metagRoot

F463692

General Info

Members	Datasets	Scaffolds	Average Seq Length
560	238	1120	130

Family's Representative Sequence

Representative Sequence	3300022730\|Ga0224570_101848\|Ga0224570_1018482
Length	127
Sequence	MKTLYTWLCIFTTVCAAAAGDVLVALAMRRIGDLGDLRRRHGFLALIVRVLSSGVLFGGIFFMAIAFFSNLIGLSWADLSVVGPASAALTFVTNALAAKFFLHENVDRRRWFATIFVCCGVLILTWS

Samples

	Sample ID	Description	Type	Environment
1	3300022730	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2	Metagenome	Rhizosphere
2	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
12	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
13	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
14	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
15	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
18	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
19	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
20	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
21	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
22	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
23	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
24	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
25	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
26	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
27	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
28	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
29	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
30	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
31	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
32	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
33	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
34	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
35	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
39	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
40	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
41	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
42	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
43	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
44	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
45	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
46	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
50	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
51	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
52	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
53	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
54	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
55	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
56	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
57	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
58	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
59	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
60	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
62	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
63	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
64	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
66	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
67	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
68	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
70	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
71	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
72	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
73	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
74	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
75	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
76	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
77	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
78	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
81	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
82	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
83	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
84	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
85	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
86	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
87	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
88	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
89	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
90	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
91	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
92	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
93	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
94	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
95	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
96	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
144	3300028017	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4	Metagenome	Rhizosphere
145	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
147	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
148	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
149	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
150	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
151	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
152	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
153	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
154	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
155	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
156	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
157	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
158	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
159	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
160	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
161	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
162	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
163	3300033547	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1	Metagenome	Unclassified
164	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
165	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
166	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
167	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
168	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
169	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
170	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
171	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
172	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
173	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
174	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
175	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
176	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
