F463597

General Info

Members Datasets Scaffolds Average Seq Length
559 337 486 359

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0043583|Ga0495649_0043583_193_1350
Length 376
Sequence MKQARRNILAGSLQLIAALALAAPTVIRVGVASPAQGSPPGISGSSIAIAHATGAIEQEFKPDNIRIEWYFFKGAGPAVNEALSNRQLDFAFQGDLPSIIGKSAGLKTRLILATGVRMNLYLAVPAGSPVRKVEDLRGKRVAIFKGTNSQLPINRLLAAHGLTEKDLKVVNLDTATAQAALTTKDIDAVFGSYDLLKLRDKGVARIVYTSKGDSPVFTRQSHMLVTDEFAARYPEQTRRFVKAVVKTARWSSEDANRDEVFRLWARPGVAKVEVWKEDYEGQPLRTRLSPLFDPFLTERYRDAVEHAYQFKLIRRKFDVDTWIDRSFLNATLKELKLETYWPANPVGAYAAGAAPVPTPVSSYVPQKPVPGGSNRS

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231021 Pseudomonas sp. GM78 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
9 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
10 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
11 2547132374 Acidovorax radicis N35 Isolate Unclassified
12 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
13 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
14 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
15 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
16 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
17 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
18 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
19 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
20 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
21 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
22 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
23 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
24 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
25 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
26 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
27 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
28 2643221717 Acidovorax sp. Root267 Isolate Unclassified
29 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
30 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
31 2773857670 Pseudomonas sp. 478 Isolate Unclassified
32 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
33 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
34 2784132072 Pseudomonas sp. 460 Isolate Unclassified
35 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
36 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
37 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
38 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
39 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
40 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
41 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
42 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
43 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
44 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
45 2858950400 Achromobacter sp. K91 Isolate Unclassified
46 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
47 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
48 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
49 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
50 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
51 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
52 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
53 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
54 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
55 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
56 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
57 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
58 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
59 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
60 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
61 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
62 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
63 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
64 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
65 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
66 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
67 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
68 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
69 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
70 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
71 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
72 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
73 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
74 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
75 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
76 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
77 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
78 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
79 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
80 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
81 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
82 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
83 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
84 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
