 nmdc:mga07m45_386048_c1 3300050496 Bacteria 813
528 nmdc:mga07m45_47170_c1 3300050496 Bacteria 2421
529 nmdc:mga08y16_220644_c1 3300050511 Bacteria 1963
530 nmdc:mga0n895_432692_c1 3300050512 Bacteria 1329
531 nmdc:mga08x19_656150_c1 3300050514 Bacteria 744
532 Ga0495601_0043387 3300053077 Bacteria 2824
533 Ga0495601_0107323 3300053077 Unclassified 1806
534 Ga0495601_0399284 3300053077 Bacteria 891
535 Ga0495612_0001273 3300053078 Bacteria 10398
536 Ga0495612_0004776 3300053078 Bacteria 5609
537 Ga0495595_0273431 3300053084 Bacteria 847
538 Ga0495619_0002335 3300053085 Bacteria 12494
539 Ga0495619_0058667 3300053085 Bacteria 2555
540 Ga0495619_0383331 3300053085 Bacteria 971
541 Ga0500643_096597 3300053087 Bacteria 803
542 Ga0500583_0202095 3300053092 Bacteria 987
543 Ga0500555_041982 3300053103 Bacteria 1272
544 Ga0500569_067740 3300053109 Bacteria 1117
545 Ga0500620_079917 3300053155 Bacteria 1132
546 Ga0500627_0055482 3300053158 Bacteria 1735
547 Ga0500636_0000093 3300053177 Bacteria 44972
548 Ga0500609_006602 3300053731 Bacteria 1579
549 Ga0501082_0003259 3300060353 Bacteria 14167
550 2508694121 2508501042 Bacteria 8719808
551 2513655353 2513237096 Bacteria 8722461
552 2513696119 2513237101 Bacteria 7952346
553 2513916569 2513237145 Bacteria 8979722
554 2723848857 2721755755 Bacteria 8322773
555 2728751766 2728368998 Bacteria 8720350
556 2874633574 2874628541 Bacteria 8630250
557 2904692722 2904690495 Bacteria 9412302
558 2908757638 2908756301 Bacteria 8864324
559 2922389519 2922386360 Bacteria 7017218
560 2935985808 2935984226 Bacteria 8302647
561 8006971102 8006964411 Bacteria 8966052
562 8006992975 8006984368 Bacteria 9651211
563 Ga0500610_0065372
564 rootH1_10043864
565 JGI25404J52841_10055678
566 Ga0070676_10076555
567 Ga0068869_100004434
568 Ga0068869_100433611
569 Ga0070666_10217477
570 Ga0070680_100109248
571 Ga0070680_100152098
572 Ga0070689_100120041
573 Ga0070661_100132010
574 Ga0070668_100115016
575 Ga0070668_100517913
576 Ga0070668_100534408
577 Ga0070675_100297684
578 Ga0070673_100004785
579 Ga0070688_100316990
580 Ga0070688_100433850
581 Ga0070667_100277341
582 Ga0070667_100400237
583 Ga0070667_100606621
584 Ga0070709_10001211
585 Ga0070709_10135759
586 Ga0070714_100013779
587 Ga0070714_100092522
588 Ga0070714_100451156
589 Ga0070714_100971718
590 Ga0070713_100035405
591 Ga0070713_100168113
592 Ga0070710_10003695
593 Ga0070711_100006816
594 Ga0070711_100021623
595 Ga0070711_100379481
596 Ga0070663_100068857
597 Ga0070678_100023004
598 Ga0070678_100056538
599 Ga0070662_100211718
600 Ga0068867_100537097
601 Ga0070685_10179825
602 Ga0070684_100013257
603 Ga0068853_100278504
604 Ga0068853_100421955
605 Ga0068853_101090876
606 Ga0070672_100120156
607 Ga0070686_100142897
608 Ga0070696_100207075
609 Ga0070665_100016387
610 Ga0070665_100018344
611 Ga0070665_100059824
612 Ga0070665_100230855
613 Ga0068855_100099047
614 Ga0070664_100193063
615 Ga0070664_100230872
616 Ga0070702_100284394
617 Ga0068852_100030085
618 Ga0068852_100147513
619 Ga0068864_100033735
620 Ga0068866_10114361
621 Ga0068861_100226420
622 Ga0068851_10236229
623 Ga0068863_100335601
624 Ga0068858_100384181
625 Ga0068858_100443025
626 Ga0068860_100096471
