F463947

General Info

Members Datasets Scaffolds Average Seq Length
562 233 1124 230

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10155271|Ga0268265_101552712
Length 232
Sequence LVQSPVLVKALNKGPVRTVTVKQGAEQVSELTTNRLSVYLRCLNALDDAGVRTISSQALAEQFHLNAAQIRKDLAYFGEFGVRGIGYYVSGLKAELQRILGLDREWPVALVGLGNLGAALFHYKGFARQGFRIALVIDDDPAKIGREIEGVPIVAGRDMAREIKARAVQIAIVAVPPEAAQAVTEQLVTAGIKAVLNFAPTRLRVARDVRLKNVDLSIELETLSFYLAKGSR

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 3.91
Rhizosphere 95.37
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10155271 3300028380 Unclassified 1936
2 Ga0065704_10026703 3300005289 Bacteria 1139
3 Ga0065712_10082701 3300005290 Bacteria 2880
4 Ga0065712_10096263 3300005290 Bacteria 2189
5 Ga0065715_10101612 3300005293 Bacteria 3187
6 Ga0065715_10110137 3300005293 Bacteria 2635
7 Ga0065715_10199992 3300005293 Bacteria 1367
8 Ga0065715_10273944 3300005293 Bacteria 1103
9 Ga0065707_10062267 3300005295 Unclassified 1156
10 Ga0065707_10234955 3300005295 Bacteria 1175
11 Ga0070658_10056272 3300005327 Bacteria 3196
12 Ga0070676_10006076 3300005328 Bacteria 6446
13 Ga0070683_100245266 3300005329 Bacteria 1704
14 Ga0070690_100034801 3300005330 Bacteria 3157
15 Ga0070690_100632318 3300005330 Bacteria 815
16 Ga0070670_100044473 3300005331 Bacteria 3818
17 Ga0070670_100142724 3300005331 Bacteria 2071
18 Ga0070670_100211076 3300005331 Bacteria 1688
19 Ga0070670_100317403 3300005331 Bacteria 1365
20 Ga0068869_100174897 3300005334 Bacteria 1679
21 Ga0068869_100314825 3300005334 Bacteria 1268
22 Ga0070666_10040832 3300005335 Bacteria 3098
23 Ga0070666_10130953 3300005335 Bacteria 1743
24 Ga0070680_100318190 3300005336 Bacteria 1321
25 Ga0070680_100343741 3300005336 Bacteria 1268
26 Ga0068868_100204214 3300005338 Bacteria 1649
27 Ga0068868_100611522 3300005338 Unclassified 966
28 Ga0070660_100003101 3300005339 Bacteria 11420
29 Ga0070660_100067863 3300005339 Bacteria 2779
30 Ga0070660_100251434 3300005339 Bacteria 1441
31 Ga0070689_100016061 3300005340 Bacteria 5475
32 Ga0070689_100292155 3300005340 Bacteria 1355
33 Ga0070691_10138690 3300005341 Bacteria 1237
34 Ga0070687_100064288 3300005343 Bacteria 1949
35 Ga0070687_100075210 3300005343 Bacteria 1826
36 Ga0070668_100024512 3300005347 Bacteria 4571
37 Ga0070668_100073053 3300005347 Bacteria 2673
38 Ga0070669_100008247 3300005353 Bacteria 7442
39 Ga0070669_100057184 3300005353 Bacteria 2861
40 Ga0070669_100233782 3300005353 Bacteria 1458
41 Ga0070669_100355181 3300005353 Bacteria 1190
42 Ga0070675_100000217 3300005354 Bacteria 36989
43 Ga0070675_100007246 3300005354 Bacteria 8556
44 Ga0070675_100021888 3300005354 Bacteria 5108
45 Ga0070675_100363208 3300005354 Bacteria 1286
46 Ga0070675_100553334 3300005354 Bacteria 1041
47 Ga0070671_100113823 3300005355 Bacteria 2273
48 Ga0070671_100221077 3300005355 Bacteria 1607
49 Ga0070674_100109161 3300005356 Bacteria 2028
50 Ga0070674_100112619 3300005356 Bacteria 2000
51 Ga0070673_100080886 3300005364 Bacteria 2634
52 Ga0070673_100086043 3300005364 Bacteria 2561
53 Ga0070673_100146631 3300005364 Bacteria 1995
54 Ga0070673_100660278 3300005364 Bacteria 958
55 Ga0070688_100013666 3300005365 Bacteria 4585
56 Ga0070688_100097658 3300005365 Bacteria 1931
57 Ga0070688_100253194 3300005365 Bacteria 1255
58 Ga0070688_100733974 3300005365 Unclassified 767
59 Ga0070659_100131227 3300005366 Bacteria 2035
60 Ga0070659_100181716 3300005366 Bacteria 1726
61 Ga0070659_100213437 3300005366 Bacteria 1591
62 Ga0070667_100172171 3300005367 Bacteria 1912
63 Ga0070703_10008349 3300005406 Bacteria 2911
64 Ga0070701_10014330 3300005438 Bacteria 3631
65 Ga0070701_10108023 3300005438 Bacteria 1551
66 Ga0070701_10126832 3300005438 Bacteria 1445
67 Ga0070705_100001877 3300005440 Bacteria 10804
68 Ga0070705_100002042 3300005440 Bacteria 10313
69 Ga0070705_100007095 3300005440 Bacteria 5510
70 Ga0070705_100411135 3300005440 Bacteria 1004
71 Ga0070700_100027810 3300005441 Bacteria 3357
72 Ga0070700_100046000 3300005441 Bacteria 2694
73 Ga0070700_100429172 3300005441 Unclassified 1000
74 Ga0070694_100002410 3300005444 Bacteria 11041
75 Ga0070694_100027569 3300005444 Bacteria 3690
76 Ga0070694_100048388 3300005444 Bacteria 2860
77 Ga0070678_100076372 3300005456 Bacteria 2523
78 Ga0070678_100286199 3300005456 Unclassified 1396
79 Ga0070678_100343694 3300005456 Bacteria 1281
80 Ga0070678_100784830 3300005456 Unclassified 864
81 Ga0070662_100253030 3300005457 Bacteria 1417
82 Ga0070662_100282741 3300005457 Bacteria 1343
83 Ga0070662_100412767 3300005457 Bacteria 1116
84 Ga0070681_10005238 3300005458 Bacteria 12524
85 Ga0070681_10024105 3300005458 Bacteria 6125
86 Ga0070681_10380734 3300005458 Bacteria 1322
87 Ga0070681_10748649 3300005458 Unclassified 894
88 Ga0068867_100001103 3300005459 Bacteria 18461
89 Ga0068867_100001545 3300005459 Bacteria 15991
90 Ga0068867_100042218 3300005459 Bacteria 3335
91 Ga0068867_100158579 3300005459 Unclassified 1783
92 Ga0068867_100283702 3300005459 Bacteria 1359
93 Ga0070707_100040303 3300005468 Bacteria 4469
94 Ga0070707_100124509 3300005468 Bacteria 2504
95 Ga0070707_100228538 3300005468 Bacteria 1812
96 Ga0070707_100267372 3300005468 Unclassified 1663
97 Ga0070707_100559448 3300005468 Bacteria 1106
98 Ga0070698_100010246 3300005471 Bacteria 10011
99 Ga0070698_100197552 3300005471 Bacteria 1947
100 Ga0070698_100318042 3300005471 Bacteria 1487
101 Ga0070699_100007909 3300005518 Bacteria 9239
102 Ga0070699_100017888 3300005518 Bacteria 6086
103 Ga0070699_100414532 3300005518 Bacteria 1219
104 Ga0070679_100008442 3300005530 Bacteria 9696
105 Ga0070679_100207985 3300005530 Bacteria 1921
106 Ga0070679_100273452 3300005530 Bacteria 1643
107 Ga0070684_100135285 3300005535 Bacteria 2226
108 Ga0070684_100150219 3300005535 Bacteria 2110
109 Ga0070684_100237354 3300005535 Bacteria 1665
110 Ga0070697_100023295 3300005536 Bacteria 4924
111 Ga0070697_100048611 3300005536 Bacteria 3440