85 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
86 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
90 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
91 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
92 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
93 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
95 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
96 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
100 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
101 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
102 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
103 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
145 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
200 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
201 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
202 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
203 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
204 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
205 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
225 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
226 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
316 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
321 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
322 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
323 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
324 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
325 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
326 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
327 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
328 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
329 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
333 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
334 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
335 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
336 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
337 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.12
Metatranscriptomes 0
Isolates 12.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.17
Nodule 2.86
Rhizoplane 5.9
Rhizosphere 54.92
Stem 0
Stem Tuber 0
Unclassified 19.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000424 3300001979 Bacteria 18050
2 JGI25155J39150_1000432 3300002704 Bacteria 11216
3 JGI25155J39150_1000469 3300002704 Bacteria 10099
4 JGI25156J39149_1001147 3300002705 Bacteria 11872
5 JGI25156J39149_1001292 3300002705 Bacteria 10864
6 JGI25162J39368_1000356 3300002737 Bacteria 39132
7 JGI25154J39366_1000961 3300002738 Bacteria 11872
8 JGI25154J39366_1001064 3300002738 Bacteria 10864
9 JGI25157J39369_1000990 3300002741 Bacteria 13286
10 JGI25152J39213_1003697 3300002773 Bacteria 5132
11 JGI25152J39213_1008691 3300002773 Bacteria 2493
12 JGI25159J45721_1002018 3300002987 Bacteria 8049
13 JGI25151J46595_10000625 3300003187 Bacteria 30742
14 JGI25165J46597_1000450 3300003214 Bacteria 41394
15 JGI25160J50197_1000018 3300003354 Bacteria 239933
16 JGI25161J50226_1000020 3300003374 Bacteria 164844
17 Ga0055538_1000002 3300003751 Bacteria 999437
18 Ga0055539_1000002 3300003752 Bacteria 999437
19 Ga0055533_1000004 3300003756 Bacteria 999437
20 Ga0055532_1000102 3300003758 Bacteria 91562
21 Ga0055525_1000002 3300003759 Bacteria 999437
22 Ga0055535_1003187 3300003761 Bacteria 4865
23 Ga0055526_1025242 3300003771 Bacteria 1912
24 Ga0055526_1029305 3300003771 Bacteria 1638
25 Ga0055528_1000273 3300003790 Bacteria 43784
26 Ga0055528_1013773 3300003790 Bacteria 3042
27 Ga0055540_1026204 3300003792 Bacteria 1414
28 Ga0055541_1000002 3300003841 Bacteria 896405
29 Ga0058692_1000144 3300003856 Bacteria 45086
30 Ga0055543_1000004 3300004625 Bacteria 239971
31 Ga0065165_1000429 3300005262 Bacteria 66016
32 Ga0065165_1004320 3300005262 Bacteria 8934
33 Ga0065714_10000082 3300005288 Bacteria 17755
34 Ga0065714_10087023 3300005288 Bacteria 2077
35 Ga0065714_10098195 3300005288 Bacteria 1715
36 Ga0065712_10020728 3300005290 Bacteria 1744
37 Ga0070668_100337278 3300005347 Bacteria 1273
38 Ga0070671_100062170 3300005355 Bacteria 3110
39 Ga0070671_100212534 3300005355 Bacteria 1641
40 Ga0070659_100025112 3300005366 Bacteria 4574
41 Ga0070667_100012256 3300005367 Bacteria 7093
42 Ga0070663_100068038 3300005455 Bacteria 2585
43 Ga0070678_100018058 3300005456 Bacteria 4562
44 Ga0068867_100116053 3300005459 Bacteria 2063
45 Ga0070706_100012987 3300005467 Bacteria 7708
46 Ga0070707_100217118 3300005468 Bacteria 1863
47 Ga0068853_100050351 3300005539 Bacteria 3583
48 Ga0070665_100092444 3300005548 Bacteria 3030
49 Ga0068855_100109586 3300005563 Bacteria 3170
50 Ga0068854_100026272 3300005578 Bacteria 4000
51 Ga0068852_100061870 3300005616 Bacteria 3254
52 Ga0068859_100063973 3300005617 Bacteria 3711
53 Ga0068861_100210297 3300005719 Bacteria 1638
54 Ga0068863_100060151 3300005841 Bacteria 3593
55 Ga0068860_100208581 3300005843 Bacteria 1895
56 Ga0075365_10006192 3300006038 Bacteria 6558