627 Ga0068860_100373519
628 Ga0068862_100244953
629 Ga0081538_10014803
630 Ga0081540_1001652
631 Ga0081540_1004900
632 Ga0081540_1013865
633 Ga0081540_1094899
634 Ga0081539_10019199
635 Ga0070717_10000460
636 Ga0070717_10004118
637 Ga0070717_10083613
638 Ga0070717_10406438
639 Ga0075365_10002534
640 Ga0075368_10103813
641 Ga0075363_100022562
642 Ga0075363_100082428
643 Ga0075364_10084168
644 Ga0070715_10062758
645 Ga0070716_100060472
646 Ga0070716_100331163
647 Ga0075367_10015720
648 Ga0075367_10143361
649 Ga0075367_10445584
650 Ga0075369_10059783
651 Ga0075369_10200972
652 Ga0075370_10043459
653 Ga0075370_10276889
654 Ga0068871_100563591
655 Ga0075428_100165992
656 Ga0075434_100187174
657 Ga0068865_100393182
658 Ga0068865_100530703
659 Ga0099825_1052051
660 Ga0099824_1006568
661 Ga0099822_1004807
662 Ga0105250_10157594
663 Ga0105240_10157372
664 Ga0105240_10337508
665 Ga0105245_10092689
666 Ga0105245_10750626
667 Ga0105247_10115701
668 Ga0105247_10127710
669 Ga0105247_10127723
670 Ga0114129_10606903
671 Ga0105243_10031625
672 Ga0105243_10648791
673 Ga0105242_10458867
674 Ga0105242_10465020
675 Ga0105248_10189544
676 Ga0105237_10191747
677 Ga0105238_10351208
678 Ga0105239_10056839
679 Ga0105239_10173053
680 Ga0105239_10210150
681 Ga0105239_10693736
682 Ga0105239_11421992
683 Ga0105246_11120899
684 Ga0157370_10036558
685 Ga0157370_10055624
686 Ga0157370_10775448
687 Ga0157369_10017917
688 Ga0157369_10838023
689 Ga0157378_10004048
690 Ga0157378_10562164
691 Ga0163162_10066394
692 Ga0163162_10271680
693 Ga0163162_10511526
694 Ga0163162_10599962
695 Ga0163162_10734508
696 Ga0157372_10086873
697 Ga0157372_10625579
698 Ga0157375_10175202
699 Ga0157375_10273955
700 Ga0157375_10491762
701 Ga0157375_10970594
702 Ga0163163_10268775
703 Ga0157380_10205344
704 Ga0157379_10226634
705 Ga0157379_10238973
706 Ga0157376_10439597
707 Ga0157376_11061364
708 Ga0163161_10411357
709 Ga0163161_10522568
710 Ga0206356_11359968
711 Ga0206356_11398113
712 Ga0206353_10135456
713 Ga0213874_10018686
714 Ga0209677_101932
715 Ga0209148_1009752
716 Ga0209233_1009040
717 Ga0209455_1001771
718 Ga0209455_1002109
719 Ga0209758_1007904
720 Ga0207692_10001892
721 Ga0207642_10026207
722 Ga0207642_10034696
723 Ga0207642_10135025
724 Ga0207688_10052507
725 Ga0207699_10000886
726 Ga0207699_10130047
727 Ga0207645_10180234
728 Ga0207645_10361579
729 Ga0207645_10371739
730 Ga0207695_10839938
731 Ga0207693_10064641
732 Ga0207693_10102344
733 Ga0207693_10105153
734 Ga0207663_10012467
735 Ga0207663_10026684
736 Ga0207663_10252512
737 Ga0207660_10141268
738 Ga0207657_10042093
739 Ga0207649_10119335
740 Ga0207652_10765876
741 Ga0207681_10172623
742 Ga0207650_10015306
743 Ga0207659_10641898
744 Ga0207687_10031351
745 Ga0207687_10044681
746 Ga0207700_10047736
747 Ga0207700_10111056
748 Ga0207700_10152324
749 Ga0207664_10008367
750 Ga0207664_10356372
751 Ga0207664_10502140
752 Ga0207690_10194463
753 Ga0207706_10065555
754 Ga0207706_10069245
755 Ga0207706_10390120
756 Ga0207686_10215198
757 Ga0207709_10100124
758 Ga0207709_10349584
759 Ga0207670_10053670
760 Ga0207665_10079668
761 Ga0207665_10139295
762 Ga0207691_10028828
763 Ga0207691_10742600
764 Ga0207711_10044711
765 Ga0207689_10025913