112 Ga0070672_100027504 3300005543 Bacteria 4243
113 Ga0070672_100281671 3300005543 Bacteria 1406
114 Ga0070672_100343354 3300005543 Bacteria 1272
115 Ga0070686_100002820 3300005544 Bacteria 9571
116 Ga0070686_100185599 3300005544 Bacteria 1481
117 Ga0070695_100000873 3300005545 Bacteria 16239
118 Ga0070695_100006000 3300005545 Bacteria 7170
119 Ga0070695_100065917 3300005545 Bacteria 2359
120 Ga0070695_100241776 3300005545 Bacteria 1310
121 Ga0070696_100002392 3300005546 Bacteria 12413
122 Ga0070696_100025159 3300005546 Bacteria 4046
123 Ga0070696_100031809 3300005546 Bacteria 3618
124 Ga0070696_100228242 3300005546 Bacteria 1400
125 Ga0070665_100011986 3300005548 Bacteria 8751
126 Ga0070704_100004850 3300005549 Bacteria 7797
127 Ga0070704_100015315 3300005549 Bacteria 4815
128 Ga0070704_100020513 3300005549 Bacteria 4263
129 Ga0070704_100040402 3300005549 Bacteria 3211
130 Ga0070704_100511650 3300005549 Bacteria 1043
131 Ga0068855_100071814 3300005563 Bacteria 4024
132 Ga0070664_100065235 3300005564 Bacteria 3106
133 Ga0070664_100067659 3300005564 Bacteria 3053
134 Ga0070664_100079571 3300005564 Bacteria 2822
135 Ga0070664_100244296 3300005564 Bacteria 1612
136 Ga0070664_100244482 3300005564 Bacteria 1612
137 Ga0068857_100033831 3300005577 Bacteria 4521
138 Ga0068857_100210097 3300005577 Bacteria 1776
139 Ga0068857_100434934 3300005577 Bacteria 1225
140 Ga0068854_100023156 3300005578 Bacteria 4240
141 Ga0068854_100119195 3300005578 Bacteria 2001
142 Ga0068856_100118860 3300005614 Bacteria 2644
143 Ga0070702_100001216 3300005615 Bacteria 10423
144 Ga0070702_100273215 3300005615 Bacteria 1157
145 Ga0068859_100008086 3300005617 Bacteria 10664
146 Ga0068859_100034797 3300005617 Bacteria 5055
147 Ga0068859_100052549 3300005617 Bacteria 4097
148 Ga0068859_100239678 3300005617 Bacteria 1902
149 Ga0068864_100014953 3300005618 Bacteria 6450
150 Ga0068864_100201993 3300005618 Bacteria 1826
151 Ga0068866_10030106 3300005718 Bacteria 2601
152 Ga0068866_10089873 3300005718 Bacteria 1670
153 Ga0068866_10250339 3300005718 Bacteria 1084
154 Ga0068861_100000837 3300005719 Bacteria 18612
155 Ga0068861_100011345 3300005719 Bacteria 6189
156 Ga0068861_100166212 3300005719 Bacteria 1824
157 Ga0068861_100251258 3300005719 Bacteria 1509
158 Ga0068861_100609996 3300005719 Bacteria 1003
159 Ga0068870_10002158 3300005840 Bacteria 8142
160 Ga0068870_10012529 3300005840 Bacteria 3966
161 Ga0068870_10202316 3300005840 Bacteria 1205
162 Ga0068863_100138086 3300005841 Bacteria 2329
163 Ga0068863_100139849 3300005841 Unclassified 2314
164 Ga0068858_100027710 3300005842 Bacteria 5264
165 Ga0068860_100005189 3300005843 Bacteria 13241
166 Ga0068860_100084020 3300005843 Bacteria 3028
167 Ga0068860_100153966 3300005843 Bacteria 2215
168 Ga0068862_100006410 3300005844 Bacteria 9786
169 Ga0068862_100026584 3300005844 Bacteria 4865
170 Ga0068862_100061417 3300005844 Bacteria 3230
171 Ga0068862_100292593 3300005844 Bacteria 1496
172 Ga0068862_100412136 3300005844 Bacteria 1266
173 Ga0081455_10039975 3300005937 Bacteria 4140
174 Ga0081455_10150346 3300005937 Bacteria 1796
175 Ga0081539_10000795 3300005985 Bacteria 61261
176 Ga0081539_10007243 3300005985 Bacteria 10193
177 Ga0097621_100004479 3300006237 Bacteria 9739
178 Ga0097621_100089234 3300006237 Bacteria 2577
179 Ga0097621_100133654 3300006237 Bacteria 2114
180 Ga0097621_100242792 3300006237 Bacteria 1575
181 Ga0075370_10009768 3300006353 Bacteria 4997
182 Ga0068871_100004065 3300006358 Bacteria 10121
183 Ga0068871_100031297 3300006358 Bacteria 4196
184 Ga0068871_100048214 3300006358 Bacteria 3438
185 Ga0068871_100186599 3300006358 Bacteria 1784
186 Ga0068871_100300449 3300006358 Bacteria 1409
187 Ga0068871_100525724 3300006358 Bacteria 1069
188 Ga0075428_100016926 3300006844 Bacteria 8051
189 Ga0075428_100201006 3300006844 Bacteria 2154
190 Ga0075433_10045384 3300006852 Bacteria 3820
191 Ga0075433_10057437 3300006852 Bacteria 3401
192 Ga0075433_10193800 3300006852 Bacteria 1807
193 Ga0075433_10409910 3300006852 Bacteria 1195
194 Ga0075433_10492998 3300006852 Bacteria 1079
195 Ga0075434_100001066 3300006871 Bacteria 22406
196 Ga0075434_100011749 3300006871 Bacteria 8271
197 Ga0075434_100018566 3300006871 Bacteria 6720
198 Ga0075434_100026577 3300006871 Bacteria 5672
199 Ga0075434_100089801 3300006871 Bacteria 3074
200 Ga0075434_100268842 3300006871 Bacteria 1724
201 Ga0075429_100020286 3300006880 Bacteria 5764
202 Ga0068865_100003665 3300006881 Bacteria 9224
203 Ga0068865_100060577 3300006881 Bacteria 2650
204 Ga0075436_100002115 3300006914 Bacteria 13695
205 Ga0075436_100005193 3300006914 Bacteria 8962
206 Ga0075436_100022285 3300006914 Bacteria 4350
207 Ga0075436_100183206 3300006914 Bacteria 1480
208 Ga0097620_100008086 3300006931 Bacteria 10664
209 Ga0097620_100034797 3300006931 Bacteria 5055
210 Ga0097620_100052550 3300006931 Bacteria 4097
211 Ga0097620_100239692 3300006931 Bacteria 1902
212 Ga0075435_100000017 3300007076 Bacteria 99666
213 Ga0075435_100001194 3300007076 Bacteria 16599
214 Ga0075435_100009185 3300007076 Bacteria 7138
215 Ga0075435_100022985 3300007076 Bacteria 4815
216 Ga0075435_100070388 3300007076 Bacteria 2855
217 Ga0075435_100074719 3300007076 Bacteria 2773
218 Ga0075435_100092702 3300007076 Bacteria 2495
219 Ga0075435_100095059 3300007076 Bacteria 2464
220 Ga0075435_100105348 3300007076 Bacteria 2341
221 Ga0105240_10033592 3300009093 Bacteria 6623
222 Ga0105240_10084229 3300009093 Bacteria 3899
223 Ga0105240_11163011 3300009093 Bacteria 818
224 Ga0111539_10000015 3300009094 Bacteria 296576
225 Ga0111539_10001132 3300009094 Bacteria 35254
226 Ga0111539_10013593 3300009094 Bacteria 10175
227 Ga0111539_10033967 3300009094 Bacteria 6188
228 Ga0111539_10035484 3300009094 Bacteria 6037
229 Ga0111539_10126688 3300009094 Bacteria 2991
230 Ga0111539_10179967 3300009094 Bacteria 2470
231 Ga0111539_10287233 3300009094 Bacteria 1914