57 Ga0075365_10037936 3300006038 Bacteria 3129
58 Ga0075368_10020547 3300006042 Bacteria 2502
59 Ga0075363_100007382 3300006048 Bacteria 5047
60 Ga0075362_10033262 3300006177 Bacteria 2242
61 Ga0075362_10038201 3300006177 Bacteria 2109
62 Ga0075367_10000621 3300006178 Bacteria 13574
63 Ga0075369_10000377 3300006186 Bacteria 13354
64 Ga0075369_10019565 3300006186 Bacteria 2765
65 Ga0075366_10064282 3300006195 Bacteria 2182
66 Ga0075370_10012137 3300006353 Bacteria 4546
67 Ga0097620_100063974 3300006931 Bacteria 3711
68 Ga0105251_10000101 3300009011 Bacteria 84159
69 Ga0105251_10000114 3300009011 Bacteria 80239
70 Ga0105251_10000659 3300009011 Bacteria 31764
71 Ga0105251_10000900 3300009011 Bacteria 26643
72 Ga0105251_10002850 3300009011 Bacteria 13057
73 Ga0105251_10039735 3300009011 Bacteria 2296
74 Ga0105244_10064484 3300009036 Bacteria 1837
75 Ga0105250_10000268 3300009092 Bacteria 42300
76 Ga0105240_10006815 3300009093 Bacteria 16707
77 Ga0105240_10040183 3300009093 Bacteria 5987
78 Ga0105240_10063805 3300009093 Bacteria 4580
79 Ga0105240_10185576 3300009093 Bacteria 2450
80 Ga0105243_10108888 3300009148 Bacteria 2314
81 Ga0105242_10120114 3300009176 Bacteria 2254
82 Ga0105242_10336382 3300009176 Bacteria 1390
83 Ga0105248_10511151 3300009177 Bacteria 1355
84 Ga0105237_10000564 3300009545 Bacteria 51816
85 Ga0105238_10019161 3300009551 Bacteria 6972
86 Ga0105249_10242913 3300009553 Bacteria 1781
87 Ga0123342_1020141 3300009766 Bacteria 4933
88 Ga0105239_10005868 3300010375 Bacteria 14316
89 Ga0105239_10018822 3300010375 Bacteria 7629
90 Ga0157370_10009041 3300013104 Bacteria 10693
91 Ga0157374_10112930 3300013296 Bacteria 2615
92 Ga0163162_10000665 3300013306 Bacteria 31845
93 Ga0163162_10042896 3300013306 Bacteria 4528
94 Ga0163162_10075638 3300013306 Bacteria 3428
95 Ga0163162_10382762 3300013306 Bacteria 1540
96 Ga0157375_10210765 3300013308 Bacteria 2100
97 Ga0157375_10223087 3300013308 Bacteria 2043
98 Ga0163163_10368378 3300014325 Bacteria 1493
99 Ga0157379_10016569 3300014968 Bacteria 6481
100 Ga0182006_1002816 3300015261 Bacteria 9276
101 Ga0182006_1007399 3300015261 Bacteria 5026
102 Ga0182007_10007393 3300015262 Bacteria 4610
103 Ga0163161_10015863 3300017792 Bacteria 5255
104 Ga0163161_10044079 3300017792 Bacteria 3212
105 Ga0163161_10092736 3300017792 Bacteria 2236
106 Ga0213872_10031309 3300021361 Bacteria 2438
107 Ga0209435_100030 3300025206 Bacteria 170822
108 Ga0209435_100134 3300025206 Bacteria 25335
109 Ga0209784_100002 3300025224 Bacteria 1753105
110 Ga0209566_100003 3300025225 Bacteria 1753105
111 Ga0209674_100004 3300025226 Bacteria 1753105
112 Ga0209147_100159 3300025229 Bacteria 91615
113 Ga0209563_100006 3300025230 Bacteria 1753105
114 Ga0209437_100286 3300025233 Bacteria 74228
115 Ga0209437_100317 3300025233 Bacteria 63136
116 Ga0209258_100259 3300025242 Bacteria 92050
117 Ga0209646_1000057 3300025246 Bacteria 266384
118 Ga0209646_1000100 3300025246 Bacteria 170822
119 Ga0209026_1000091 3300025250 Bacteria 171170
120 Ga0209677_100003 3300025253 Bacteria 1753105
121 Ga0209148_1005591 3300025254 Bacteria 2859
122 Ga0209759_1000084 3300025256 Bacteria 169233
123 Ga0209759_1000141 3300025256 Bacteria 124528
124 Ga0209129_1000182 3300025258 Bacteria 87739
125 Ga0209129_1003600 3300025258 Bacteria 6628
126 Ga0209233_1000249 3300025261 Bacteria 86702
127 Ga0209455_1008345 3300025272 Bacteria 2821
128 Ga0209673_1000691 3300025273 Bacteria 48251
129 Ga0209673_1010739 3300025273 Bacteria 3836
130 Ga0209130_1000035 3300025284 Bacteria 296161
131 Ga0209025_1000461 3300025294 Bacteria 79418
132 Ga0209564_1002222 3300025295 Bacteria 16072
133 Ga0209564_1015018 3300025295 Bacteria 3179
134 Ga0209758_1029740 3300025297 Bacteria 2276
135 Ga0209256_1000648 3300025299 Bacteria 47343
136 Ga0207426_1000017 3300025302 Bacteria 577913
137 Ga0207426_1000851 3300025302 Bacteria 32072
138 Ga0207426_1001839 3300025302 Bacteria 15628
139 Ga0209051_1000932 3300025303 Bacteria 28929
140 Ga0209051_1005930 3300025303 Bacteria 7012
141 Ga0209051_1006880 3300025303 Bacteria 6318
142 Ga0207696_1000020 3300025711 Bacteria 434998
143 Ga0207655_1021552 3300025728 Bacteria 3266
144 Ga0207655_1030571 3300025728 Bacteria 2502
145 Ga0207713_1000032 3300025735 Bacteria 276465
146 Ga0207713_1000200 3300025735 Bacteria 82983
147 Ga0207713_1003128 3300025735 Bacteria 11474
148 Ga0207713_1021002 3300025735 Bacteria 3141
149 Ga0207647_10143723 3300025904 Bacteria 1397
150 Ga0207684_10015012 3300025910 Bacteria 6667
151 Ga0207695_10005698 3300025913 Bacteria 16426
152 Ga0207695_10060576 3300025913 Bacteria 3916
153 Ga0207695_10080303 3300025913 Bacteria 3303
154 Ga0207671_10006250 3300025914 Bacteria 10674
155 Ga0207694_10026948 3300025924 Bacteria 4376
156 Ga0207706_10036995 3300025933 Bacteria 4335
157 Ga0207706_10215203 3300025933 Bacteria 1683
158 Ga0207709_10045430 3300025935 Bacteria 2660
159 Ga0207665_10154329 3300025939 Unclassified 1647
160 Ga0207658_10008255 3300025986 Bacteria 7094
161 Ga0207678_10072977 3300026067 Bacteria 2941