177	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
178	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
179	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
180	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
181	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
182	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
183	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
184	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
185	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
186	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
187	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
188	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
189	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
190	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
191	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
192	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
193	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
194	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
195	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
196	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
197	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
198	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
199	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
200	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
201	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
202	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
203	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
204	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
205	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
206	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
207	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
208	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
209	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
210	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
211	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
212	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
213	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
214	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
215	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
216	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
217	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
218	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
219	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
220	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
221	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
222	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
223	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
224	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
225	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
226	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
227	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
228	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
229	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
230	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
231	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
232	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
233	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
234	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
235	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
236	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
237	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
238	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.29
Metatranscriptomes	0.71
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	4.46
Rhizosphere	93.04
Stem	0
Stem Tuber	0
Unclassified	30

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0224570_101848	3300022730	Unclassified	1488
2	LJNas_1026317	3300000546	Unclassified	622
3	Ga0065712_10094923	3300005290	Unclassified	2236
4	Ga0065715_10473747	3300005293	Bacteria	804
5	Ga0070676_10389504	3300005328	Bacteria	967
6	Ga0070683_100092751	3300005329	Bacteria	2837
7	Ga0070683_100176032	3300005329	Bacteria	2031
8	Ga0070690_100205082	3300005330	Unclassified	1374
9	Ga0070670_100118792	3300005331	Unclassified	2280
10	Ga0070670_101067701	3300005331	Bacteria	736
11	Ga0068869_100002642	3300005334	Bacteria	10827
12	Ga0070680_100019417	3300005336	Bacteria	5386
13	Ga0070682_100038113	3300005337	Bacteria	2947
14	Ga0068868_100001093	3300005338	Bacteria	18565
15	Ga0068868_100009989	3300005338	Bacteria	6858
16	Ga0068868_102351358	3300005338	Unclassified	509
17	Ga0070660_100108688	3300005339	Unclassified	2204
18	Ga0070660_100114516	3300005339	Unclassified	2148
19	Ga0070691_10140497	3300005341	Bacteria	1230
20	Ga0070691_10176812	3300005341	Unclassified	1109
21	Ga0070687_100069578	3300005343	Bacteria	1885
22	Ga0070661_100011816	3300005344	Bacteria	6093
23	Ga0070661_100236120	3300005344	Bacteria	1406
24	Ga0070661_100541941	3300005344	Unclassified	935
25	Ga0070692_10468506	3300005345	Bacteria	810
26	Ga0070671_100263578	3300005355	Unclassified	1465
27	Ga0070673_100104851	3300005364	Bacteria	2335
28	Ga0070659_100589686	3300005366	Unclassified	954
29	Ga0070659_100802503	3300005366	Bacteria	819
30	Ga0070709_10196834	3300005434	Unclassified	1425
31	Ga0070709_10376543	3300005434	Unclassified	1054
32	Ga0070709_10634853	3300005434	Unclassified	825
33	Ga0070709_10783208	3300005434	Bacteria	747
34	Ga0070714_100004400	3300005435	Bacteria	10605
35	Ga0070714_100129229	3300005435	Bacteria	2256
36	Ga0070714_100226717	3300005435	Unclassified	1720
37	Ga0070714_100274545	3300005435	Bacteria	1564
38	Ga0070714_100291630	3300005435	Bacteria	1518
39	Ga0070714_100300361	3300005435	Bacteria	1496
40	Ga0070714_102510630	3300005435	Unclassified	500
41	Ga0070713_100001793	3300005436	Bacteria	13835
42	Ga0070713_100020906	3300005436	Bacteria	5025
43	Ga0070713_100038787	3300005436	Bacteria	3863
44	Ga0070713_100050473	3300005436	Bacteria	3437
45	Ga0070713_100059926	3300005436	Unclassified	3181
46	Ga0070713_100204587	3300005436	Bacteria	1784
47	Ga0070713_100296137	3300005436	Bacteria	1488
48	Ga0070713_100468777	3300005436	Viruses	1185
49	Ga0070713_100622215	3300005436	Unclassified	1027
50	Ga0070713_101588082	3300005436	Unclassified	635
51	Ga0070710_10048078	3300005437	Bacteria	2382
52	Ga0070710_10226309	3300005437	Bacteria	1192
53	Ga0070710_10290943	3300005437	Bacteria	1063
54	Ga0070710_10342114	3300005437	Unclassified	988
55	Ga0070710_10391572	3300005437	Bacteria	929
56	Ga0070711_100045117	3300005439	Bacteria	2996
57	Ga0070711_100149713	3300005439	Bacteria	1759