232 Ga0111539_10354731 3300009094 Bacteria 1707
233 Ga0105245_10219355 3300009098 Bacteria 1834
234 Ga0105245_10538171 3300009098 Bacteria 1189
235 Ga0105245_10681787 3300009098 Bacteria 1060
236 Ga0105247_10030308 3300009101 Bacteria 3278
237 Ga0114129_10000239 3300009147 Bacteria 61404
238 Ga0114129_10003080 3300009147 Bacteria 23394
239 Ga0114129_10012983 3300009147 Bacteria 11860
240 Ga0114129_10037306 3300009147 Bacteria 6863
241 Ga0114129_10074065 3300009147 Bacteria 4743
242 Ga0114129_10192095 3300009147 Bacteria 2772
243 Ga0114129_10218954 3300009147 Bacteria 2569
244 Ga0114129_10358047 3300009147 Bacteria 1931
245 Ga0114129_10373293 3300009147 Bacteria 1885
246 Ga0114129_10456689 3300009147 Bacteria 1675
247 Ga0114129_10511672 3300009147 Bacteria 1566
248 Ga0105243_10020790 3300009148 Bacteria 4980
249 Ga0105243_10039179 3300009148 Bacteria 3693
250 Ga0105243_10410062 3300009148 Bacteria 1261
251 Ga0105243_10475996 3300009148 Bacteria 1177
252 Ga0105243_10497108 3300009148 Unclassified 1155
253 Ga0105242_10015703 3300009176 Bacteria 5883
254 Ga0105242_10026582 3300009176 Bacteria 4587
255 Ga0105242_10052095 3300009176 Bacteria 3338
256 Ga0105242_10463647 3300009176 Bacteria 1197
257 Ga0105242_10706715 3300009176 Bacteria 987
258 Ga0105242_10750088 3300009176 Bacteria 961
259 Ga0105248_10011543 3300009177 Bacteria 9735
260 Ga0105248_10017224 3300009177 Bacteria 7961
261 Ga0105248_10103185 3300009177 Bacteria 3214
262 Ga0105248_10204903 3300009177 Bacteria 2223
263 Ga0105248_10360424 3300009177 Bacteria 1637
264 Ga0105248_10536366 3300009177 Bacteria 1320
265 Ga0105238_10280677 3300009551 Bacteria 1647
266 Ga0105238_10916466 3300009551 Bacteria 895
267 Ga0105238_11196484 3300009551 Bacteria 784
268 Ga0105249_10006058 3300009553 Bacteria 10479
269 Ga0105249_10143057 3300009553 Bacteria 2295
270 Ga0105249_10254324 3300009553 Bacteria 1743
271 Ga0105249_10355207 3300009553 Bacteria 1486
272 Ga0105249_10428325 3300009553 Bacteria 1358
273 Ga0105249_10519572 3300009553 Bacteria 1238
274 Ga0105246_10182909 3300011119 Bacteria 1615
275 Ga0157369_11092464 3300013105 Bacteria 815
276 Ga0157374_10368818 3300013296 Bacteria 1429
277 Ga0163162_10028482 3300013306 Bacteria 5527
278 Ga0163162_10233380 3300013306 Bacteria 1970
279 Ga0163162_10523897 3300013306 Bacteria 1315
280 Ga0157375_10024544 3300013308 Bacteria 5582
281 Ga0157375_10161219 3300013308 Bacteria 2384
282 Ga0157375_10337456 3300013308 Unclassified 1672
283 Ga0157375_10891603 3300013308 Bacteria 1034
284 Ga0157375_11759484 3300013308 Bacteria 734
285 Ga0163163_10009930 3300014325 Bacteria 8535
286 Ga0163163_10055077 3300014325 Bacteria 3930
287 Ga0157380_10017634 3300014326 Bacteria 5286
288 Ga0157380_10110333 3300014326 Bacteria 2310
289 Ga0157380_10235322 3300014326 Bacteria 1648
290 Ga0157377_10025414 3300014745 Bacteria 3159
291 Ga0157379_10007541 3300014968 Bacteria 9418
292 Ga0157379_10047361 3300014968 Bacteria 3836
293 Ga0157379_10203029 3300014968 Bacteria 1793
294 Ga0157379_10632535 3300014968 Bacteria 1001
295 Ga0157376_10193141 3300014969 Bacteria 1868
296 Ga0157376_10590639 3300014969 Bacteria 1104
297 Ga0157376_10807410 3300014969 Bacteria 951
298 Ga0157376_10989530 3300014969 Unclassified 863
299 Ga0163161_10299775 3300017792 Bacteria 1265
300 Ga0163161_10739711 3300017792 Bacteria 822
301 Ga0207697_10092912 3300025315 Bacteria 1280
302 Ga0207697_10136029 3300025315 Unclassified 1064
303 Ga0207697_10149956 3300025315 Bacteria 1014
304 Ga0207710_10042399 3300025900 Bacteria 2021
305 Ga0207680_10038071 3300025903 Bacteria 2782
306 Ga0207680_10260797 3300025903 Bacteria 1199
307 Ga0207685_10033598 3300025905 Bacteria 1855
308 Ga0207643_10084467 3300025908 Bacteria 1843
309 Ga0207643_10142630 3300025908 Bacteria 1432
310 Ga0207654_10017937 3300025911 Bacteria 3709
311 Ga0207707_10081622 3300025912 Bacteria 2822
312 Ga0207695_10263452 3300025913 Unclassified 1621
313 Ga0207660_10027439 3300025917 Bacteria 3885
314 Ga0207660_10752853 3300025917 Bacteria 795
315 Ga0207662_10074702 3300025918 Bacteria 2058
316 Ga0207657_10002928 3300025919 Bacteria 18323
317 Ga0207652_10056175 3300025921 Bacteria 3389
318 Ga0207646_10065728 3300025922 Bacteria 3238
319 Ga0207646_10080275 3300025922 Bacteria 2917
320 Ga0207646_10109008 3300025922 Bacteria 2484
321 Ga0207646_10609972 3300025922 Bacteria 979
322 Ga0207646_10783361 3300025922 Unclassified 850
323 Ga0207681_10008109 3300025923 Bacteria 6426
324 Ga0207681_10070547 3300025923 Bacteria 2433
325 Ga0207681_10325547 3300025923 Bacteria 1223
326 Ga0207650_10036818 3300025925 Bacteria 3561
327 Ga0207650_10098860 3300025925 Bacteria 2243
328 Ga0207650_10147536 3300025925 Bacteria 1854
329 Ga0207659_10000499 3300025926 Bacteria 23578
330 Ga0207659_10005077 3300025926 Bacteria 7982
331 Ga0207659_10055066 3300025926 Bacteria 2843
332 Ga0207659_10433154 3300025926 Bacteria 1105
333 Ga0207687_10040710 3300025927 Bacteria 3187
334 Ga0207644_10276889 3300025931 Bacteria 1346
335 Ga0207690_10045737 3300025932 Bacteria 2894
336 Ga0207690_10070773 3300025932 Bacteria 2404
337 Ga0207706_10326241 3300025933 Bacteria 1336
338 Ga0207706_10346665 3300025933 Bacteria 1291
339 Ga0207706_10507453 3300025933 Bacteria 1041
340 Ga0207686_10524652 3300025934 Bacteria 922
341 Ga0207709_10056643 3300025935 Bacteria 2427
342 Ga0207669_10005979 3300025937 Bacteria 5517
343 Ga0207669_10138875 3300025937 Bacteria 1683
344 Ga0207669_10755503 3300025937 Bacteria 803
345 Ga0207704_10007070 3300025938 Bacteria 5278
346 Ga0207704_10242649 3300025938 Bacteria 1347
347 Ga0207691_10185019 3300025940 Bacteria 1819
348 Ga0207691_10600723 3300025940 Unclassified 931
349 Ga0207711_10042716 3300025941 Bacteria 3863
350 Ga0207711_10080733 3300025941 Bacteria 2841
351 Ga0207711_10092898 3300025941 Bacteria 2656
352 Ga0207711_10286320 3300025941 Bacteria 1518
353 Ga0207711_10288532 3300025941 Bacteria 1512
354 Ga0207711_10345998 3300025941 Bacteria 1376