162 Ga0207648_10020423 3300026089 Bacteria 5964
163 Ga0207674_10078966 3300026116 Bacteria 3296
164 Ga0207683_10031236 3300026121 Bacteria 4622
165 Ga0207698_10044170 3300026142 Bacteria 3346
166 Ga0207698_10119392 3300026142 Bacteria 2228
167 Ga0209371_1000001 3300027312 Bacteria 2771503
168 Ga0209371_1018037 3300027312 Bacteria 1808
169 Ga0268264_10163972 3300028381 Bacteria 2005
170 Ga0307517_10151891 3300028786 Bacteria 1585
171 Ga0307515_10000492 3300028794 Bacteria 94501
172 Ga0307515_10000571 3300028794 Bacteria 86938
173 Ga0307515_10105341 3300028794 Bacteria 3359
174 Ga0307515_10132008 3300028794 Bacteria 2743
175 Ga0268256_1000001 3300030500 Bacteria 2771065
176 Ga0268256_1020125 3300030500 Bacteria 1808
177 Ga0307513_10013229 3300031456 Bacteria 10129
178 Ga0307513_10123405 3300031456 Bacteria 2552
179 Ga0307513_10132353 3300031456 Bacteria 2437
180 Ga0307513_10232792 3300031456 Bacteria 1654
181 Ga0307509_10000654 3300031507 Bacteria 58837
182 Ga0307509_10008448 3300031507 Bacteria 13131
183 Ga0307514_10000708 3300031649 Bacteria 57806
184 Ga0307516_10006124 3300031730 Bacteria 14179
185 Ga0307516_10053150 3300031730 Bacteria 3962
186 Ga0307405_10268844 3300031731 Bacteria 1277
187 Ga0307412_10010053 3300031911 Bacteria 5442
188 Ga0307412_10046935 3300031911 Bacteria 2833
189 Ga0307510_10001775 3300033180 Bacteria 24067
190 Ga0307510_10040139 3300033180 Bacteria 5143
191 Ga0395905_0027725 3300037471 Bacteria 5341
192 Ga0436361_0163520 3300039447 Bacteria 2105
193 Ga0436361_0456842 3300039447 Bacteria 43282
194 Ga0439465_0004220 3300041413 Bacteria 4676
195 Ga0451795_1074212 3300041456 Bacteria 1444
196 Ga0439451_020130 3300042009 Bacteria 1345
197 Ga0450911_000247 3300042115 Bacteria 20510
198 Ga0450902_000035 3300042137 Bacteria 11749
199 Ga0450902_000345 3300042137 Bacteria 5675
200 Ga0450903_001670 3300042138 Bacteria 4106
201 Ga0450905_000968 3300042142 Bacteria 3592
202 Ga0451577_0029453 3300042876 Bacteria 4963
203 Ga0451577_0292037 3300042876 Bacteria 1477
204 Ga0453683_0237437 3300044673 Bacteria 1161
205 Ga0466965_0064287 3300044683 Bacteria 1836
206 Ga0466960_0038620 3300044901 Bacteria 2246
207 Ga0466967_0109771 3300045976 Bacteria 2533
208 Ga0495617_004568 3300046452 Bacteria 5016
209 Ga0495617_026767 3300046452 Bacteria 1942
210 Ga0495603_0000130 3300046455 Bacteria 36862
211 Ga0495603_0000827 3300046455 Bacteria 17785
212 Ga0495603_0011081 3300046455 Bacteria 5465
213 Ga0495603_0030596 3300046455 Bacteria 3241
214 Ga0495590_0002504 3300046457 Bacteria 7599
215 Ga0495590_0013638 3300046457 Bacteria 2983
216 Ga0495591_000453 3300046458 Bacteria 33315
217 Ga0495591_006075 3300046458 Bacteria 5429
218 Ga0495591_007180 3300046458 Bacteria 4774
219 Ga0495591_049239 3300046458 Bacteria 1159
220 Ga0495629_0000131 3300046459 Bacteria 65274
221 Ga0495638_0000129 3300046460 Bacteria 123549
222 Ga0495638_0000163 3300046460 Bacteria 103363
223 Ga0495638_0046061 3300046460 Bacteria 2741
224 Ga0495653_0000110 3300046463 Bacteria 68799
225 Ga0495653_0009746 3300046463 Bacteria 7855
226 Ga0495650_0001340 3300046471 Bacteria 24528
227 Ga0495650_0001356 3300046471 Bacteria 24315
228 Ga0495650_0025673 3300046471 Bacteria 2755
229 Ga0495580_0003084 3300046472 Bacteria 14276
230 Ga0495582_0019489 3300046473 Bacteria 3709
231 Ga0495605_0000790 3300046474 Bacteria 22729
232 Ga0495605_0001903 3300046474 Bacteria 13308
233 Ga0495605_0052114 3300046474 Bacteria 1989
234 Ga0495584_0000517 3300046491 Bacteria 26319
235 Ga0495584_0003139 3300046491 Bacteria 9179
236 Ga0495584_0018419 3300046491 Bacteria 3549
237 Ga0495585_0000283 3300046492 Bacteria 50893
238 Ga0495585_0001302 3300046492 Bacteria 19904
239 Ga0495585_0020176 3300046492 Bacteria 3835
240 Ga0495585_0021200 3300046492 Bacteria 3733
241 Ga0495585_0050057 3300046492 Bacteria 2318
242 Ga0495596_0000876 3300046500 Bacteria 18144
243 Ga0495596_0020539 3300046500 Bacteria 2703
244 Ga0495596_0040202 3300046500 Bacteria 1846
245 Ga0495607_0000021 3300046501 Bacteria 164571
246 Ga0495607_0005001 3300046501 Bacteria 9618
247 Ga0495607_0016893 3300046501 Bacteria 4698
248 Ga0495607_0018192 3300046501 Bacteria 4486
249 Ga0495583_0001424 3300046506 Bacteria 24362
250 Ga0495583_0009518 3300046506 Bacteria 5794
251 Ga0495583_0025577 3300046506 Bacteria 2946
252 Ga0495583_0062018 3300046506 Bacteria 1666
253 Ga0495606_0000421 3300046507 Bacteria 70842
254 Ga0495606_0191932 3300046507 Bacteria 1170
255 Ga0495610_0013173 3300046512 Bacteria 4926
256 Ga0495610_0048013 3300046512 Bacteria 2097
257 Ga0495616_0006786 3300046513 Bacteria 6900
258 Ga0495616_0006880 3300046513 Bacteria 6847
259 Ga0495620_0014489 3300046515 Bacteria 4006
260 Ga0495620_0059236 3300046515 Bacteria 1601
261 Ga0495628_0002410 3300046516 Bacteria 16862
262 Ga0495630_0032332 3300046517 Bacteria 3898
263 Ga0495631_0086726 3300046518 Bacteria 1348
264 Ga0495632_0000229 3300046519 Bacteria 56776
265 Ga0495632_0003134 3300046519 Bacteria 11957
266 Ga0495632_0005181 3300046519 Bacteria 8696