766 Ga0207689_10054011
767 Ga0207689_10704926
768 Ga0207661_10209179
769 Ga0207679_10338834
770 Ga0207679_10876169
771 Ga0207667_10692131
772 Ga0207651_10010736
773 Ga0207712_10280978
774 Ga0207668_10036096
775 Ga0207668_10234102
776 Ga0207668_10403284
777 Ga0207668_10516269
778 Ga0207640_10150410
779 Ga0207677_10960157
780 Ga0207703_10270270
781 Ga0207703_10417931
782 Ga0207703_11009205
783 Ga0207639_10301123
784 Ga0207639_10436980
785 Ga0207639_10534217
786 Ga0207678_10022693
787 Ga0207678_10047955
788 Ga0207678_10163900
789 Ga0207678_10172287
790 Ga0207678_10178109
791 Ga0207678_10235345
792 Ga0207678_10649382
793 Ga0207678_10658707
794 Ga0207708_10061905
795 Ga0207641_10687123
796 Ga0207648_10053433
797 Ga0207676_10039180
798 Ga0207676_10172900
799 Ga0207675_100062787
800 Ga0207675_100154057
801 Ga0207675_100605940
802 Ga0207683_10055863
803 Ga0207683_10065545
804 Ga0207683_10570049
805 Ga0207698_10110250
806 Ga0207698_10494432
807 Ga0209589_1000005
808 Ga0209489_100005
809 Ga0209700_100006
810 Ga0209813_10057957
811 Ga0209813_10173277
812 Ga0207428_10243834
813 Ga0268266_10002736
814 Ga0268266_10019352
815 Ga0268266_10036101
816 Ga0268266_10076554
817 Ga0268266_10171032
818 Ga0268264_10397567
819 Ga0307517_10000098
820 Ga0307517_10413380
821 Ga0307515_10122545
822 Ga0307515_10235023
823 Ga0265330_10015800
824 Ga0265340_10011584
825 Ga0307513_10058753
826 Ga0307513_10109297
827 Ga0307408_100763520
828 Ga0307508_10096049
829 Ga0307413_10147115
830 Ga0307406_10219843
831 Ga0307409_100114549
832 Ga0307510_10002468
833 Ga0373930_0029391
834 Ga0373938_0007473
835 Ga0373944_0059473
836 Ga0373951_0023835
837 Ga0373923_0008176
838 Ga0373936_0038660
839 Ga0373955_0001757
840 Ga0373942_0088260
841 Ga0373931_0021752
842 Ga0373927_0093174
843 Ga0373927_0109205
844 Ga0373927_0387748
845 Ga0373933_0000026
846 Ga0373933_0003184
847 Ga0373947_0204459
848 Ga0373947_0299777
849 Ga0373937_0016121
850 Ga0373937_0115770
851 Ga0373925_0309392
852 Ga0373925_0845433
853 Ga0395899_0170629
854 Ga0395899_0218466
855 Ga0395900_0040725
856 Ga0395898_0048210
857 Ga0436364_0004220
858 Ga0436364_1092211
859 Ga0395901_0054662
860 Ga0395901_0221244
861 Ga0395901_0978851
862 Ga0436365_1219019
863 Ga0436365_1243424
864 Ga0436365_1394139
865 Ga0436365_1732587
866 Ga0436360_0584942
867 Ga0436363_1602813
868 Ga0451807_1462804
869 Ga0451845_0368407
870 Ga0451849_1019899
871 Ga0466961_0038795
872 Ga0466971_0126717
873 Ga0466957_0126687
874 Ga0466957_0275833
875 Ga0466959_0533221
876 Ga0466958_0064099
877 Ga0466967_0070906
878 Ga0466967_0385126
879 Ga0495592_0036191
880 Ga0495603_0130346
881 Ga0495629_0070161
882 Ga0495629_0180218
883 Ga0495629_0313119
884 Ga0495638_0032118
885 Ga0495638_0213839
886 Ga0495651_0000373
887 Ga0495651_0072626
888 Ga0495651_0125490
889 Ga0495653_0010231
890 Ga0495650_0189524
891 Ga0495580_0398061
892 Ga0495582_0082153
893 Ga0495582_0095112
894 Ga0495582_0169674
895 Ga0495605_0208852
896 Ga0495662_0264088
897 Ga0495664_0001335
898 Ga0495664_0104300
899 Ga0495585_0180907
900 Ga0495585_0272589
901 Ga0495585_0404478
902 Ga0495594_0094831
903 Ga0495596_0170898
904 Ga0495606_0001505
905 Ga0495608_0021698
906 Ga0495608_0053458
907 Ga0495610_0249070