355 Ga0207711_10429374 3300025941 Bacteria 1229
356 Ga0207711_10842825 3300025941 Bacteria 853
357 Ga0207689_10108237 3300025942 Bacteria 2284
358 Ga0207689_10207113 3300025942 Bacteria 1620
359 Ga0207689_10215878 3300025942 Bacteria 1585
360 Ga0207679_10201698 3300025945 Bacteria 1662
361 Ga0207679_10578517 3300025945 Unclassified 1010
362 Ga0207679_10764734 3300025945 Bacteria 879
363 Ga0207667_10161678 3300025949 Bacteria 2303
364 Ga0207651_10013595 3300025960 Bacteria 4665
365 Ga0207651_10220092 3300025960 Bacteria 1534
366 Ga0207712_10178441 3300025961 Bacteria 1666
367 Ga0207712_10472219 3300025961 Bacteria 1067
368 Ga0207712_10613937 3300025961 Unclassified 942
369 Ga0207640_10006637 3300025981 Bacteria 6357
370 Ga0207640_10123978 3300025981 Bacteria 1856
371 Ga0207658_10111506 3300025986 Bacteria 2163
372 Ga0207677_10500499 3300026023 Bacteria 1050
373 Ga0207677_10624824 3300026023 Bacteria 948
374 Ga0207703_10002125 3300026035 Bacteria 17428
375 Ga0207703_10064709 3300026035 Bacteria 3002
376 Ga0207703_10074845 3300026035 Bacteria 2805
377 Ga0207708_10001769 3300026075 Bacteria 15961
378 Ga0207708_10155983 3300026075 Bacteria 1800
379 Ga0207708_10319826 3300026075 Bacteria 1266
380 Ga0207708_10528172 3300026075 Bacteria 992
381 Ga0207702_10300901 3300026078 Unclassified 1522
382 Ga0207641_10000667 3300026088 Bacteria 37425
383 Ga0207648_10003506 3300026089 Bacteria 16433
384 Ga0207648_10009855 3300026089 Bacteria 9111
385 Ga0207648_10157350 3300026089 Bacteria 2006
386 Ga0207648_10358999 3300026089 Bacteria 1314
387 Ga0207676_10018119 3300026095 Bacteria 5113
388 Ga0207674_10378830 3300026116 Bacteria 1368
389 Ga0207675_100002022 3300026118 Bacteria 20216
390 Ga0207675_100118277 3300026118 Bacteria 2506
391 Ga0207675_100136045 3300026118 Bacteria 2331
392 Ga0207675_100185195 3300026118 Bacteria 1995
393 Ga0207675_100305600 3300026118 Bacteria 1550
394 Ga0207675_100311500 3300026118 Bacteria 1535
395 Ga0207675_100585303 3300026118 Bacteria 1118
396 Ga0207683_10018891 3300026121 Bacteria 5880
397 Ga0207683_10032541 3300026121 Bacteria 4530
398 Ga0207683_10057467 3300026121 Bacteria 3415
399 Ga0207683_10086308 3300026121 Bacteria 2790
400 Ga0207698_11006957 3300026142 Unclassified 844
401 Ga0209974_10125721 3300027876 Bacteria 911
402 Ga0207428_10017228 3300027907 Bacteria 6204
403 Ga0207428_10041204 3300027907 Bacteria 3741
404 Ga0207428_10060387 3300027907 Bacteria 3004
405 Ga0207428_10228155 3300027907 Bacteria 1394
406 Ga0207428_10287135 3300027907 Unclassified 1220
407 Ga0268266_10005990 3300028379 Bacteria 11220
408 Ga0268266_10400443 3300028379 Bacteria 1298
409 Ga0268265_10011902 3300028380 Bacteria 5884
410 Ga0268265_10026426 3300028380 Bacteria 4130
411 Ga0268265_10393864 3300028380 Bacteria 1278
412 Ga0268265_10442547 3300028380 Bacteria 1212
413 Ga0268264_10187173 3300028381 Bacteria 1884
414 Ga0268264_10197269 3300028381 Bacteria 1839
415 Ga0268264_10332205 3300028381 Bacteria 1441
416 Ga0268264_11083335 3300028381 Bacteria 809
417 Ga0307410_10393586 3300031852 Bacteria 1118
418 Ga0307410_10511953 3300031852 Unclassified 989
419 Ga0307407_10094999 3300031903 Bacteria 1837
420 Ga0307411_10122797 3300032005 Bacteria 1883
421 Ga0307411_10586118 3300032005 Bacteria 957
422 Ga0373959_0001444 3300034820 Bacteria 3797
423 Ga0373929_0000890 3300035085 Bacteria 5822
424 Ga0373940_0000836 3300035088 Bacteria 5136
425 Ga0373949_0002510 3300035090 Bacteria 4675
426 Ga0373952_0000146 3300035092 Bacteria 10395
427 Ga0373932_0000281 3300035112 Bacteria 15327
428 Ga0373939_0000223 3300035114 Bacteria 15543
429 Ga0373941_0005380 3300035115 Bacteria 3009
430 Ga0373956_0090970 3300035119 Bacteria 1408
431 Ga0373960_0001303 3300035121 Bacteria 5493
432 Ga0373943_0094440 3300035170 Bacteria 1554
433 Ga0373942_0000133 3300035207 Bacteria 17557
434 Ga0373961_0001255 3300035241 Bacteria 7762
435 Ga0373962_0001311 3300035242 Bacteria 5850
436 Ga0373931_0006873 3300035691 Bacteria 5348
437 Ga0373931_0125474 3300035691 Bacteria 1472
438 Ga0373935_0198680 3300035692 Bacteria 1385
439 Ga0373935_0335915 3300035692 Bacteria 1075
440 Ga0373933_0067032 3300035724 Bacteria 2177
441 Ga0373947_0048179 3300035725 Bacteria 2556
442 Ga0373947_0369893 3300035725 Bacteria 964
443 Ga0373937_0056527 3300036401 Bacteria 3604
444 Ga0373925_0129570 3300037068 Bacteria 1966
445 Ga0373925_0261969 3300037068 Bacteria 1389
446 Ga0451853_1262188 3300041512 Bacteria 1639
447 Ga0439444_0011482 3300042437 Bacteria 1435
448 Ga0439444_0063295 3300042437 Bacteria 777
449 Ga0439464_0040096 3300042439 Bacteria 1333
450 Ga0439440_0024829 3300042993 Bacteria 1377
451 Ga0466963_0140803 3300044694 Bacteria 1671
452 Ga0451576_0006135 3300045051 Bacteria 14810
453 Ga0495629_0318066 3300046459 Bacteria 1064
454 Ga0495651_0333924 3300046462 Unclassified 1007
455 Ga0495582_0168302 3300046473 Bacteria 1247
456 Ga0495662_0174978 3300046476 Bacteria 1058
457 Ga0495628_0256498 3300046516 Bacteria 1304
458 Ga0495630_0242930 3300046517 Bacteria 1376
459 Ga0495640_0138834 3300046533 Bacteria 1568
460 Ga0495586_0227546 3300046535 Unclassified 1061
461 Ga0495645_0283536 3300046543 Unclassified 1088
462 Ga0495634_0029738 3300046642 Bacteria 3781
463 Ga0495647_0042163 3300046681 Bacteria 1741
464 Ga0495647_0070429 3300046681 Bacteria 1399
465 Ga0495658_0108245 3300046683 Bacteria 1668
466 Ga0495670_0304242 3300046691 Unclassified 855
467 Ga0495636_0261150 3300047318 Bacteria 803
468 Ga0496100_0077966 3300048903 Bacteria 2229
469 Ga0496100_0300352 3300048903 Bacteria 1202
470 Ga0496101_0001396 3300048904 Bacteria 14449
471 Ga0496102_0338280 3300048905 Bacteria 1418
472 Ga0496103_0269463 3300048906 Bacteria 1095
473 Ga0496104_0005976 3300048907 Bacteria 10663
474 Ga0496104_0019238 3300048907 Bacteria 6244
475 Ga0496104_0074446 3300048907 Bacteria 3233
476 Ga0496105_0676560 3300048908 Bacteria 794
477 Ga0496106_0378961 3300048909 Unclassified 1137