267 Ga0495632_0015557 3300046519 Bacteria 4259
268 Ga0495632_0021728 3300046519 Bacteria 3453
269 Ga0495637_0001388 3300046520 Bacteria 14467
270 Ga0495637_0002621 3300046520 Bacteria 9865
271 Ga0495643_0004168 3300046522 Bacteria 10267
272 Ga0495643_0010338 3300046522 Bacteria 5745
273 Ga0495644_0000248 3300046523 Bacteria 25155
274 Ga0495644_0031417 3300046523 Bacteria 2006
275 Ga0495644_0036155 3300046523 Bacteria 1863
276 Ga0495648_0002059 3300046524 Bacteria 19033
277 Ga0495648_0080664 3300046524 Bacteria 1853
278 Ga0495648_0146777 3300046524 Bacteria 1235
279 Ga0495642_0000024 3300046528 Bacteria 92899
280 Ga0495642_0001197 3300046528 Bacteria 11940
281 Ga0495654_0004143 3300046530 Bacteria 8696
282 Ga0495654_0005836 3300046530 Bacteria 7087
283 Ga0495654_0010039 3300046530 Bacteria 5169
284 Ga0495654_0052383 3300046530 Bacteria 1987
285 Ga0495654_0106488 3300046530 Bacteria 1284
286 Ga0495587_0011494 3300046536 Bacteria 5607
287 Ga0495609_0012039 3300046538 Bacteria 4107
288 Ga0495597_0000087 3300046542 Bacteria 81275
289 Ga0495597_0011499 3300046542 Bacteria 4290
290 Ga0495597_0013662 3300046542 Bacteria 3884
291 Ga0495645_0039747 3300046543 Bacteria 3430
292 Ga0495645_0063533 3300046543 Bacteria 2672
293 Ga0495622_0002201 3300046557 Bacteria 9507
294 Ga0495656_0003448 3300046615 Bacteria 5346
295 Ga0495668_0004657 3300046616 Bacteria 9630
296 Ga0495634_0091774 3300046642 Bacteria 1971
297 Ga0495611_0000967 3300046648 Bacteria 15310
298 Ga0495611_0065802 3300046648 Bacteria 1652
299 Ga0495625_0001843 3300046660 Bacteria 24209
300 Ga0495625_0004068 3300046660 Bacteria 13972
301 Ga0495625_0013786 3300046660 Bacteria 6479
302 Ga0495635_0084994 3300046663 Bacteria 2165
303 Ga0495659_0004103 3300046664 Bacteria 4599
304 Ga0495661_0000013 3300046665 Bacteria 259387
305 Ga0495588_0107541 3300046674 Bacteria 1468
306 Ga0495623_0007956 3300046679 Bacteria 6891
307 Ga0495623_0071871 3300046679 Bacteria 2152
308 Ga0495646_0035256 3300046680 Bacteria 3104
309 Ga0495658_0059223 3300046683 Bacteria 2192
310 Ga0495658_0065593 3300046683 Bacteria 2095
311 Ga0495669_0000568 3300046684 Bacteria 16328
312 Ga0495669_0012052 3300046684 Bacteria 3675
313 Ga0495669_0037723 3300046684 Bacteria 2139
314 Ga0495613_0228101 3300046689 Bacteria 1306
315 Ga0495624_0004662 3300046690 Bacteria 9981
316 Ga0495670_0004932 3300046691 Bacteria 6554
317 Ga0495670_0009461 3300046691 Bacteria 4790
318 Ga0495670_0013015 3300046691 Bacteria 4091
319 Ga0495670_0078157 3300046691 Bacteria 1683
320 Ga0495671_0000995 3300046692 Bacteria 19753
321 Ga0495671_0002467 3300046692 Bacteria 11674
322 Ga0495671_0044243 3300046692 Bacteria 2233
323 Ga0495671_0092893 3300046692 Bacteria 1476
324 Ga0495649_0000412 3300046694 Bacteria 37157
325 Ga0495649_0000637 3300046694 Bacteria 28551
326 Ga0495649_0001602 3300046694 Bacteria 16874
327 Ga0495649_0016231 3300046694 Bacteria 4223
328 Ga0495649_0043583 3300046694 Bacteria 2449
329 Ga0495649_0213375 3300046694 Bacteria 1000
330 Ga0495589_0000774 3300046794 Bacteria 20341
331 Ga0495589_0014859 3300046794 Bacteria 4005
332 Ga0495589_0016529 3300046794 Bacteria 3792
333 Ga0495589_0016861 3300046794 Bacteria 3750
334 Ga0495600_0003625 3300046809 Bacteria 9104
335 Ga0495660_0004264 3300046810 Bacteria 8674
336 Ga0495660_0004950 3300046810 Bacteria 8022
337 Ga0495660_0016432 3300046810 Bacteria 4267
338 Ga0495660_0023656 3300046810 Bacteria 3504
339 Ga0495660_0073243 3300046810 Bacteria 1812
340 Ga0495581_0000960 3300047315 Bacteria 15486
341 Ga0495672_0007650 3300047320 Bacteria 8104
342 Ga0495672_0014016 3300047320 Bacteria 5509
343 Ga0495672_0054614 3300047320 Bacteria 2333
344 Ga0495676_0027229 3300047321 Bacteria 4905
345 Ga0495680_0001202 3300047322 Bacteria 28406
346 Ga0495680_0003258 3300047322 Bacteria 16118
347 Ga0495680_0010186 3300047322 Bacteria 8398
348 Ga0495680_0110575 3300047322 Bacteria 2036
349 Ga0495683_0003792 3300047323 Bacteria 8723
350 Ga0495683_0006472 3300047323 Bacteria 6401
351 Ga0495683_0023169 3300047323 Bacteria 3192
352 Ga0495683_0043265 3300047323 Bacteria 2268
353 Ga0495683_0045977 3300047323 Bacteria 2191
354 Ga0495687_031474 3300047443 Bacteria 2433
355 Ga0495675_0001160 3300047444 Bacteria 15989
356 Ga0495675_0063139 3300047444 Bacteria 2344
357 Ga0495677_0002281 3300047445 Bacteria 7564
358 Ga0495679_032664 3300047446 Bacteria 1667
359 Ga0495679_037916 3300047446 Bacteria 1513
360 Ga0495685_006742 3300047447 Bacteria 3773
361 Ga0495673_0015526 3300047469 Bacteria 3922
362 Ga0495673_0020707 3300047469 Bacteria 3268
363 Ga0495673_0044004 3300047469 Bacteria 1993
364 Ga0495681_0007412 3300047470 Bacteria 7013
365 Ga0495681_0055665 3300047470 Bacteria 1843
366 Ga0495681_0070021 3300047470 Bacteria 1592
367 Ga0495686_0000045 3300047472 Bacteria 284761
368 Ga0495686_0075378 3300047472 Bacteria 2069
369 Ga0495593_0002097 3300047673 Bacteria 11937
370 Ga0495593_0002305 3300047673 Bacteria 11449
371 Ga0495593_0017702 3300047673 Bacteria 4011
372 Ga0495614_0089265 3300048089 Bacteria 1340
373 Ga0495626_0060515 3300048091 Bacteria 1725