908 Ga0495618_0008671
909 Ga0495620_0075537
910 Ga0495628_0173112
911 Ga0495630_0189732
912 Ga0495631_0177849
913 Ga0495632_0104081
914 Ga0495643_0111740
915 Ga0495644_0186396
916 Ga0495666_0062897
917 Ga0495652_0033452
918 Ga0495652_0450414
919 Ga0495640_0030954
920 Ga0495640_0136900
921 Ga0495587_0010689
922 Ga0495598_0047515
923 Ga0495609_0059342
924 Ga0495609_0105640
925 Ga0495645_0006200
926 Ga0495645_0035483
927 Ga0495622_0067022
928 Ga0495667_0001792
929 Ga0495667_0127472
930 Ga0495667_0631616
931 Ga0495656_0078190
932 Ga0495656_0244514
933 Ga0495668_0048244
934 Ga0495634_0010551
935 Ga0495634_0180731
936 Ga0495625_0289395
937 Ga0495625_0428973
938 Ga0495635_0002389
939 Ga0495588_0087870
940 Ga0495657_0134266
941 Ga0495657_0179136
942 Ga0495599_0010812
943 Ga0495599_0028076
944 Ga0495623_0012402
945 Ga0495623_0152102
946 Ga0495646_0017415
947 Ga0495646_0040171
948 Ga0495647_0022402
949 Ga0495647_0203581
950 Ga0495669_0001766
951 Ga0495669_0171664
952 Ga0495613_0177798
953 Ga0495624_0107745
954 Ga0495624_0170643
955 Ga0495604_0002176
956 Ga0495604_0066912
957 Ga0495604_0275241
958 Ga0495674_0007051
959 Ga0495672_0017936
960 Ga0495672_0209158
961 Ga0495676_0042756
962 Ga0495676_0130566
963 Ga0495680_0037491
964 Ga0495680_0115768
965 Ga0495683_0085478
966 Ga0495675_0322871
967 Ga0495677_0011853
968 Ga0495679_133466
969 Ga0495673_0119020
970 Ga0495684_0042325
971 Ga0495593_0134530
972 Ga0495602_0248467
973 Ga0496100_0155839
974 Ga0496101_0015393
975 Ga0496101_0070671
976 Ga0496102_0357586
977 Ga0496102_0359417
978 Ga0496102_0417931
979 Ga0496102_0623578
980 Ga0496103_0146953
981 Ga0496103_0266068
982 Ga0496104_0032323
983 Ga0496104_0125848
984 Ga0496105_0010969
985 Ga0496105_0069854
986 Ga0496105_0253935
987 Ga0496105_0403072
988 Ga0496105_0748244
989 Ga0496106_0059354
990 Ga0496106_0165600
991 Ga0496106_0491201
992 Ga0496107_0025525
993 Ga0496107_0161923
994 Ga0496107_0198064
995 Ga0496107_0270122
996 Ga0496107_0386532
997 Ga0496107_0793888
998 Ga0496108_0052446
999 Ga0496108_0215225
1000 Ga0496108_0419093
1001 Ga0496108_0960779
1002 Ga0496109_0057569
1003 Ga0496109_0134662
1004 Ga0496109_0442773
1005 Ga0496109_0524177
1006 Ga0496109_0580342
1007 Ga0496110_0541143
1008 Ga0496111_0006424
1009 Ga0496111_0092676
1010 Ga0496111_0289019
1011 Ga0496111_0509219
1012 Ga0496112_0014817
1013 Ga0496112_0015295
1014 Ga0496112_0032780
1015 Ga0496112_0460934
1016 Ga0496112_0564718
1017 Ga0496113_0181619
1018 Ga0496113_0187647
1019 Ga0496113_0246575
1020 Ga0496114_0017725
1021 Ga0496114_0066358
1022 Ga0496114_0244909
1023 Ga0496114_0310117
1024 Ga0496115_0079633
1025 Ga0496115_0107290
1026 Ga0496115_0138674
1027 Ga0496115_0331912
1028 Ga0496116_0158982
1029 Ga0496117_0136813
1030 Ga0496117_0436890
1031 Ga0496118_0070751
1032 Ga0496121_0012479
1033 Ga0496121_0229473
1034 Ga0496124_0102594
1035 Ga0496124_0132105
1036 Ga0496124_0336040
1037 Ga0496125_0085784
1038 Ga0496125_0324704
1039 Ga0496126_0007855
1040 Ga0496126_0178281
1041 Ga0496126_0195260
1042 Ga0496126_0315890
1043 Ga0496126_0360625
1044 Ga0496126_0425053
1045 Ga0496126_0499123
1046 Ga0501031_0000157
1047 Ga0501032_0002373
1048 Ga0501033_0000175
1049 Ga0501034_0006645
1050 Ga0501036_0000367