478 Ga0496107_0068373 3300048910 Bacteria 2578
479 Ga0496108_0017281 3300048911 Bacteria 5900
480 Ga0496109_0144243 3300048912 Bacteria 2227
481 Ga0496109_0292505 3300048912 Unclassified 1536
482 Ga0496110_0543466 3300048913 Bacteria 1056
483 Ga0496111_0102316 3300048914 Bacteria 2106
484 Ga0496112_0159392 3300048915 Bacteria 2223
485 Ga0496112_0506459 3300048915 Bacteria 1142
486 Ga0496114_0007586 3300048917 Bacteria 8576
487 Ga0496114_0126910 3300048917 Bacteria 2200
488 Ga0496114_0415263 3300048917 Bacteria 1192
489 Ga0496114_0490157 3300048917 Bacteria 1087
490 Ga0501031_0403477 3300049568 Unclassified 884
491 Ga0501034_0285554 3300049571 Bacteria 1589
492 Ga0501036_0026282 3300049572 Bacteria 4913
493 Ga0501038_0170830 3300049574 Bacteria 1760
494 Ga0501041_0010127 3300049577 Bacteria 5556
495 Ga0501046_0262777 3300049580 Bacteria 1268
496 Ga0501048_0055749 3300049582 Bacteria 2805
497 Ga0501072_0100280 3300049588 Bacteria 2301
498 Ga0501075_0300129 3300049591 Bacteria 1224
499 Ga0501075_0392126 3300049591 Bacteria 1058
500 Ga0501076_0072930 3300049592 Bacteria 2748
501 Ga0501077_0208138 3300049593 Bacteria 1243
502 Ga0501079_0056356 3300049741 Bacteria 3033
503 Ga0501079_0587654 3300049741 Bacteria 876
504 Ga0501083_0090041 3300049744 Bacteria 2027
505 Ga0501044_0021367 3300049823 Bacteria 6907
506 Ga0501045_0090250 3300049824 Bacteria 2264
507 nmdc:mga0k408_41766_c1 3300050493 Bacteria 2641
508 nmdc:mga07m45_60632_c1 3300050496 Bacteria 2142
509 nmdc:mga05p37_112434_c1 3300050507 Bacteria 3349
510 nmdc:mga05p37_115097_c1 3300050507 Bacteria 3306
511 nmdc:mga05p37_146580_c1 3300050507 Bacteria 2890
512 nmdc:mga05p37_1500_c2 3300050507 Bacteria 23791
513 nmdc:mga05p37_19228_c1 3300050507 Bacteria 8262
514 nmdc:mga05p37_204063_c1 3300050507 Bacteria 2392
515 nmdc:mga05p37_215343_c1 3300050507 Bacteria 2320
516 nmdc:mga05p37_395609_c1 3300050507 Bacteria 1615
517 nmdc:mga05p37_4340_c1 3300050507 Bacteria 16554
518 nmdc:mga05p37_5099_c1 3300050507 Bacteria 15409
519 nmdc:mga05p37_600150_c1 3300050507 Unclassified 1243
520 nmdc:mga05p37_732333_c1 3300050507 Bacteria 1093
521 nmdc:mga05p37_815347_c1 3300050507 Bacteria 1019
522 nmdc:mga0qj67_12626_c1 3300050509 Bacteria 6368
523 nmdc:mga08y16_160626_c1 3300050511 Bacteria 1322
524 nmdc:mga08y16_3405_c1 3300050511 Bacteria 16499
525 nmdc:mga08y16_383033_c1 3300050511 Bacteria 1441
526 nmdc:mga08y16_50571_c1 3300050511 Bacteria 4349
527 nmdc:mga08y16_8175_c1 3300050511 Bacteria 10946
528 nmdc:mga08y16_8442_c1 3300050511 Bacteria 10785
529 nmdc:mga08y16_8468_c1 3300050511 Bacteria 10771
530 nmdc:mga0n895_1122511_c1 3300050512 Bacteria 763
531 nmdc:mga0n895_132734_c1 3300050512 Bacteria 2516
532 nmdc:mga0n895_17730_c1 3300050512 Bacteria 6570
533 nmdc:mga0n895_18852_c1 3300050512 Bacteria 6397
534 nmdc:mga0n895_215068_c1 3300050512 Bacteria 1952
535 nmdc:mga0n895_326216_c1 3300050512 Bacteria 1555
536 nmdc:mga0n895_37_c1 3300050512 Bacteria 77167
537 nmdc:mga0n895_469234_c1 3300050512 Bacteria 1270
538 nmdc:mga0n895_482393_c1 3300050512 Bacteria 1250
539 nmdc:mga0n895_645007_c1 3300050512 Unclassified 1058
540 nmdc:mga0rr50_12012_c1 3300050513 Bacteria 5575
541 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
542 nmdc:mga0rr50_179054_c1 3300050513 Bacteria 1732
543 nmdc:mga0rr50_3750_c1 3300050513 Bacteria 8807
544 nmdc:mga0rr50_573158_c1 3300050513 Bacteria 962
545 nmdc:mga0rr50_66339_c1 3300050513 Bacteria 2738
546 nmdc:mga08x19_123606_c1 3300050514 Bacteria 1737
547 nmdc:mga08x19_24477_c1 3300050514 Bacteria 3753
548 nmdc:mga08x19_257171_c1 3300050514 Bacteria 1207
549 nmdc:mga08x19_925_c1 3300050514 Bacteria 18506
550 nmdc:mga0a205_13920_c1 3300050515 Bacteria 7501
551 nmdc:mga0a205_442960_c1 3300050515 Bacteria 1159
552 nmdc:mga0a205_492765_c1 3300050515 Bacteria 1083
553 Ga0495601_0140261 3300053077 Bacteria 1576
554 Ga0495601_0173728 3300053077 Bacteria 1409
555 Ga0495601_0187200 3300053077 Bacteria 1353
556 Ga0495595_0099455 3300053084 Bacteria 1403
557 Ga0495619_0028118 3300053085 Bacteria 3625
558 Ga0495619_0174841 3300053085 Bacteria 1485
559 Ga0590074_001332 3300059423 Bacteria 3944
560 Ga0590075_000068 3300059424 Bacteria 25784
561 Ga0590077_001345 3300059426 Bacteria 5806
562 Ga0530510_0021734 3300061734 Bacteria 4566
563 Ga0268265_10155271
564 Ga0065704_10026703
565 Ga0065712_10082701
566 Ga0065712_10096263
567 Ga0065715_10101612
568 Ga0065715_10110137
569 Ga0065715_10199992
570 Ga0065715_10273944
571 Ga0065707_10062267
572 Ga0065707_10234955
573 Ga0070658_10056272
574 Ga0070676_10006076
575 Ga0070683_100245266
576 Ga0070690_100034801
577 Ga0070690_100632318
578 Ga0070670_100044473
579 Ga0070670_100142724
580 Ga0070670_100211076
581 Ga0070670_100317403
582 Ga0068869_100174897
583 Ga0068869_100314825
584 Ga0070666_10040832
585 Ga0070666_10130953
586 Ga0070680_100318190
587 Ga0070680_100343741
588 Ga0068868_100204214
589 Ga0068868_100611522
590 Ga0070660_100003101
591 Ga0070660_100067863
592 Ga0070660_100251434
593 Ga0070689_100016061
594 Ga0070689_100292155
595 Ga0070691_10138690
596 Ga0070687_100064288
597 Ga0070687_100075210
598 Ga0070668_100024512
599 Ga0070668_100073053
600 Ga0070669_100008247
601 Ga0070669_100057184
602 Ga0070669_100233782
603 Ga0070669_100355181
604 Ga0070675_100000217
605 Ga0070675_100007246
606 Ga0070675_100021888
607 Ga0070675_100363208
608 Ga0070675_100553334
609 Ga0070671_100113823
610 Ga0070671_100221077
611 Ga0070674_100109161
612 Ga0070674_100112619
613 Ga0070673_100080886
614 Ga0070673_100086043
615 Ga0070673_100146631
616 Ga0070673_100660278
617 Ga0070688_100013666
618 Ga0070688_100097658
619 Ga0070688_100253194
620 Ga0070688_100733974
621 Ga0070659_100131227
622 Ga0070659_100181716
623 Ga0070659_100213437
624 Ga0070667_100172171
625 Ga0070703_10008349
626 Ga0070701_10014330
627 Ga0070701_10108023
628 Ga0070701_10126832
629 Ga0070705_100001877
630 Ga0070705_100002042