374 Ga0496100_0004410 3300048903 Bacteria 7456
375 Ga0496100_0006158 3300048903 Bacteria 6526
376 Ga0496101_0004224 3300048904 Bacteria 9005
377 Ga0496101_0025760 3300048904 Bacteria 4083
378 Ga0496101_0093954 3300048904 Bacteria 2234
379 Ga0496102_0014822 3300048905 Bacteria 6779
380 Ga0496102_0025839 3300048905 Bacteria 5230
381 Ga0496102_0078191 3300048905 Bacteria 3045
382 Ga0496102_0100425 3300048905 Bacteria 2687
383 Ga0496103_0010732 3300048906 Bacteria 5420
384 Ga0496104_0002548 3300048907 Bacteria 15702
385 Ga0496104_0032031 3300048907 Bacteria 4893
386 Ga0496104_0112044 3300048907 Bacteria 2616
387 Ga0496105_0007903 3300048908 Bacteria 8261
388 Ga0496105_0025926 3300048908 Bacteria 4776
389 Ga0496105_0054299 3300048908 Bacteria 3308
390 Ga0496105_0234822 3300048908 Bacteria 1489
391 Ga0496106_0006261 3300048909 Bacteria 8810
392 Ga0496106_0166502 3300048909 Bacteria 1745
393 Ga0496107_0005634 3300048910 Bacteria 8577
394 Ga0496110_0029915 3300048913 Bacteria 4693
395 Ga0496110_0050478 3300048913 Bacteria 3652
396 Ga0496110_0202129 3300048913 Bacteria 1805
397 Ga0496111_0007158 3300048914 Bacteria 7290
398 Ga0496111_0063328 3300048914 Bacteria 2682
399 Ga0496111_0113421 3300048914 Bacteria 1997
400 Ga0496112_0032470 3300048915 Bacteria 5069
401 Ga0496112_0343842 3300048915 Bacteria 1435
402 Ga0496113_0008848 3300048916 Bacteria 6581
403 Ga0496113_0010853 3300048916 Bacteria 6046
404 Ga0496114_0004014 3300048917 Bacteria 11374
405 Ga0496116_0007831 3300048919 Bacteria 9384
406 Ga0496116_0007962 3300048919 Bacteria 9283
407 Ga0496116_0020976 3300048919 Bacteria 4941
408 Ga0496116_0041603 3300048919 Bacteria 3151
409 Ga0496116_0117759 3300048919 Bacteria 1545
410 Ga0496117_0011794 3300048920 Bacteria 7784
411 Ga0496117_0023641 3300048920 Bacteria 4889
412 Ga0496118_0019324 3300048921 Bacteria 6094
413 Ga0496118_0056854 3300048921 Bacteria 2937
414 Ga0496119_0009017 3300048922 Bacteria 8653
415 Ga0496120_0011277 3300048923 Bacteria 6157
416 Ga0496121_0000478 3300048924 Bacteria 77761
417 Ga0496121_0002169 3300048924 Bacteria 30728
418 Ga0496121_0003781 3300048924 Bacteria 21129
419 Ga0496121_0009279 3300048924 Bacteria 11348
420 Ga0496121_0015635 3300048924 Bacteria 7921
421 Ga0496121_0031960 3300048924 Bacteria 4797
422 Ga0496121_0039492 3300048924 Bacteria 4157
423 Ga0496121_0154606 3300048924 Bacteria 1684
424 Ga0496122_0000748 3300048925 Bacteria 63291
425 Ga0496122_0001544 3300048925 Bacteria 36564
426 Ga0496122_0016770 3300048925 Bacteria 6901
427 Ga0496122_0032085 3300048925 Bacteria 4351
428 Ga0496123_0000432 3300048926 Bacteria 75431
429 Ga0496123_0001196 3300048926 Bacteria 38152
430 Ga0496123_0016224 3300048926 Bacteria 6061
431 Ga0496123_0016506 3300048926 Bacteria 5993
432 Ga0496123_0037366 3300048926 Bacteria 3429
433 Ga0496123_0074480 3300048926 Bacteria 2101
434 Ga0496124_0000004 3300048927 Bacteria 976131
435 Ga0496124_0013134 3300048927 Bacteria 8107
436 Ga0496124_0014294 3300048927 Bacteria 7682
437 Ga0496124_0081505 3300048927 Bacteria 2659
438 Ga0496124_0276013 3300048927 Bacteria 1228
439 Ga0496125_0000146 3300048928 Bacteria 154919
440 Ga0496125_0006650 3300048928 Bacteria 12443
441 Ga0496125_0007191 3300048928 Bacteria 11869
442 Ga0496125_0024108 3300048928 Bacteria 5602
443 Ga0496125_0034410 3300048928 Bacteria 4466
444 Ga0496125_0053276 3300048928 Bacteria 3318
445 Ga0496125_0056608 3300048928 Bacteria 3183
446 Ga0496126_0018095 3300048929 Bacteria 6997
447 Ga0496126_0057911 3300048929 Bacteria 3495
448 Ga0496126_0079915 3300048929 Bacteria 2894
449 Ga0496126_0113381 3300048929 Bacteria 2360
450 Ga0495678_004938 3300049459 Bacteria 7526
451 Ga0495678_006919 3300049459 Bacteria 5952
452 Ga0501034_0000353 3300049571 Bacteria 79342
453 nmdc:mga03683_16844_c1 3300050489 Bacteria 2755
454 nmdc:mga03683_20885_c1 3300050489 Bacteria 2517
455 nmdc:mga00v17_91962_c1 3300050491 Bacteria 1906
456 nmdc:mga0yw44_4186_c1 3300050492 Bacteria 6247
457 nmdc:mga0k408_41768_c1 3300050493 Bacteria 2641
458 nmdc:mga06z11_4960_c1 3300050494 Bacteria 2409
459 nmdc:mga07m45_80102_c1 3300050496 Bacteria 1865
460 nmdc:mga07m45_8294_c1 3300050496 Bacteria 5334
461 Ga0500610_0000927 3300053079 Bacteria 9478
462 Ga0500578_0000086 3300053086 Bacteria 103107
463 Ga0500643_004909 3300053087 Bacteria 5889
464 Ga0500651_0000338 3300053093 Bacteria 26429
465 Ga0500566_0089066 3300053094 Bacteria 1707
466 Ga0500557_000312 3300053105 Bacteria 6465
467 Ga0500569_000738 3300053109 Bacteria 5700
468 Ga0500571_000087 3300053110 Bacteria 29151
469 Ga0500593_000084 3300053117 Bacteria 34222
470 Ga0500593_000441 3300053117 Bacteria 16355
471 Ga0500593_001716 3300053117 Bacteria 7914
472 Ga0500597_086192 3300053120 Bacteria 1363
473 Ga0500607_003436 3300053121 Bacteria 11607
474 Ga0500618_000790 3300053125 Bacteria 17674
475 Ga0500618_005721 3300053125 Bacteria 3745
476 Ga0500655_001139 3300053133 Bacteria 5062
477 Ga0500658_0001092 3300053134 Bacteria 11096
478 Ga0500658_0001599 3300053134 Bacteria 9053