58	Ga0070711_101227528	3300005439	Bacteria	649
59	Ga0070705_100293594	3300005440	Unclassified	1161
60	Ga0070708_100034235	3300005445	Bacteria	4418
61	Ga0070708_100093755	3300005445	Bacteria	2738
62	Ga0070663_100370973	3300005455	Bacteria	1163
63	Ga0070678_100348930	3300005456	Bacteria	1272
64	Ga0070678_101278098	3300005456	Unclassified	682
65	Ga0070662_100993819	3300005457	Unclassified	718
66	Ga0070662_101418737	3300005457	Unclassified	598
67	Ga0070681_10007515	3300005458	Bacteria	10652
68	Ga0070681_10015864	3300005458	Bacteria	7510
69	Ga0070681_10058261	3300005458	Unclassified	3843
70	Ga0070681_10150080	3300005458	Bacteria	2257
71	Ga0070681_10571797	3300005458	Bacteria	1044
72	Ga0070681_10695644	3300005458	Unclassified	932
73	Ga0068867_100001428	3300005459	Bacteria	16539
74	Ga0068867_101090562	3300005459	Unclassified	728
75	Ga0070706_100322287	3300005467	Bacteria	1441
76	Ga0070707_100410084	3300005468	Unclassified	1315
77	Ga0070707_100868943	3300005468	Unclassified	866
78	Ga0070707_101142571	3300005468	Unclassified	745
79	Ga0070707_101197427	3300005468	Bacteria	726
80	Ga0070698_100127120	3300005471	Unclassified	2506
81	Ga0070679_100030397	3300005530	Bacteria	5333
82	Ga0070679_100145493	3300005530	Bacteria	2348
83	Ga0070679_100213049	3300005530	Bacteria	1895
84	Ga0070679_101317638	3300005530	Bacteria	668
85	Ga0070684_100077535	3300005535	Bacteria	2935
86	Ga0070684_100079441	3300005535	Unclassified	2900
87	Ga0070684_100345944	3300005535	Bacteria	1367
88	Ga0070697_100110058	3300005536	Unclassified	2295
89	Ga0070697_100266004	3300005536	Unclassified	1469
90	Ga0068853_100063473	3300005539	Bacteria	3199
91	Ga0068853_100114422	3300005539	Unclassified	2400
92	Ga0068853_100175286	3300005539	Bacteria	1942
93	Ga0068853_100210328	3300005539	Bacteria	1773
94	Ga0068853_102164361	3300005539	Bacteria	539
95	Ga0070693_100195091	3300005547	Bacteria	1312
96	Ga0068855_100000952	3300005563	Bacteria	36034
97	Ga0068855_100006023	3300005563	Bacteria	14793
98	Ga0068855_100050650	3300005563	Bacteria	4893
99	Ga0068855_100171438	3300005563	Unclassified	2457
100	Ga0068855_101166711	3300005563	Unclassified	802
101	Ga0070664_100000278	3300005564	Bacteria	36897
102	Ga0070664_100050503	3300005564	Bacteria	3520
103	Ga0070664_100078822	3300005564	Bacteria	2834
104	Ga0070664_100150639	3300005564	Bacteria	2053
105	Ga0070664_100364715	3300005564	Bacteria	1316
106	Ga0068857_100000113	3300005577	Bacteria	48281
107	Ga0068857_100001051	3300005577	Bacteria	21364
108	Ga0068854_100001102	3300005578	Bacteria	16252
109	Ga0068854_100030695	3300005578	Bacteria	3729
110	Ga0068854_100071429	3300005578	Bacteria	2539
111	Ga0068854_100072560	3300005578	Bacteria	2521
112	Ga0068854_100135439	3300005578	Bacteria	1885
113	Ga0068856_100000096	3300005614	Bacteria	83677
114	Ga0068856_100000243	3300005614	Bacteria	59277
115	Ga0068856_100000305	3300005614	Bacteria	53825
116	Ga0068856_100004911	3300005614	Bacteria	13234
117	Ga0068856_100032746	3300005614	Bacteria	5090
118	Ga0068856_100340769	3300005614	Unclassified	1517
119	Ga0068856_100510994	3300005614	Bacteria	1222
120	Ga0068856_100714585	3300005614	Bacteria	1022
121	Ga0068852_100501691	3300005616	Bacteria	1208
122	Ga0068852_101408351	3300005616	Unclassified	719
123	Ga0068859_100013832	3300005617	Bacteria	8093
124	Ga0068859_100026605	3300005617	Bacteria	5802
125	Ga0068864_100008229	3300005618	Bacteria	8602
126	Ga0068864_100029331	3300005618	Unclassified	4658
127	Ga0068864_100207964	3300005618	Bacteria	1801
128	Ga0068864_101859813	3300005618	Unclassified	608
129	Ga0068866_10027059	3300005718	Bacteria	2715
130	Ga0068861_100329484	3300005719	Bacteria	1332
131	Ga0068870_10031720	3300005840	Unclassified	2679
132	Ga0068863_100018791	3300005841	Bacteria	6615
133	Ga0068863_100828020	3300005841	Unclassified	924
134	Ga0068863_101936717	3300005841	Bacteria	599
135	Ga0068858_100014219	3300005842	Bacteria	7504
136	Ga0068858_100017328	3300005842	Bacteria	6756
137	Ga0068860_100036976	3300005843	Unclassified	4675
138	Ga0068860_100041849	3300005843	Bacteria	4376
139	Ga0068860_100129861	3300005843	Bacteria	2417
140	Ga0068860_100280854	3300005843	Bacteria	1627
141	Ga0068862_100691408	3300005844	Bacteria	987
142	Ga0070717_10000272	3300006028	Bacteria	35378
143	Ga0070717_10004367	3300006028	Bacteria	10200
144	Ga0070717_10009598	3300006028	Bacteria	7280
145	Ga0070717_10019597	3300006028	Bacteria	5309
146	Ga0070717_10029980	3300006028	Bacteria	4369
147	Ga0070717_10038105	3300006028	Bacteria	3906
148	Ga0070717_10047675	3300006028	Bacteria	3511
149	Ga0070717_10678734	3300006028	Unclassified	935
150	Ga0070717_11049999	3300006028	Bacteria	742
151	Ga0070717_11534339	3300006028	Bacteria	604
152	Ga0070715_10047854	3300006163	Bacteria	1825
153	Ga0070715_10204648	3300006163	Unclassified	1005
154	Ga0070715_10739574	3300006163	Unclassified	591
155	Ga0070716_100010019	3300006173	Bacteria	4739
156	Ga0070716_100134902	3300006173	Unclassified	1566
157	Ga0070716_100616144	3300006173	Unclassified	818
158	Ga0070716_100709827	3300006173	Unclassified	769
159	Ga0070712_100009039	3300006175	Bacteria	6275
160	Ga0070712_100037797	3300006175	Bacteria	3293
161	Ga0070712_100208295	3300006175	Bacteria	1540
162	Ga0070712_100934100	3300006175	Bacteria	749
163	Ga0070712_101241474	3300006175	Unclassified	649
164	Ga0097621_100000022	3300006237	Bacteria	85005
165	Ga0097621_100000562	3300006237	Bacteria	26047
166	Ga0097621_100023646	3300006237	Unclassified	4787
167	Ga0097621_100095553	3300006237	Bacteria	2493
168	Ga0097621_100633623	3300006237	Bacteria	980
169	Ga0068871_100001873	3300006358	Bacteria	14228
170	Ga0068871_100016575	3300006358	Bacteria	5554
171	Ga0068871_100044356	3300006358	Unclassified	3576
172	Ga0068871_100138893	3300006358	Unclassified	2065
173	Ga0068871_100780748	3300006358	Bacteria	879
174	Ga0075434_100097532	3300006871	Bacteria	2944
175	Ga0075434_101050904	3300006871	Bacteria	828
176	Ga0075436_100000675	3300006914	Bacteria	22482
177	Ga0075436_100089685	3300006914	Bacteria	2137
178	Ga0075436_100128785	3300006914	Unclassified	1774
179	Ga0075436_100828877	3300006914	Bacteria	690
180	Ga0097620_100013832	3300006931	Bacteria	8093
181	Ga0097620_100026604	3300006931	Bacteria	5802
182	Ga0075435_100018090	3300007076	Bacteria	5348
183	Ga0075435_100341516	3300007076	Unclassified	1283
184	Ga0105240_10017033	3300009093	Bacteria	9816
185	Ga0105240_10031734	3300009093	Bacteria	6845
186	Ga0105240_10049586	3300009093	Bacteria	5298
187	Ga0105240_10116056	3300009093	Bacteria	3231
188	Ga0105240_10131193	3300009093	Bacteria	3006
189	Ga0105240_10137150	3300009093	Bacteria	2929