631 Ga0070705_100007095
632 Ga0070705_100411135
633 Ga0070700_100027810
634 Ga0070700_100046000
635 Ga0070700_100429172
636 Ga0070694_100002410
637 Ga0070694_100027569
638 Ga0070694_100048388
639 Ga0070678_100076372
640 Ga0070678_100286199
641 Ga0070678_100343694
642 Ga0070678_100784830
643 Ga0070662_100253030
644 Ga0070662_100282741
645 Ga0070662_100412767
646 Ga0070681_10005238
647 Ga0070681_10024105
648 Ga0070681_10380734
649 Ga0070681_10748649
650 Ga0068867_100001103
651 Ga0068867_100001545
652 Ga0068867_100042218
653 Ga0068867_100158579
654 Ga0068867_100283702
655 Ga0070707_100040303
656 Ga0070707_100124509
657 Ga0070707_100228538
658 Ga0070707_100267372
659 Ga0070707_100559448
660 Ga0070698_100010246
661 Ga0070698_100197552
662 Ga0070698_100318042
663 Ga0070699_100007909
664 Ga0070699_100017888
665 Ga0070699_100414532
666 Ga0070679_100008442
667 Ga0070679_100207985
668 Ga0070679_100273452
669 Ga0070684_100135285
670 Ga0070684_100150219
671 Ga0070684_100237354
672 Ga0070697_100023295
673 Ga0070697_100048611
674 Ga0070672_100027504
675 Ga0070672_100281671
676 Ga0070672_100343354
677 Ga0070686_100002820
678 Ga0070686_100185599
679 Ga0070695_100000873
680 Ga0070695_100006000
681 Ga0070695_100065917
682 Ga0070695_100241776
683 Ga0070696_100002392
684 Ga0070696_100025159
685 Ga0070696_100031809
686 Ga0070696_100228242
687 Ga0070665_100011986
688 Ga0070704_100004850
689 Ga0070704_100015315
690 Ga0070704_100020513
691 Ga0070704_100040402
692 Ga0070704_100511650
693 Ga0068855_100071814
694 Ga0070664_100065235
695 Ga0070664_100067659
696 Ga0070664_100079571
697 Ga0070664_100244296
698 Ga0070664_100244482
699 Ga0068857_100033831
700 Ga0068857_100210097
701 Ga0068857_100434934
702 Ga0068854_100023156
703 Ga0068854_100119195
704 Ga0068856_100118860
705 Ga0070702_100001216
706 Ga0070702_100273215
707 Ga0068859_100008086
708 Ga0068859_100034797
709 Ga0068859_100052549
710 Ga0068859_100239678
711 Ga0068864_100014953
712 Ga0068864_100201993
713 Ga0068866_10030106
714 Ga0068866_10089873
715 Ga0068866_10250339
716 Ga0068861_100000837
717 Ga0068861_100011345
718 Ga0068861_100166212
719 Ga0068861_100251258
720 Ga0068861_100609996
721 Ga0068870_10002158
722 Ga0068870_10012529
723 Ga0068870_10202316
724 Ga0068863_100138086
725 Ga0068863_100139849
726 Ga0068858_100027710
727 Ga0068860_100005189
728 Ga0068860_100084020
729 Ga0068860_100153966
730 Ga0068862_100006410
731 Ga0068862_100026584
732 Ga0068862_100061417
733 Ga0068862_100292593
734 Ga0068862_100412136
735 Ga0081455_10039975
736 Ga0081455_10150346
737 Ga0081539_10000795
738 Ga0081539_10007243
739 Ga0097621_100004479
740 Ga0097621_100089234
741 Ga0097621_100133654
742 Ga0097621_100242792
743 Ga0075370_10009768
744 Ga0068871_100004065
745 Ga0068871_100031297
746 Ga0068871_100048214
747 Ga0068871_100186599
748 Ga0068871_100300449
749 Ga0068871_100525724
750 Ga0075428_100016926
751 Ga0075428_100201006
752 Ga0075433_10045384
753 Ga0075433_10057437
754 Ga0075433_10193800
755 Ga0075433_10409910
756 Ga0075433_10492998
757 Ga0075434_100001066
758 Ga0075434_100011749
759 Ga0075434_100018566
760 Ga0075434_100026577
761 Ga0075434_100089801
762 Ga0075434_100268842
763 Ga0075429_100020286
764 Ga0068865_100003665
765 Ga0068865_100060577
766 Ga0075436_100002115
767 Ga0075436_100005193
768 Ga0075436_100022285
769 Ga0075436_100183206
770 Ga0097620_100008086
771 Ga0097620_100034797
772 Ga0097620_100052550
773 Ga0097620_100239692
774 Ga0075435_100000017
775 Ga0075435_100001194
776 Ga0075435_100009185
777 Ga0075435_100022985
778 Ga0075435_100070388
779 Ga0075435_100074719
780 Ga0075435_100092702
781 Ga0075435_100095059
782 Ga0075435_100105348
783 Ga0105240_10033592
784 Ga0105240_10084229
785 Ga0105240_11163011
786 Ga0111539_10000015
787 Ga0111539_10001132
788 Ga0111539_10013593
789 Ga0111539_10033967
790 Ga0111539_10035484
791 Ga0111539_10126688
792 Ga0111539_10179967
793 Ga0111539_10287233
794 Ga0111539_10354731
795 Ga0105245_10219355
796 Ga0105245_10538171
797 Ga0105245_10681787
798 Ga0105247_10030308
799 Ga0114129_10000239
800 Ga0114129_10003080
801 Ga0114129_10012983
802 Ga0114129_10037306
803 Ga0114129_10074065
804 Ga0114129_10192095
805 Ga0114129_10218954
806 Ga0114129_10358047
807 Ga0114129_10373293
808 Ga0114129_10456689
809 Ga0114129_10511672
810 Ga0105243_10020790
811 Ga0105243_10039179
812 Ga0105243_10410062
813 Ga0105243_10475996
814 Ga0105243_10497108
815 Ga0105242_10015703
816 Ga0105242_10026582
817 Ga0105242_10052095
818 Ga0105242_10463647
819 Ga0105242_10706715
820 Ga0105242_10750088
821 Ga0105248_10011543
822 Ga0105248_10017224
823 Ga0105248_10103185
824 Ga0105248_10204903
825 Ga0105248_10360424
826 Ga0105248_10536366
827 Ga0105238_10280677
828 Ga0105238_10916466
829 Ga0105238_11196484
830 Ga0105249_10006058
831 Ga0105249_10143057
832 Ga0105249_10254324
833 Ga0105249_10355207
834 Ga0105249_10428325
835 Ga0105249_10519572
836 Ga0105246_10182909
837 Ga0157369_11092464
838 Ga0157374_10368818
839 Ga0163162_10028482
840 Ga0163162_10233380
841 Ga0163162_10523897
842 Ga0157375_10024544
843 Ga0157375_10161219
844 Ga0157375_10337456
845 Ga0157375_10891603
846 Ga0157375_11759484
847 Ga0163163_10009930
848 Ga0163163_10055077
849 Ga0157380_10017634
850 Ga0157380_10110333
851 Ga0157380_10235322
852 Ga0157377_10025414
853 Ga0157379_10007541
854 Ga0157379_10047361
855 Ga0157379_10203029
856 Ga0157379_10632535
857 Ga0157376_10193141
858 Ga0157376_10590639
859 Ga0157376_10807410
860 Ga0157376_10989530
861 Ga0163161_10299775
862 Ga0163161_10739711
863 Ga0207697_10092912
864 Ga0207697_10136029
865 Ga0207697_10149956
866 Ga0207710_10042399
867 Ga0207680_10038071
868 Ga0207680_10260797
869 Ga0207685_10033598
870 Ga0207643_10084467
871 Ga0207643_10142630
872 Ga0207654_10017937
873 Ga0207707_10081622
874 Ga0207695_10263452
875 Ga0207660_10027439
876 Ga0207660_10752853
877 Ga0207662_10074702
878 Ga0207657_10002928
879 Ga0207652_10056175
880 Ga0207646_10065728