1051 Ga0501037_0007027
1052 Ga0501038_0000157
1053 Ga0501039_0003135
1054 Ga0501040_0243706
1055 Ga0501046_0000387
1056 Ga0501047_0006835
1057 Ga0501048_0000655
1058 Ga0501067_0000463
1059 Ga0501068_0008984
1060 Ga0501068_0413365
1061 Ga0501069_0023462
1062 Ga0501070_0008624
1063 Ga0501072_0000658
1064 Ga0501072_0572151
1065 Ga0501073_0000239
1066 Ga0501074_0000093
1067 Ga0501076_0854649
1068 Ga0501079_0004929
1069 Ga0501080_0000635
1070 Ga0501083_0000350
1071 Ga0501035_0000172
1072 Ga0501044_0001408
1073 nmdc:mga03n38_1102_c1
1074 nmdc:mga03n38_43489_c1
1075 nmdc:mga00v17_5293_c1
1076 nmdc:mga0yw44_109922_c1
1077 nmdc:mga0yw44_151822_c1
1078 nmdc:mga0yw44_16013_c2
1079 nmdc:mga0yw44_2044_c1
1080 nmdc:mga0yw44_223837_c1
1081 nmdc:mga06z11_134021_c1
1082 nmdc:mga06z11_236518_c1
1083 nmdc:mga06z11_30429_c1
1084 nmdc:mga06z11_3791_c1
1085 nmdc:mga06z11_448983_c1
1086 nmdc:mga06z11_541284_c1
1087 nmdc:mga07m45_156850_c1
1088 nmdc:mga07m45_268404_c1
1089 nmdc:mga07m45_386048_c1
1090 nmdc:mga07m45_47170_c1
1091 nmdc:mga08y16_220644_c1
1092 nmdc:mga0n895_432692_c1
1093 nmdc:mga08x19_656150_c1
1094 Ga0495601_0043387
1095 Ga0495601_0107323
1096 Ga0495601_0399284
1097 Ga0495612_0001273
1098 Ga0495612_0004776
1099 Ga0495595_0273431
1100 Ga0495619_0002335
1101 Ga0495619_0058667
1102 Ga0495619_0383331
1103 Ga0500643_096597
1104 Ga0500583_0202095
1105 Ga0500555_041982
1106 Ga0500569_067740
1107 Ga0500620_079917
1108 Ga0500627_0055482
1109 Ga0500636_0000093
1110 Ga0500609_006602
1111 Ga0501082_0003259
1112 2508694121
1113 2513655353
1114 2513696119
1115 2513916569
1116 2723848857
1117 2728751766
1118 2874633574
1119 2904692722
1120 2908757638
1121 2922389519
1122 2935985808
1123 8006971102
1124 8006992975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

54

99

0.96

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

126

230

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8983 35 219
3bru-assembly1.cif.gz_B crystal structure of regulatory protein tetr from rhodobacter sphaeroides 0.8957 38 218
4kwa-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator from saccharomonospora viridis in complex with choline 0.8742 35 216
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.8702 35 215
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8677 35 219
ID Description Score Start End Superfamily
2i10B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.938 37 87 1.10.10.60
3locA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9257 35 82 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9193 36 82 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9165 37 82 1.10.10.60
3bqzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9139 35 80 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3D9HXZ7-F1-model_v4 TetR family transcriptional regulator 0.94 32 221 GO:0003677
GO:0006355
AF-A0A6J4SWB7-F1-model_v4 HTH tetR-type domain-containing protein 0.9302 31 219 GO:0003677
GO:0006355
AF-A0A1B4YPW5-F1-model_v4 deleted 0.9298 46 217
AF-A0A1Y5E4Q7-F1-model_v4 HTH tetR-type domain-containing protein 0.9284 27 215 GO:0003677
GO:0006355
AF-A0A3B0SFN1-F1-model_v4 HTH tetR-type domain-containing protein 0.9257 44 222 GO:0003677
GO:0006355

Map