190	Ga0105240_10734035	3300009093	Bacteria	1075
191	Ga0105245_10176972	3300009098	Bacteria	2035
192	Ga0114129_13408312	3300009147	Unclassified	511
193	Ga0105243_10914140	3300009148	Bacteria	874
194	Ga0105241_10031255	3300009174	Bacteria	3987
195	Ga0105241_10038806	3300009174	Unclassified	3591
196	Ga0105241_10042698	3300009174	Bacteria	3432
197	Ga0105241_10414937	3300009174	Unclassified	1184
198	Ga0105241_10591541	3300009174	Unclassified	1001
199	Ga0105248_10032942	3300009177	Bacteria	5788
200	Ga0105248_10103581	3300009177	Bacteria	3208
201	Ga0105248_10304721	3300009177	Bacteria	1794
202	Ga0105248_12966177	3300009177	Unclassified	541
203	Ga0105237_10014873	3300009545	Bacteria	8117
204	Ga0105237_10080775	3300009545	Bacteria	3242
205	Ga0105237_10275444	3300009545	Bacteria	1685
206	Ga0105237_10287891	3300009545	Bacteria	1646
207	Ga0105237_10374805	3300009545	Bacteria	1428
208	Ga0105237_10664024	3300009545	Bacteria	1049
209	Ga0105237_11026022	3300009545	Unclassified	832
210	Ga0105238_10000644	3300009551	Bacteria	36743
211	Ga0105238_10036914	3300009551	Bacteria	4969
212	Ga0105238_10089046	3300009551	Bacteria	3073
213	Ga0105238_10304985	3300009551	Bacteria	1576
214	Ga0105249_10167418	3300009553	Bacteria	2129
215	Ga0105249_10430204	3300009553	Bacteria	1355
216	Ga0105249_12484188	3300009553	Unclassified	591
217	Ga0105249_12878931	3300009553	Unclassified	552
218	Ga0105239_10083240	3300010375	Bacteria	3523
219	Ga0105239_10104189	3300010375	Bacteria	3141
220	Ga0105239_10413158	3300010375	Unclassified	1528
221	Ga0105239_10503939	3300010375	Bacteria	1376
222	Ga0105246_10041577	3300011119	Unclassified	3108
223	Ga0157373_10032259	3300013100	Bacteria	3771
224	Ga0157373_10060981	3300013100	Unclassified	2672
225	Ga0157373_10065247	3300013100	Unclassified	2576
226	Ga0157373_10200977	3300013100	Bacteria	1405
227	Ga0157373_10857453	3300013100	Unclassified	672
228	Ga0157371_10056733	3300013102	Bacteria	2778
229	Ga0157371_10057042	3300013102	Bacteria	2769
230	Ga0157371_10163649	3300013102	Bacteria	1589
231	Ga0157370_10019816	3300013104	Bacteria	6731
232	Ga0157370_10714274	3300013104	Bacteria	914
233	Ga0157370_11033889	3300013104	Unclassified	743
234	Ga0157369_10000034	3300013105	Bacteria	200710
235	Ga0157369_10017221	3300013105	Bacteria	8121
236	Ga0157369_10064889	3300013105	Bacteria	3932
237	Ga0157369_10071544	3300013105	Unclassified	3723
238	Ga0157369_10137997	3300013105	Unclassified	2581
239	Ga0157369_10309073	3300013105	Bacteria	1644
240	Ga0157369_10424307	3300013105	Bacteria	1379
241	Ga0157374_10000052	3300013296	Bacteria	125138
242	Ga0157374_10001074	3300013296	Bacteria	23713
243	Ga0157374_10005336	3300013296	Bacteria	10792
244	Ga0157374_10073458	3300013296	Bacteria	3228
245	Ga0157374_10589662	3300013296	Unclassified	1121
246	Ga0157378_10000227	3300013297	Bacteria	54885
247	Ga0157378_10001800	3300013297	Bacteria	19248
248	Ga0157378_10015688	3300013297	Bacteria	6633
249	Ga0157378_10068034	3300013297	Bacteria	3193
250	Ga0157378_10091458	3300013297	Bacteria	2766
251	Ga0157372_10000585	3300013307	Bacteria	39797
252	Ga0157372_10001482	3300013307	Bacteria	25500
253	Ga0157372_10003253	3300013307	Bacteria	17560
254	Ga0157372_10003378	3300013307	Bacteria	17218
255	Ga0157372_10005242	3300013307	Bacteria	13771
256	Ga0157372_10008781	3300013307	Bacteria	10733
257	Ga0157372_10023442	3300013307	Bacteria	6691
258	Ga0157372_10029829	3300013307	Bacteria	5961
259	Ga0157372_10036871	3300013307	Bacteria	5392
260	Ga0157372_10252931	3300013307	Unclassified	2045
261	Ga0157372_10317063	3300013307	Bacteria	1815
262	Ga0163163_10128601	3300014325	Bacteria	2572
263	Ga0182008_10072486	3300014497	Bacteria	1694
264	Ga0157377_10446965	3300014745	Bacteria	891
265	Ga0157379_10202440	3300014968	Unclassified	1795
266	Ga0157376_10004963	3300014969	Bacteria	9275
267	Ga0157376_10116275	3300014969	Bacteria	2363
268	Ga0157376_10147590	3300014969	Bacteria	2117
269	Ga0157376_12058445	3300014969	Unclassified	609
270	Ga0182006_1025513	3300015261	Bacteria	2427
271	Ga0182007_10014155	3300015262	Bacteria	3017
272	Ga0182005_1197022	3300015265	Unclassified	604
273	Ga0213874_10196388	3300021377	Unclassified	724
274	Ga0213875_10000224	3300021388	Bacteria	57760
275	Ga0224572_1007523	3300024225	Archaea	1998
276	Ga0224572_1011642	3300024225	Bacteria	1664
277	Ga0228598_1002456	3300024227	Bacteria	4040
278	Ga0207692_10025539	3300025898	Bacteria	2761
279	Ga0207692_10038389	3300025898	Bacteria	2348
280	Ga0207692_10144143	3300025898	Unclassified	1358
281	Ga0207692_10234210	3300025898	Bacteria	1094
282	Ga0207692_10484220	3300025898	Bacteria	783
283	Ga0207642_10017155	3300025899	Bacteria	2747
284	Ga0207647_10258938	3300025904	Bacteria	997
285	Ga0207647_10730224	3300025904	Unclassified	538
286	Ga0207699_10013995	3300025906	Bacteria	4122
287	Ga0207699_10087220	3300025906	Bacteria	1951
288	Ga0207699_10382834	3300025906	Bacteria	999
289	Ga0207699_11261218	3300025906	Bacteria	547
290	Ga0207645_10332624	3300025907	Bacteria	1015
291	Ga0207643_10087558	3300025908	Bacteria	1811
292	Ga0207705_10152377	3300025909	Bacteria	1733
293	Ga0207684_10405673	3300025910	Unclassified	1172
294	Ga0207684_10773016	3300025910	Bacteria	813
295	Ga0207684_11035705	3300025910	Unclassified	685
296	Ga0207654_10028142	3300025911	Bacteria	3062
297	Ga0207654_10242013	3300025911	Bacteria	1206
298	Ga0207654_10318027	3300025911	Unclassified	1063
299	Ga0207707_10000496	3300025912	Bacteria	40443
300	Ga0207707_10136782	3300025912	Bacteria	2142
301	Ga0207707_10336495	3300025912	Unclassified	1302
302	Ga0207707_10504317	3300025912	Bacteria	1032
303	Ga0207695_10008608	3300025913	Bacteria	12747
304	Ga0207695_10012834	3300025913	Bacteria	10032
305	Ga0207695_10042465	3300025913	Bacteria	4856
306	Ga0207695_10076540	3300025913	Bacteria	3401
307	Ga0207695_10104831	3300025913	Unclassified	2815
308	Ga0207695_10121405	3300025913	Bacteria	2580
309	Ga0207695_10722203	3300025913	Unclassified	876
310	Ga0207671_10588828	3300025914	Unclassified	887
311	Ga0207671_10955625	3300025914	Unclassified	676
312	Ga0207693_10016437	3300025915	Bacteria	5912
313	Ga0207693_10017348	3300025915	Bacteria	5742
314	Ga0207693_10863392	3300025915	Bacteria	695
315	Ga0207663_10011814	3300025916	Bacteria	4701
316	Ga0207663_11381037	3300025916	Bacteria	567
317	Ga0207660_10014013	3300025917	Bacteria	5262
318	Ga0207657_10000830	3300025919	Bacteria	32651
319	Ga0207649_10039059	3300025920	Unclassified	2876
320	Ga0207652_10003101	3300025921	Bacteria	13852
321	Ga0207652_10189261	3300025921	Bacteria	1851
322	Ga0207652_10767716	3300025921	Bacteria	857
323	Ga0207652_11135278	3300025921	Bacteria	682