881 Ga0207646_10080275
882 Ga0207646_10109008
883 Ga0207646_10609972
884 Ga0207646_10783361
885 Ga0207681_10008109
886 Ga0207681_10070547
887 Ga0207681_10325547
888 Ga0207650_10036818
889 Ga0207650_10098860
890 Ga0207650_10147536
891 Ga0207659_10000499
892 Ga0207659_10005077
893 Ga0207659_10055066
894 Ga0207659_10433154
895 Ga0207687_10040710
896 Ga0207644_10276889
897 Ga0207690_10045737
898 Ga0207690_10070773
899 Ga0207706_10326241
900 Ga0207706_10346665
901 Ga0207706_10507453
902 Ga0207686_10524652
903 Ga0207709_10056643
904 Ga0207669_10005979
905 Ga0207669_10138875
906 Ga0207669_10755503
907 Ga0207704_10007070
908 Ga0207704_10242649
909 Ga0207691_10185019
910 Ga0207691_10600723
911 Ga0207711_10042716
912 Ga0207711_10080733
913 Ga0207711_10092898
914 Ga0207711_10286320
915 Ga0207711_10288532
916 Ga0207711_10345998
917 Ga0207711_10429374
918 Ga0207711_10842825
919 Ga0207689_10108237
920 Ga0207689_10207113
921 Ga0207689_10215878
922 Ga0207679_10201698
923 Ga0207679_10578517
924 Ga0207679_10764734
925 Ga0207667_10161678
926 Ga0207651_10013595
927 Ga0207651_10220092
928 Ga0207712_10178441
929 Ga0207712_10472219
930 Ga0207712_10613937
931 Ga0207640_10006637
932 Ga0207640_10123978
933 Ga0207658_10111506
934 Ga0207677_10500499
935 Ga0207677_10624824
936 Ga0207703_10002125
937 Ga0207703_10064709
938 Ga0207703_10074845
939 Ga0207708_10001769
940 Ga0207708_10155983
941 Ga0207708_10319826
942 Ga0207708_10528172
943 Ga0207702_10300901
944 Ga0207641_10000667
945 Ga0207648_10003506
946 Ga0207648_10009855
947 Ga0207648_10157350
948 Ga0207648_10358999
949 Ga0207676_10018119
950 Ga0207674_10378830
951 Ga0207675_100002022
952 Ga0207675_100118277
953 Ga0207675_100136045
954 Ga0207675_100185195
955 Ga0207675_100305600
956 Ga0207675_100311500
957 Ga0207675_100585303
958 Ga0207683_10018891
959 Ga0207683_10032541
960 Ga0207683_10057467
961 Ga0207683_10086308
962 Ga0207698_11006957
963 Ga0209974_10125721
964 Ga0207428_10017228
965 Ga0207428_10041204
966 Ga0207428_10060387
967 Ga0207428_10228155
968 Ga0207428_10287135
969 Ga0268266_10005990
970 Ga0268266_10400443
971 Ga0268265_10011902
972 Ga0268265_10026426
973 Ga0268265_10393864
974 Ga0268265_10442547
975 Ga0268264_10187173
976 Ga0268264_10197269
977 Ga0268264_10332205
978 Ga0268264_11083335
979 Ga0307410_10393586
980 Ga0307410_10511953
981 Ga0307407_10094999
982 Ga0307411_10122797
983 Ga0307411_10586118
984 Ga0373959_0001444
985 Ga0373929_0000890
986 Ga0373940_0000836
987 Ga0373949_0002510
988 Ga0373952_0000146
989 Ga0373932_0000281
990 Ga0373939_0000223
991 Ga0373941_0005380
992 Ga0373956_0090970
993 Ga0373960_0001303
994 Ga0373943_0094440
995 Ga0373942_0000133
996 Ga0373961_0001255
997 Ga0373962_0001311
998 Ga0373931_0006873
999 Ga0373931_0125474
1000 Ga0373935_0198680
1001 Ga0373935_0335915
1002 Ga0373933_0067032
1003 Ga0373947_0048179
1004 Ga0373947_0369893
1005 Ga0373937_0056527
1006 Ga0373925_0129570
1007 Ga0373925_0261969
1008 Ga0451853_1262188
1009 Ga0439444_0011482
1010 Ga0439444_0063295
1011 Ga0439464_0040096
1012 Ga0439440_0024829
1013 Ga0466963_0140803
1014 Ga0451576_0006135
1015 Ga0495629_0318066
1016 Ga0495651_0333924
1017 Ga0495582_0168302
1018 Ga0495662_0174978
1019 Ga0495628_0256498
1020 Ga0495630_0242930
1021 Ga0495640_0138834
1022 Ga0495586_0227546
1023 Ga0495645_0283536
1024 Ga0495634_0029738
1025 Ga0495647_0042163
1026 Ga0495647_0070429
1027 Ga0495658_0108245
1028 Ga0495670_0304242
1029 Ga0495636_0261150
1030 Ga0496100_0077966
1031 Ga0496100_0300352
1032 Ga0496101_0001396
1033 Ga0496102_0338280
1034 Ga0496103_0269463
1035 Ga0496104_0005976
1036 Ga0496104_0019238
1037 Ga0496104_0074446
1038 Ga0496105_0676560
1039 Ga0496106_0378961
1040 Ga0496107_0068373
1041 Ga0496108_0017281
1042 Ga0496109_0144243
1043 Ga0496109_0292505
1044 Ga0496110_0543466
1045 Ga0496111_0102316
1046 Ga0496112_0159392
1047 Ga0496112_0506459
1048 Ga0496114_0007586
1049 Ga0496114_0126910
1050 Ga0496114_0415263
1051 Ga0496114_0490157
1052 Ga0501031_0403477
1053 Ga0501034_0285554
1054 Ga0501036_0026282
1055 Ga0501038_0170830
1056 Ga0501041_0010127
1057 Ga0501046_0262777
1058 Ga0501048_0055749
1059 Ga0501072_0100280
1060 Ga0501075_0300129
1061 Ga0501075_0392126
1062 Ga0501076_0072930
1063 Ga0501077_0208138
1064 Ga0501079_0056356
1065 Ga0501079_0587654
1066 Ga0501083_0090041
1067 Ga0501044_0021367
1068 Ga0501045_0090250
1069 nmdc:mga0k408_41766_c1
1070 nmdc:mga07m45_60632_c1
1071 nmdc:mga05p37_112434_c1
1072 nmdc:mga05p37_115097_c1
1073 nmdc:mga05p37_146580_c1
1074 nmdc:mga05p37_1500_c2
1075 nmdc:mga05p37_19228_c1
1076 nmdc:mga05p37_204063_c1
1077 nmdc:mga05p37_215343_c1
1078 nmdc:mga05p37_395609_c1
1079 nmdc:mga05p37_4340_c1
1080 nmdc:mga05p37_5099_c1
1081 nmdc:mga05p37_600150_c1
1082 nmdc:mga05p37_732333_c1
1083 nmdc:mga05p37_815347_c1
1084 nmdc:mga0qj67_12626_c1
1085 nmdc:mga08y16_160626_c1
1086 nmdc:mga08y16_3405_c1
1087 nmdc:mga08y16_383033_c1
1088 nmdc:mga08y16_50571_c1
1089 nmdc:mga08y16_8175_c1
1090 nmdc:mga08y16_8442_c1
1091 nmdc:mga08y16_8468_c1
1092 nmdc:mga0n895_1122511_c1
1093 nmdc:mga0n895_132734_c1
1094 nmdc:mga0n895_17730_c1
1095 nmdc:mga0n895_18852_c1
1096 nmdc:mga0n895_215068_c1
1097 nmdc:mga0n895_326216_c1
1098 nmdc:mga0n895_37_c1
1099 nmdc:mga0n895_469234_c1
1100 nmdc:mga0n895_482393_c1
1101 nmdc:mga0n895_645007_c1
1102 nmdc:mga0rr50_12012_c1
1103 nmdc:mga0rr50_14_c1
1104 nmdc:mga0rr50_179054_c1
1105 nmdc:mga0rr50_3750_c1
1106 nmdc:mga0rr50_573158_c1
1107 nmdc:mga0rr50_66339_c1
1108 nmdc:mga08x19_123606_c1
1109 nmdc:mga08x19_24477_c1
1110 nmdc:mga08x19_257171_c1
1111 nmdc:mga08x19_925_c1
1112 nmdc:mga0a205_13920_c1
1113 nmdc:mga0a205_442960_c1
1114 nmdc:mga0a205_492765_c1
1115 Ga0495601_0140261
1116 Ga0495601_0173728
1117 Ga0495601_0187200
1118 Ga0495595_0099455
1119 Ga0495619_0028118
1120 Ga0495619_0174841
1121 Ga0590074_001332
1122 Ga0590075_000068
1123 Ga0590077_001345
1124 Ga0530510_0021734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06971