479 Ga0500659_0002710 3300053135 Bacteria 10595
480 Ga0500568_0000587 3300053139 Bacteria 26463
481 Ga0500616_0000308 3300053153 Bacteria 70261
482 Ga0500616_0001233 3300053153 Bacteria 25673
483 Ga0500616_0006911 3300053153 Bacteria 7319
484 Ga0500634_0009930 3300053161 Bacteria 4842
485 Ga0500634_0027305 3300053161 Bacteria 3110
486 Ga0500636_0034147 3300053177 Bacteria 3011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0213375 Ga0495649_0213375_45_983 299
2 3300003856 Ga0058692_1000144 Ga0058692_100014410 318
3 3300005366 Ga0070659_100025112 Ga0070659_1000251123 318
4 3300027312 Ga0209371_1000001 Ga0209371_10000011280 318
5 3300030500 Ga0268256_1000001 Ga0268256_10000011361 318
6 3300047469 Ga0495673_0044004 Ga0495673_0044004_924_1940 325
7 3300046492 Ga0495585_0020176 Ga0495585_0020176_2803_3795 330
8 3300048925 Ga0496122_0032085 Ga0496122_0032085_2105_3211 332
9 3300046543 Ga0495645_0063533 Ga0495645_0063533_424_1491 333
10 3300053120 Ga0500597_086192 Ga0500597_086192_312_1343 333
11 3300046501 Ga0495607_0000021 Ga0495607_0000021_51779_52930 334
12 3300050491 nmdc:mga00v17_91962_c1 nmdc:mga00v17_91962_c1_321_1409 334
13 3300046519 Ga0495632_0015557 Ga0495632_0015557_1237_2301 335
14 3300046794 Ga0495589_0016861 Ga0495589_0016861_302_1366 335
15 3300046810 Ga0495660_0073243 Ga0495660_0073243_519_1529 335
16 3300046684 Ga0495669_0037723 Ga0495669_0037723_895_1962 336
17 3300046694 Ga0495649_0016231 Ga0495649_0016231_760_1827 336
18 3300046794 Ga0495589_0016529 Ga0495589_0016529_1447_2514 336
19 3300047323 Ga0495683_0003792 Ga0495683_0003792_3630_4697 336
20 3300005459 Ga0068867_100116053 Ga0068867_1001160531 337
21 3300005467 Ga0070706_100012987 Ga0070706_1000129876 337
22 3300005468 Ga0070707_100217118 Ga0070707_1002171182 337
23 3300005578 Ga0068854_100026272 Ga0068854_1000262723 337
24 3300006177 Ga0075362_10038201 Ga0075362_100382011 337
25 3300009093 Ga0105240_10040183 Ga0105240_100401831 337
26 3300009148 Ga0105243_10108888 Ga0105243_101088882 337
27 3300010375 Ga0105239_10018822 Ga0105239_100188222 337
28 3300025910 Ga0207684_10015012 Ga0207684_100150125 337
29 3300025933 Ga0207706_10036995 Ga0207706_100369953 337
30 3300025935 Ga0207709_10045430 Ga0207709_100454302 337
31 3300026116 Ga0207674_10078966 Ga0207674_100789662 337
32 3300031456 Ga0307513_10232792 Ga0307513_102327922 337
33 3300031730 Ga0307516_10006124 Ga0307516_100061246 337
34 3300050489 nmdc:mga03683_20885_c1 nmdc:mga03683_20885_c1_325_1404 337
35 3300050496 nmdc:mga07m45_8294_c1 nmdc:mga07m45_8294_c1_3247_4326 337
36 3300046694 Ga0495649_0001602 Ga0495649_0001602_886_1929 338
37 3300046457 Ga0495590_0013638 Ga0495590_0013638_1806_2960 339
38 3300046519 Ga0495632_0003134 Ga0495632_0003134_8611_9765 339
39 3300046694 Ga0495649_0000637 Ga0495649_0000637_6107_7261 339
40 3300005548 Ga0070665_100092444 Ga0070665_1000924443 340
41 3300006048 Ga0075363_100007382 Ga0075363_1000073825 340
42 3300006186 Ga0075369_10019565 Ga0075369_100195652 340
43 3300006353 Ga0075370_10012137 Ga0075370_100121373 340
44 3300009176 Ga0105242_10120114 Ga0105242_101201142 340
45 3300013306 Ga0163162_10000665 Ga0163162_100006658 340
46 3300013308 Ga0157375_10223087 Ga0157375_102230872 340
47 3300026067 Ga0207678_10072977 Ga0207678_100729773 340
48 3300044673 Ga0453683_0237437 Ga0453683_0237437_35_1093 340
49 3300046471 Ga0495650_0025673 Ga0495650_0025673_1713_2744 340
50 3300046474 Ga0495605_0000790 Ga0495605_0000790_21529_22560 340
51 3300046491 Ga0495584_0018419 Ga0495584_0018419_1843_2874 340
52 3300046500 Ga0495596_0020539 Ga0495596_0020539_1068_2099 340
53 3300046501 Ga0495607_0016893 Ga0495607_0016893_108_1139 340
54 3300046506 Ga0495583_0009518 Ga0495583_0009518_2623_3654 340
55 3300046523 Ga0495644_0031417 Ga0495644_0031417_709_1740 340
56 3300046530 Ga0495654_0010039 Ga0495654_0010039_2674_3726 340
57 3300046684 Ga0495669_0012052 Ga0495669_0012052_2390_3421 340
58 3300046691 Ga0495670_0013015 Ga0495670_0013015_899_1930 340
59 3300046794 Ga0495589_0000774 Ga0495589_0000774_6760_7791 340
60 3300047447 Ga0495685_006742 Ga0495685_006742_1188_2219 340
61 3300048903 Ga0496100_0006158 Ga0496100_0006158_958_1989 340
62 3300048905 Ga0496102_0100425 Ga0496102_0100425_1596_2627 340
63 3300048907 Ga0496104_0032031 Ga0496104_0032031_75_1106 340
64 3300048908 Ga0496105_0234822 Ga0496105_0234822_171_1202 340
65 3300048919 Ga0496116_0117759 Ga0496116_0117759_229_1260 340
66 3300048928 Ga0496125_0056608 Ga0496125_0056608_1742_2794 340
67 3300050489 nmdc:mga03683_16844_c1 nmdc:mga03683_16844_c1_1475_2554 340
68 3300050493 nmdc:mga0k408_41768_c1 nmdc:mga0k408_41768_c1_225_1304 340
69 3300053134 Ga0500658_0001092 Ga0500658_0001092_818_1870 340
70 3300053153 Ga0500616_0006911 Ga0500616_0006911_5703_6755 340
71 3300046689 Ga0495613_0228101 Ga0495613_0228101_250_1284 341
72 3300048927 Ga0496124_0276013 Ga0496124_0276013_80_1120 341
73 3300039447 Ga0436361_0163520 Ga0436361_0163520_968_2056 342
74 3300047443 Ga0495687_031474 Ga0495687_031474_31_1110 342
75 3300048091 Ga0495626_0060515 Ga0495626_0060515_122_1201 342