324	Ga0207646_10107450	3300025922	Bacteria	2503
325	Ga0207694_10000250	3300025924	Bacteria	51411
326	Ga0207694_10062507	3300025924	Unclassified	2899
327	Ga0207650_10032393	3300025925	Unclassified	3781
328	Ga0207700_10004509	3300025928	Bacteria	8222
329	Ga0207700_10009460	3300025928	Bacteria	6090
330	Ga0207700_10052188	3300025928	Bacteria	3056
331	Ga0207700_10367767	3300025928	Unclassified	1255
332	Ga0207700_10468606	3300025928	Unclassified	1112
333	Ga0207700_10707737	3300025928	Unclassified	899
334	Ga0207700_11209382	3300025928	Bacteria	674
335	Ga0207664_10015704	3300025929	Bacteria	5505
336	Ga0207664_10017803	3300025929	Bacteria	5220
337	Ga0207664_10020398	3300025929	Bacteria	4911
338	Ga0207664_10062293	3300025929	Bacteria	2979
339	Ga0207664_10111361	3300025929	Bacteria	2277
340	Ga0207664_10119483	3300025929	Bacteria	2203
341	Ga0207664_10146467	3300025929	Bacteria	2003
342	Ga0207664_10215512	3300025929	Unclassified	1663
343	Ga0207664_10324217	3300025929	Bacteria	1359
344	Ga0207690_10603387	3300025932	Bacteria	896
345	Ga0207706_10038235	3300025933	Bacteria	4257
346	Ga0207706_10127021	3300025933	Unclassified	2242
347	Ga0207709_10595271	3300025935	Bacteria	875
348	Ga0207665_10080122	3300025939	Bacteria	2246
349	Ga0207665_10439430	3300025939	Unclassified	999
350	Ga0207665_10854578	3300025939	Unclassified	720
351	Ga0207665_11227655	3300025939	Unclassified	598
352	Ga0207691_10691789	3300025940	Unclassified	860
353	Ga0207711_10201887	3300025941	Bacteria	1814
354	Ga0207689_10013884	3300025942	Bacteria	6860
355	Ga0207689_10048522	3300025942	Unclassified	3502
356	Ga0207661_10114833	3300025944	Bacteria	2283
357	Ga0207661_10257634	3300025944	Unclassified	1553
358	Ga0207679_10004663	3300025945	Bacteria	8539
359	Ga0207679_10043033	3300025945	Bacteria	3249
360	Ga0207679_10107008	3300025945	Bacteria	2199
361	Ga0207679_10352451	3300025945	Bacteria	1283
362	Ga0207679_10361869	3300025945	Bacteria	1267
363	Ga0207667_10000996	3300025949	Bacteria	36261
364	Ga0207667_10007025	3300025949	Bacteria	13599
365	Ga0207667_10346903	3300025949	Bacteria	1514
366	Ga0207667_10766249	3300025949	Unclassified	963
367	Ga0207651_10099496	3300025960	Bacteria	2154
368	Ga0207712_10873567	3300025961	Unclassified	793
369	Ga0207640_10023771	3300025981	Bacteria	3688
370	Ga0207640_10039846	3300025981	Bacteria	2977
371	Ga0207640_10211112	3300025981	Bacteria	1479
372	Ga0207640_10593995	3300025981	Bacteria	936
373	Ga0207658_10700680	3300025986	Bacteria	915
374	Ga0207677_10047462	3300026023	Bacteria	2884
375	Ga0207677_10124843	3300026023	Unclassified	1943
376	Ga0207703_10009521	3300026035	Bacteria	7622
377	Ga0207703_10018786	3300026035	Bacteria	5397
378	Ga0207639_10056811	3300026041	Unclassified	3001
379	Ga0207639_10159479	3300026041	Bacteria	1899
380	Ga0207639_10201849	3300026041	Bacteria	1706
381	Ga0207639_10289515	3300026041	Unclassified	1444
382	Ga0207702_10006631	3300026078	Bacteria	9955
383	Ga0207702_10011612	3300026078	Bacteria	7340
384	Ga0207702_10018995	3300026078	Bacteria	5687
385	Ga0207702_10019240	3300026078	Bacteria	5649
386	Ga0207702_10159313	3300026078	Bacteria	2060
387	Ga0207702_10484152	3300026078	Bacteria	1204
388	Ga0207702_10698763	3300026078	Bacteria	999
389	Ga0207702_11236523	3300026078	Bacteria	741
390	Ga0207641_10018032	3300026088	Bacteria	5785
391	Ga0207641_10237198	3300026088	Bacteria	1698
392	Ga0207641_10536774	3300026088	Bacteria	1139
393	Ga0207648_10194858	3300026089	Unclassified	1796
394	Ga0207676_10011829	3300026095	Bacteria	6243
395	Ga0207676_10343599	3300026095	Bacteria	1378
396	Ga0207674_10002031	3300026116	Bacteria	25688
397	Ga0207675_100388764	3300026118	Unclassified	1373
398	Ga0207698_11159862	3300026142	Unclassified	786
399	Ga0207698_11249255	3300026142	Bacteria	757
400	Ga0265354_1025655	3300028016	Unclassified	565
401	Ga0265356_1000851	3300028017	Bacteria	5017
402	Ga0268264_10014425	3300028381	Bacteria	6493
403	Ga0268264_10086657	3300028381	Unclassified	2691
404	Ga0268264_10106177	3300028381	Bacteria	2451
405	Ga0265338_10003184	3300028800	Bacteria	23419
406	Ga0265762_1000747	3300030760	Bacteria	5797
407	Ga0265762_1025340	3300030760	Unclassified	1106
408	Ga0265760_10000428	3300031090	Bacteria	11808
409	Ga0265760_10014540	3300031090	Unclassified	2256
410	Ga0265332_10017070	3300031238	Bacteria	3202
411	Ga0265328_10092406	3300031239	Unclassified	1118
412	Ga0265340_10172965	3300031247	Unclassified	978
413	Ga0265340_10311911	3300031247	Bacteria	697
414	Ga0265339_10055019	3300031249	Bacteria	2160
415	Ga0265339_10107797	3300031249	Bacteria	1444
416	Ga0265331_10173732	3300031250	Unclassified	974
417	Ga0265316_10165521	3300031344	Unclassified	1652
418	Ga0265316_10424384	3300031344	Bacteria	956
419	Ga0307408_100337982	3300031548	Bacteria	1274
420	Ga0265313_10260485	3300031595	Bacteria	705
421	Ga0265314_10685855	3300031711	Unclassified	519
422	Ga0265342_10136853	3300031712	Bacteria	1369
423	Ga0265342_10310126	3300031712	Unclassified	829
424	Ga0307410_10153701	3300031852	Bacteria	1716
425	Ga0307409_100369850	3300031995	Bacteria	1359
426	Ga0307415_102017520	3300032126	Unclassified	562
427	Ga0316214_1026233	3300033545	Unclassified	821
428	Ga0316212_1008477	3300033547	Bacteria	1479
429	Ga0373926_0014732	3300035083	Bacteria	2661
430	Ga0373926_0282146	3300035083	Unclassified	647
431	Ga0373934_0098403	3300035086	Unclassified	1182
432	Ga0373944_0044681	3300035089	Bacteria	1381
433	Ga0373936_0037200	3300035113	Unclassified	1943
434	Ga0373936_0148239	3300035113	Bacteria	1016
435	Ga0373936_0478887	3300035113	Unclassified	577
436	Ga0373936_0510605	3300035113	Unclassified	559
437	Ga0373939_0313095	3300035114	Unclassified	629
438	Ga0373945_0162555	3300035116	Unclassified	911
439	Ga0373943_0049025	3300035170	Bacteria	2071
440	Ga0373943_0116275	3300035170	Unclassified	1417
441	Ga0373943_0214020	3300035170	Unclassified	1071
442	Ga0373946_0067632	3300035171	Bacteria	1535
443	Ga0373955_0184179	3300035172	Bacteria	1240
444	Ga0373931_0011944	3300035691	Bacteria	4202
445	Ga0373931_0087481	3300035691	Bacteria	1730
446	Ga0373931_0245845	3300035691	Bacteria	1086
447	Ga0373935_0015420	3300035692	Unclassified	4619
448	Ga0373935_0216390	3300035692	Bacteria	1329
449	Ga0373927_0020506	3300035695	Bacteria	4335
450	Ga0373927_0048097	3300035695	Bacteria	2758
451	Ga0373927_0192438	3300035695	Unclassified	1338
452	Ga0373933_0245735	3300035724	Unclassified	1152
453	Ga0373933_0468046	3300035724	Unclassified	825
454	Ga0373947_0407847	3300035725	Bacteria	917
455	Ga0373937_0084993	3300036401	Bacteria	2928
456	Ga0373937_0411089	3300036401	Unclassified	1284
457	Ga0373937_0993501	3300036401	Bacteria	788