Put_DNA-bind_N

Putative DNA-binding protein N-terminus

27

75

0.98

PF02629

CoA_binding

CoA binding domain

103

201

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zz5-assembly2.cif.gz_C redox-sensing transcriptional repressor rex 0.8759 84 223
3ket-assembly1.cif.gz_A-2 crystal structure of a rex-family transcriptional regulatory protein from streptococcus agalactiae bound to a palindromic operator 0.873 20 222
1xcb-assembly1.cif.gz_B x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus 0.8729 23 224
5zz6-assembly2.cif.gz_C redox-sensing transcriptional repressor rex 0.8702 20 223
3wgh-assembly1.cif.gz_A crystal structure of rsp in complex with beta-nadh 0.8691 18 225
ID Description Score Start End Superfamily
5zz6C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9264 20 89 1.10.10.10
3wg9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9192 93 225 3.40.50.720
1xcbB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9115 23 90 1.10.10.10
1r72C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9064 23 90 1.10.10.10
5zz5B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9059 93 223 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B3E9K1-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9624 107 210 GO:0003677
GO:0005737
GO:0045892
GO:0051775
AF-A0A292SNA1-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9557 110 218 GO:0003677
GO:0005737
GO:0045892
GO:0051775
AF-A0A356IEP7-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9549 30 194 GO:0003677
GO:0005737
GO:0045892
GO:0051775
AF-A0A355QEQ3-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.9504 114 223 GO:0003677
GO:0005737
GO:0045892
GO:0051775
AF-A0A3D3TQV7-F1-model_v4 Redox-sensing transcriptional repressor Rex 0.945 115 229 GO:0003677
GO:0005737
GO:0045892
GO:0051775

Map