458	Ga0373925_0013644	3300037068	Bacteria	5883
459	Ga0373925_0017270	3300037068	Bacteria	5227
460	Ga0373925_0021047	3300037068	Bacteria	4752
461	Ga0373925_0504908	3300037068	Bacteria	993
462	Ga0373925_1638547	3300037068	Bacteria	526
463	Ga0436364_1006074	3300037853	Bacteria	129171
464	Ga0436364_1098998	3300037853	Bacteria	2422
465	Ga0395901_0557141	3300038443	Unclassified	1161
466	Ga0436365_0039278	3300039437	Bacteria	1551
467	Ga0436365_0266173	3300039437	Bacteria	1160
468	Ga0436365_1570491	3300039437	Unclassified	1007
469	Ga0436363_0778512	3300039450	Unclassified	628
470	Ga0436363_0827623	3300039450	Bacteria	1980
471	Ga0436363_0874835	3300039450	Bacteria	507
472	Ga0436363_1084670	3300039450	Bacteria	1045
473	Ga0436363_1601994	3300039450	Bacteria	670
474	Ga0436362_1295402	3300039453	Bacteria	4520
475	Ga0453683_0017248	3300044673	Bacteria	4651
476	Ga0466966_0347895	3300044684	Unclassified	891
477	Ga0466961_0009128	3300044693	Bacteria	6316
478	Ga0466963_0144917	3300044694	Bacteria	1647
479	Ga0466963_0158764	3300044694	Archaea	1573
480	Ga0466964_0228174	3300044706	Bacteria	907
481	Ga0466968_0516952	3300044735	Unclassified	596
482	Ga0466957_0091174	3300044842	Bacteria	1910
483	Ga0466959_0305123	3300045049	Unclassified	1090
484	Ga0466959_0365363	3300045049	Unclassified	983
485	Ga0451576_0719529	3300045051	Bacteria	1049
486	Ga0451576_0994112	3300045051	Bacteria	879
487	Ga0466958_0034420	3300045836	Bacteria	3022
488	Ga0466958_0261876	3300045836	Bacteria	1107
489	Ga0466967_0105005	3300045976	Bacteria	2587
490	Ga0466967_0445527	3300045976	Bacteria	1265
491	Ga0495651_0634957	3300046462	Unclassified	671
492	Ga0495653_0968075	3300046463	Unclassified	504
493	Ga0495580_0000751	3300046472	Bacteria	27777
494	Ga0495580_0001473	3300046472	Bacteria	20639
495	Ga0495580_0004382	3300046472	Bacteria	11858
496	Ga0495580_0022308	3300046472	Bacteria	4660
497	Ga0495580_0137297	3300046472	Archaea	1695
498	Ga0495580_0757195	3300046472	Bacteria	632
499	Ga0495582_0001114	3300046473	Bacteria	15096
500	Ga0495582_0059526	3300046473	Unclassified	2107
501	Ga0495594_0566938	3300046499	Bacteria	644
502	Ga0495618_0736185	3300046514	Unclassified	578
503	Ga0495630_0042188	3300046517	Bacteria	3408
504	Ga0495630_0220445	3300046517	Unclassified	1448
505	Ga0495666_0008202	3300046526	Bacteria	5234
506	Ga0495665_0000559	3300046531	Bacteria	18956
507	Ga0495665_0671354	3300046531	Unclassified	515
508	Ga0495587_0330148	3300046536	Unclassified	851
509	Ga0495645_0407888	3300046543	Unclassified	865
510	Ga0495667_0288179	3300046559	Bacteria	1042
511	Ga0495623_0466725	3300046679	Unclassified	670
512	Ga0495646_0371887	3300046680	Bacteria	746
513	Ga0495646_0450197	3300046680	Unclassified	665
514	Ga0495669_0070699	3300046684	Unclassified	1590
515	Ga0495600_0066581	3300046809	Bacteria	2355
516	Ga0495674_0391673	3300047319	Unclassified	1123
517	Ga0495675_0048183	3300047444	Bacteria	2711
518	Ga0495675_0239796	3300047444	Bacteria	1092
519	Ga0495684_0503326	3300047471	Unclassified	833
520	Ga0495593_0443724	3300047673	Bacteria	649
521	Ga0495602_0079038	3300048088	Bacteria	2776
522	Ga0495602_0317098	3300048088	Unclassified	1136
523	Ga0495602_0468338	3300048088	Bacteria	886
524	Ga0496100_1360980	3300048903	Unclassified	560
525	Ga0496101_0142833	3300048904	Bacteria	1826
526	Ga0496101_0232318	3300048904	Bacteria	1434
527	Ga0496102_0037505	3300048905	Bacteria	4373
528	Ga0496102_0072616	3300048905	Bacteria	3162
529	Ga0496102_0425573	3300048905	Bacteria	1247
530	Ga0496103_0015349	3300048906	Bacteria	4556
531	Ga0496103_0221509	3300048906	Bacteria	1217
532	Ga0496104_0015610	3300048907	Bacteria	6885
533	Ga0496104_0374176	3300048907	Bacteria	1337
534	Ga0496104_1229299	3300048907	Unclassified	652
535	Ga0496105_0158423	3300048908	Bacteria	1859
536	Ga0496105_0532829	3300048908	Bacteria	919
537	Ga0496106_0072554	3300048909	Bacteria	2633
538	Ga0496108_0126946	3300048911	Unclassified	2190
539	Ga0496109_0094895	3300048912	Bacteria	2761
540	Ga0496109_0266201	3300048912	Bacteria	1615
541	Ga0496110_0078295	3300048913	Bacteria	2943
542	Ga0496111_0011615	3300048914	Bacteria	5940
543	Ga0496112_0071591	3300048915	Bacteria	3427
544	Ga0496112_0120283	3300048915	Bacteria	2596
545	Ga0496112_0974104	3300048915	Bacteria	768
546	Ga0496113_0063990	3300048916	Unclassified	2780
547	Ga0496113_0641869	3300048916	Unclassified	849
548	Ga0496115_0133308	3300048918	Bacteria	2048
549	Ga0501224_040560	3300049664	Unclassified	704
550	Ga0501249_058563	3300049679	Bacteria	890
551	Ga0501270_061374	3300049767	Unclassified	706
552	Ga0501283_092214	3300049779	Unclassified	581
553	nmdc:mga0n895_1289_c1	3300050512	Bacteria	18538
554	nmdc:mga0rr50_8182_c1	3300050513	Bacteria	6494
555	nmdc:mga0rr50_97801_c1	3300050513	Bacteria	2299
556	nmdc:mga08x19_1187044_c1	3300050514	Unclassified	541
557	nmdc:mga08x19_160592_c2	3300050514	Unclassified	790
558	nmdc:mga08x19_3269_c1	3300050514	Bacteria	9706
559	nmdc:mga08x19_83569_c1	3300050514	Bacteria	2099
560	Ga0466962_0156668	3300061719	Bacteria	1106
561	Ga0224570_101848
562	LJNas_1026317
563	Ga0065712_10094923
564	Ga0065715_10473747
565	Ga0070676_10389504
566	Ga0070683_100092751
567	Ga0070683_100176032
568	Ga0070690_100205082
569	Ga0070670_100118792
570	Ga0070670_101067701
571	Ga0068869_100002642
572	Ga0070680_100019417
573	Ga0070682_100038113
574	Ga0068868_100001093
575	Ga0068868_100009989
576	Ga0068868_102351358
577	Ga0070660_100108688
578	Ga0070660_100114516
579	Ga0070691_10140497
580	Ga0070691_10176812
581	Ga0070687_100069578
582	Ga0070661_100011816
583	Ga0070661_100236120
584	Ga0070661_100541941
585	Ga0070692_10468506
586	Ga0070671_100263578
587	Ga0070673_100104851
588	Ga0070659_100589686
589	Ga0070659_100802503
590	Ga0070709_10196834
591	Ga0070709_10376543
592	Ga0070709_10634853
593	Ga0070709_10783208
594	Ga0070714_100004400
595	Ga0070714_100129229
596	Ga0070714_100226717
597	Ga0070714_100274545
598	Ga0070714_100291630
599	Ga0070714_100300361
600	Ga0070714_102510630
601	Ga0070713_100001793
602	Ga0070713_100020906
603	Ga0070713_100038787
604	Ga0070713_100050473
605	Ga0070713_100059926
606	Ga0070713_100204587
607	Ga0070713_100296137
608	Ga0070713_100468777
609	Ga0070713_100622215
610	Ga0070713_101588082
611	Ga0070710_10048078
612	Ga0070710_10226309
613	Ga0070710_10290943
614	Ga0070710_10342114
615	Ga0070710_10391572
616	Ga0070711_100045117
617	Ga0070711_100149713
618	Ga0070711_101227528
619	Ga0070705_100293594
620	Ga0070708_100034235
621	Ga0070708_100093755
622	Ga0070663_100370973
623	Ga0070678_100348930
624	Ga0070678_101278098
625	Ga0070662_100993819
626	Ga0070662_101418737
627	Ga0070681_10007515
628	Ga0070681_10015864
629	Ga0070681_10058261
630	Ga0070681_10150080
631	Ga0070681_10571797
632	Ga0070681_10695644
633	Ga0068867_100001428
634	Ga0068867_101090562
635	Ga0070706_100322287
636	Ga0070707_100410084
637	Ga0070707_100868943
638	Ga0070707_101142571
639	Ga0070707_101197427
640	Ga0070698_100127120
641	Ga0070679_100030397
642	Ga0070679_100145493
643	Ga0070679_100213049
644	Ga0070679_101317638
645	Ga0070684_100077535
646	Ga0070684_100079441
647	Ga0070684_100345944
648	Ga0070697_100110058
649	Ga0070697_100266004
650	Ga0068853_100063473
651	Ga0068853_100114422
652	Ga0068853_100175286
653	Ga0068853_100210328
654	Ga0068853_102164361
655	Ga0070693_100195091
656	Ga0068855_100000952
657	Ga0068855_100006023
658	Ga0068855_100050650
659	Ga0068855_100171438
660	Ga0068855_101166711
661	Ga0070664_100000278
662	Ga0070664_100050503
663	Ga0070664_100078822
664	Ga0070664_100150639
665	Ga0070664_100364715
666	Ga0068857_100000113
667	Ga0068857_100001051
668	Ga0068854_100001102
669	Ga0068854_100030695
670	Ga0068854_100071429
671	Ga0068854_100072560
672	Ga0068854_100135439
673	Ga0068856_100000096
674	Ga0068856_100000243
675	Ga0068856_100000305
676	Ga0068856_100004911
677	Ga0068856_100032746
678	Ga0068856_100340769
679	Ga0068856_100510994
680	Ga0068856_100714585
681	Ga0068852_100501691
682	Ga0068852_101408351
683	Ga0068859_100013832
684	Ga0068859_100026605
685	Ga0068864_100008229
686	Ga0068864_100029331
687	Ga0068864_100207964
688	Ga0068864_101859813
689	Ga0068866_10027059
690	Ga0068861_100329484
691	Ga0068870_10031720
692	Ga0068863_100018791
693	Ga0068863_100828020
694	Ga0068863_101936717
695	Ga0068858_100014219
696	Ga0068858_100017328
697	Ga0068860_100036976
698	Ga0068860_100041849
699	Ga0068860_100129861
700	Ga0068860_100280854
701	Ga0068862_100691408
702	Ga0070717_10000272
703	Ga0070717_10004367
704	Ga0070717_10009598
705	Ga0070717_10019597
706	Ga0070717_10029980
707	Ga0070717_10038105
708	Ga0070717_10047675
709	Ga0070717_10678734
710	Ga0070717_11049999
711	Ga0070717_11534339
712	Ga0070715_10047854
713	Ga0070715_10204648
714	Ga0070715_10739574
715	Ga0070716_100010019
716	Ga0070716_100134902
717	Ga0070716_100616144
718	Ga0070716_100709827
719	Ga0070712_100009039
720	Ga0070712_100037797
721	Ga0070712_100208295
722	Ga0070712_100934100
723	Ga0070712_101241474
724	Ga0097621_100000022
725	Ga0097621_100000562
726	Ga0097621_100023646
727	Ga0097621_100095553
728	Ga0097621_100633623
729	Ga0068871_100001873
730	Ga0068871_100016575
731	Ga0068871_100044356
732	Ga0068871_100138893
733	Ga0068871_100780748
734	Ga0075434_100097532
735	Ga0075434_101050904
736	Ga0075436_100000675
737	Ga0075436_100089685
738	Ga0075436_100128785
739	Ga0075436_100828877
740	Ga0097620_100013832
741	Ga0097620_100026604
742	Ga0075435_100018090
743	Ga0075435_100341516
744	Ga0105240_10017033
745	Ga0105240_10031734
746	Ga0105240_10049586
747	Ga0105240_10116056
748	Ga0105240_10131193
749	Ga0105240_10137150
750	Ga0105240_10734035
751	Ga0105245_10176972
752	Ga0114129_13408312
753	Ga0105243_10914140
754	Ga0105241_10031255
755	Ga0105241_10038806
756	Ga0105241_10042698
757	Ga0105241_10414937
758	Ga0105241_10591541
759	Ga0105248_10032942
760	Ga0105248_10103581
761	Ga0105248_10304721
762	Ga0105248_12966177
763	Ga0105237_10014873
764	Ga0105237_10080775
765	Ga0105237_10275444
766	Ga0105237_10287891
767	Ga0105237_10374805
768	Ga0105237_10664024
769	Ga0105237_11026022
770	Ga0105238_10000644
771	Ga0105238_10036914
772	Ga0105238_10089046
773	Ga0105238_10304985
774	Ga0105249_10167418
775	Ga0105249_10430204
776	Ga0105249_12484188
777	Ga0105249_12878931
778	Ga0105239_10083240
779	Ga0105239_10104189
780	Ga0105239_10413158
781	Ga0105239_10503939
782	Ga0105246_10041577
783	Ga0157373_10032259
784	Ga0157373_10060981
785	Ga0157373_10065247
786	Ga0157373_10200977
787	Ga0157373_10857453
788	Ga0157371_10056733
789	Ga0157371_10057042
790	Ga0157371_10163649
791	Ga0157370_10019816
792	Ga0157370_10714274
793	Ga0157370_11033889
794	Ga0157369_10000034
795	Ga0157369_10017221
796	Ga0157369_10064889
797	Ga0157369_10071544
798	Ga0157369_10137997
799	Ga0157369_10309073
800	Ga0157369_10424307
801	Ga0157374_10000052
802	Ga0157374_10001074
803	Ga0157374_10005336
804	Ga0157374_10073458
805	Ga0157374_10589662
806	Ga0157378_10000227
807	Ga0157378_10001800
808	Ga0157378_10015688
809	Ga0157378_10068034
810	Ga0157378_10091458
811	Ga0157372_10000585
812	Ga0157372_10001482
813	Ga0157372_10003253
814	Ga0157372_10003378
815	Ga0157372_10005242
816	Ga0157372_10008781
817	Ga0157372_10023442
818	Ga0157372_10029829
819	Ga0157372_10036871
820	Ga0157372_10252931
821	Ga0157372_10317063
822	Ga0163163_10128601
823	Ga0182008_10072486
824	Ga0157377_10446965
825	Ga0157379_10202440
826	Ga0157376_10004963
827	Ga0157376_10116275
828	Ga0157376_10147590
829	Ga0157376_12058445
830	Ga0182006_1025513
831	Ga0182007_10014155
832	Ga0182005_1197022
833	Ga0213874_10196388
834	Ga0213875_10000224
835	Ga0224572_1007523
836	Ga0224572_1011642
837	Ga0228598_1002456
838	Ga0207692_10025539
839	Ga0207692_10038389
840	Ga0207692_10144143
841	Ga0207692_10234210
842	Ga0207692_10484220
843	Ga0207642_10017155
844	Ga0207647_10258938
845	Ga0207647_10730224
846	Ga0207699_10013995
847	Ga0207699_10087220
848	Ga0207699_10382834
849	Ga0207699_11261218
850	Ga0207645_10332624
851	Ga0207643_10087558
852	Ga0207705_10152377
853	Ga0207684_10405673
854	Ga0207684_10773016
855	Ga0207684_11035705
856	Ga0207654_10028142
857	Ga0207654_10242013
858	Ga0207654_10318027
859	Ga0207707_10000496
860	Ga0207707_10136782
861	Ga0207707_10336495
862	Ga0207707_10504317
863	Ga0207695_10008608
864	Ga0207695_10012834
865	Ga0207695_10042465
866	Ga0207695_10076540
867	Ga0207695_10104831
868	Ga0207695_10121405
869	Ga0207695_10722203
870	Ga0207671_10588828
871	Ga0207671_10955625
872	Ga0207693_10016437
873	Ga0207693_10017348
874	Ga0207693_10863392
875	Ga0207663_10011814
876	Ga0207663_11381037
877	Ga0207660_10014013
878	Ga0207657_10000830
879	Ga0207649_10039059
880	Ga0207652_10003101
881	Ga0207652_10189261
882	Ga0207652_10767716
883	Ga0207652_11135278
884	Ga0207646_10107450
885	Ga0207694_10000250
886	Ga0207694_10062507
887	Ga0207650_10032393
888	Ga0207700_10004509
889	Ga0207700_10009460
890	Ga0207700_10052188
891	Ga0207700_10367767
892	Ga0207700_10468606
893	Ga0207700_10707737
894	Ga0207700_11209382
895	Ga0207664_10015704
896	Ga0207664_10017803
897	Ga0207664_10020398
898	Ga0207664_10062293
899	Ga0207664_10111361
900	Ga0207664_10119483
901	Ga0207664_10146467
902	Ga0207664_10215512
903	Ga0207664_10324217
904	Ga0207690_10603387
905	Ga0207706_10038235
906	Ga0207706_10127021
907	Ga0207709_10595271
908	Ga0207665_10080122
909	Ga0207665_10439430
910	Ga0207665_10854578
911	Ga0207665_11227655
912	Ga0207691_10691789
913	Ga0207711_10201887
914	Ga0207689_10013884
915	Ga0207689_10048522
916	Ga0207661_10114833
917	Ga0207661_10257634
918	Ga0207679_10004663
919	Ga0207679_10043033
920	Ga0207679_10107008
921	Ga0207679_10352451
922	Ga0207679_10361869
923	Ga0207667_10000996
924	Ga0207667_10007025
925	Ga0207667_10346903
926	Ga0207667_10766249
927	Ga0207651_10099496
928	Ga0207712_10873567
929	Ga0207640_10023771
930	Ga0207640_10039846
931	Ga0207640_10211112
932	Ga0207640_10593995
933	Ga0207658_10700680
934	Ga0207677_10047462
935	Ga0207677_10124843
936	Ga0207703_10009521
937	Ga0207703_10018786
938	Ga0207639_10056811
939	Ga0207639_10159479
940	Ga0207639_10201849
941	Ga0207639_10289515
942	Ga0207702_10006631
943	Ga0207702_10011612
944	Ga0207702_10018995
945	Ga0207702_10019240
946	Ga0207702_10159313
947	Ga0207702_10484152
948	Ga0207702_10698763
949	Ga0207702_11236523
950	Ga0207641_10018032
951	Ga0207641_10237198
952	Ga0207641_10536774
953	Ga0207648_10194858
954	Ga0207676_10011829
955	Ga0207676_10343599
956	Ga0207674_10002031
957	Ga0207675_100388764
958	Ga0207698_11159862
959	Ga0207698_11249255
960	Ga0265354_1025655
961	Ga0265356_1000851
962	Ga0268264_10014425
963	Ga0268264_10086657
964	Ga0268264_10106177
965	Ga0265338_10003184
966	Ga0265762_1000747
967	Ga0265762_1025340
968	Ga0265760_10000428
969	Ga0265760_10014540
970	Ga0265332_10017070
971	Ga0265328_10092406
972	Ga0265340_10172965
973	Ga0265340_10311911
974	Ga0265339_10055019
975	Ga0265339_10107797
976	Ga0265331_10173732
977	Ga0265316_10165521
978	Ga0265316_10424384
979	Ga0307408_100337982
980	Ga0265313_10260485
981	Ga0265314_10685855
982	Ga0265342_10136853
983	Ga0265342_10310126
984	Ga0307410_10153701
985	Ga0307409_100369850
986	Ga0307415_102017520
987	Ga0316214_1026233
988	Ga0316212_1008477
989	Ga0373926_0014732
990	Ga0373926_0282146
991	Ga0373934_0098403
992	Ga0373944_0044681
993	Ga0373936_0037200
994	Ga0373936_0148239
995	Ga0373936_0478887
996	Ga0373936_0510605
997	Ga0373939_0313095
998	Ga0373945_0162555
999	Ga0373943_0049025
1000	Ga0373943_0116275
1001	Ga0373943_0214020
1002	Ga0373946_0067632
1003	Ga0373955_0184179
1004	Ga0373931_0011944
1005	Ga0373931_0087481
1006	Ga0373931_0245845
1007	Ga0373935_0015420
1008	Ga0373935_0216390
1009	Ga0373927_0020506
1010	Ga0373927_0048097
1011	Ga0373927_0192438
1012	Ga0373933_0245735
1013	Ga0373933_0468046
1014	Ga0373947_0407847
1015	Ga0373937_0084993
1016	Ga0373937_0411089
1017	Ga0373937_0993501
1018	Ga0373925_0013644
1019	Ga0373925_0017270
1020	Ga0373925_0021047
1021	Ga0373925_0504908
1022	Ga0373925_1638547
1023	Ga0436364_1006074
1024	Ga0436364_1098998
1025	Ga0395901_0557141
1026	Ga0436365_0039278
1027	Ga0436365_0266173
1028	Ga0436365_1570491
1029	Ga0436363_0778512
1030	Ga0436363_0827623
1031	Ga0436363_0874835
1032	Ga0436363_1084670
1033	Ga0436363_1601994
1034	Ga0436362_1295402
1035	Ga0453683_0017248
1036	Ga0466966_0347895
1037	Ga0466961_0009128
1038	Ga0466963_0144917
1039	Ga0466963_0158764
1040	Ga0466964_0228174
1041	Ga0466968_0516952
1042	Ga0466957_0091174
1043	Ga0466959_0305123
1044	Ga0466959_0365363
1045	Ga0451576_0719529
1046	Ga0451576_0994112
1047	Ga0466958_0034420
1048	Ga0466958_0261876
1049	Ga0466967_0105005
1050	Ga0466967_0445527
1051	Ga0495651_0634957
1052	Ga0495653_0968075
1053	Ga0495580_0000751
1054	Ga0495580_0001473
1055	Ga0495580_0004382
1056	Ga0495580_0022308
1057	Ga0495580_0137297
1058	Ga0495580_0757195
1059	Ga0495582_0001114
1060	Ga0495582_0059526
1061	Ga0495594_0566938
1062	Ga0495618_0736185
1063	Ga0495630_0042188
1064	Ga0495630_0220445
1065	Ga0495666_0008202
1066	Ga0495665_0000559
1067	Ga0495665_0671354
1068	Ga0495587_0330148
1069	Ga0495645_0407888
1070	Ga0495667_0288179
1071	Ga0495623_0466725
1072	Ga0495646_0371887
1073	Ga0495646_0450197
1074	Ga0495669_0070699
1075	Ga0495600_0066581
1076	Ga0495674_0391673
1077	Ga0495675_0048183
1078	Ga0495675_0239796
1079	Ga0495684_0503326
1080	Ga0495593_0443724
1081	Ga0495602_0079038
1082	Ga0495602_0317098
1083	Ga0495602_0468338
1084	Ga0496100_1360980
1085	Ga0496101_0142833
1086	Ga0496101_0232318
1087	Ga0496102_0037505
1088	Ga0496102_0072616
1089	Ga0496102_0425573
1090	Ga0496103_0015349
1091	Ga0496103_0221509
1092	Ga0496104_0015610
1093	Ga0496104_0374176
1094	Ga0496104_1229299
1095	Ga0496105_0158423
1096	Ga0496105_0532829
1097	Ga0496106_0072554
1098	Ga0496108_0126946
1099	Ga0496109_0094895
1100	Ga0496109_0266201
1101	Ga0496110_0078295
1102	Ga0496111_0011615
1103	Ga0496112_0071591
1104	Ga0496112_0120283
1105	Ga0496112_0974104
1106	Ga0496113_0063990
1107	Ga0496113_0641869
1108	Ga0496115_0133308
1109	Ga0501224_040560
1110	Ga0501249_058563
1111	Ga0501270_061374
1112	Ga0501283_092214
1113	nmdc:mga0n895_1289_c1
1114	nmdc:mga0rr50_8182_c1
1115	nmdc:mga0rr50_97801_c1
1116	nmdc:mga08x19_1187044_c1
1117	nmdc:mga08x19_160592_c2
1118	nmdc:mga08x19_3269_c1
1119	nmdc:mga08x19_83569_c1
1120	Ga0466962_0156668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8tgy-assembly1.cif.gz_E	crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea	0.8433	11	130
8tgy-assembly1.cif.gz_E	crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea	0.8082	11	130
7mgx-assembly1.cif.gz_B	structure of emre-d3 mutant in complex with monobody l10 and methyl viologen	0.796	11	131
7mgx-assembly1.cif.gz_B	structure of emre-d3 mutant in complex with monobody l10 and methyl viologen	0.7824	11	131
7svx-assembly1.cif.gz_B	structure of emre-d3 mutant in complex with monobody l10 and harmane	0.778	11	129

ID	Description	Score	Start	End	Superfamily
af_Q8WY98_11_126_1.10.3730.20	Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;	0.8664	17	128	1.10.3730.20
af_Q5A5P7_5_125_1.10.3730.20	Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;	0.858	11	130	1.10.3730.20
af_P69212_3_109_1.10.3730.20	Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;	0.8491	11	130	1.10.3730.20
af_A0A1D6M9S6_14_266_1.10.3730.20	Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;	0.8457	7	129	1.10.3730.20
af_I1JIY8_5_299_1.10.3730.20	Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;	0.839	7	127	1.10.3730.20

ID	Description	Score	Start	End	GO Terms
AF-A0A7V1UKN2-F1-model_v4	EamA domain-containing protein	0.95	7	131	GO:0005886 GO:0022857
AF-A0A1Q7YP53-F1-model_v4	EamA domain-containing protein	0.9282	7	131	GO:0005886 GO:0022857
AF-A0A6L9Z563-F1-model_v4	EamA-like transporter family protein	0.9241	10	130	GO:0005886 GO:0022857
AF-A0A1F5CD55-F1-model_v4	EamA domain-containing protein	0.9209	11	131	GO:0005886 GO:0022857
AF-A0A495BPZ7-F1-model_v4	deleted	0.9188	8	131

F463692

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Map