76 3300046463 Ga0495653_0000110 Ga0495653_0000110_26107_27150 343
77 3300046492 Ga0495585_0000283 Ga0495585_0000283_4359_5402 343
78 3300046492 Ga0495585_0050057 Ga0495585_0050057_334_1377 343
79 3300046507 Ga0495606_0000421 Ga0495606_0000421_26245_27288 343
80 3300046665 Ga0495661_0000013 Ga0495661_0000013_166190_167233 343
81 3300049459 Ga0495678_006919 Ga0495678_006919_3827_4870 343
82 3300048924 Ga0496121_0031960 Ga0496121_0031960_3049_4236 344
83 3300048927 Ga0496124_0000004 Ga0496124_0000004_56615_57802 344
84 3300053125 Ga0500618_005721 Ga0500618_005721_1775_2857 344
85 iso_pu_bacteria 2904434214 2904439101 344
86 iso_pu_bacteria 2919125081 2919126894 344
87 3300006038 Ga0075365_10037936 Ga0075365_100379362 345
88 3300009011 Ga0105251_10000101 Ga0105251_1000010155 345
89 3300009011 Ga0105251_10000900 Ga0105251_100009007 345
90 3300009092 Ga0105250_10000268 Ga0105250_1000026821 345
91 3300009093 Ga0105240_10185576 Ga0105240_101855762 345
92 3300013296 Ga0157374_10112930 Ga0157374_101129303 345
93 3300013306 Ga0163162_10042896 Ga0163162_100428963 345
94 3300013306 Ga0163162_10382762 Ga0163162_103827622 345
95 3300015261 Ga0182006_1007399 Ga0182006_10073993 345
96 3300025302 Ga0207426_1000851 Ga0207426_100085133 345
97 3300025711 Ga0207696_1000020 Ga0207696_1000020321 345
98 3300025735 Ga0207713_1000032 Ga0207713_100003254 345
99 3300025735 Ga0207713_1003128 Ga0207713_10031284 345
100 3300025904 Ga0207647_10143723 Ga0207647_101437231 345
101 3300025913 Ga0207695_10080303 Ga0207695_100803033 345
102 3300037471 Ga0395905_0027725 Ga0395905_0027725_1151_2236 345
103 3300045976 Ga0466967_0109771 Ga0466967_0109771_326_1411 345
104 3300046455 Ga0495603_0000130 Ga0495603_0000130_25836_26903 345
105 3300046458 Ga0495591_049239 Ga0495591_049239_81_1148 345
106 3300046459 Ga0495629_0000131 Ga0495629_0000131_14613_15680 345
107 3300046471 Ga0495650_0001356 Ga0495650_0001356_12224_13291 345
108 3300046472 Ga0495580_0003084 Ga0495580_0003084_10926_11993 345
109 3300046473 Ga0495582_0019489 Ga0495582_0019489_174_1241 345
110 3300046500 Ga0495596_0040202 Ga0495596_0040202_109_1176 345
111 3300046501 Ga0495607_0018192 Ga0495607_0018192_1907_2974 345
112 3300046506 Ga0495583_0062018 Ga0495583_0062018_454_1521 345
113 3300046507 Ga0495606_0191932 Ga0495606_0191932_45_1130 345
114 3300046515 Ga0495620_0014489 Ga0495620_0014489_47_1132 345
115 3300046516 Ga0495628_0002410 Ga0495628_0002410_8316_9383 345
116 3300046528 Ga0495642_0001197 Ga0495642_0001197_9106_10173 345
117 3300046543 Ga0495645_0039747 Ga0495645_0039747_1650_2735 345
118 3300046642 Ga0495634_0091774 Ga0495634_0091774_528_1595 345
119 3300046679 Ga0495623_0007956 Ga0495623_0007956_5337_6422 345
120 3300046679 Ga0495623_0071871 Ga0495623_0071871_798_1865 345
121 3300046680 Ga0495646_0035256 Ga0495646_0035256_1417_2484 345
122 3300046690 Ga0495624_0004662 Ga0495624_0004662_4209_5294 345
123 3300046794 Ga0495589_0014859 Ga0495589_0014859_2657_3724 345
124 3300047315 Ga0495581_0000960 Ga0495581_0000960_5703_6770 345
125 3300047320 Ga0495672_0007650 Ga0495672_0007650_2945_4012 345
126 3300047322 Ga0495680_0001202 Ga0495680_0001202_4397_5482 345
127 3300047322 Ga0495680_0110575 Ga0495680_0110575_680_1765 345
128 3300047444 Ga0495675_0063139 Ga0495675_0063139_739_1806 345
129 3300047446 Ga0495679_037916 Ga0495679_037916_204_1271 345
130 3300047469 Ga0495673_0020707 Ga0495673_0020707_504_1571 345
131 3300047470 Ga0495681_0070021 Ga0495681_0070021_117_1184 345
132 3300047472 Ga0495686_0000045 Ga0495686_0000045_38985_40052 345
133 3300047673 Ga0495593_0002305 Ga0495593_0002305_6226_7311 345
134 3300048903 Ga0496100_0004410 Ga0496100_0004410_3736_4821 345
135 3300048904 Ga0496101_0004224 Ga0496101_0004224_4028_5113 345
136 3300048904 Ga0496101_0025760 Ga0496101_0025760_868_1953 345
137 3300048904 Ga0496101_0093954 Ga0496101_0093954_957_2024 345
138 3300048905 Ga0496102_0014822 Ga0496102_0014822_4040_5125 345
139 3300048906 Ga0496103_0010732 Ga0496103_0010732_1863_2948 345
140 3300048907 Ga0496104_0112044 Ga0496104_0112044_878_1963 345
141 3300048908 Ga0496105_0025926 Ga0496105_0025926_3065_4150 345
142 3300048908 Ga0496105_0054299 Ga0496105_0054299_1769_2836 345
143 3300048909 Ga0496106_0006261 Ga0496106_0006261_6857_7942 345
144 3300048909 Ga0496106_0166502 Ga0496106_0166502_646_1713 345
145 3300048910 Ga0496107_0005634 Ga0496107_0005634_3779_4864 345
146 3300048913 Ga0496110_0050478 Ga0496110_0050478_1502_2587 345
147 3300048914 Ga0496111_0007158 Ga0496111_0007158_1729_2814 345
148 3300048915 Ga0496112_0032470 Ga0496112_0032470_1594_2679 345
149 3300048916 Ga0496113_0008848 Ga0496113_0008848_3887_4972 345
150 3300048917 Ga0496114_0004014 Ga0496114_0004014_3176_4243 345
151 3300048919 Ga0496116_0020976 Ga0496116_0020976_3620_4705 345
152 3300048920 Ga0496117_0023641 Ga0496117_0023641_349_1434 345
153 3300048921 Ga0496118_0056854 Ga0496118_0056854_1600_2685 345
154 3300048924 Ga0496121_0002169 Ga0496121_0002169_27401_28486 345
155 3300048925 Ga0496122_0016770 Ga0496122_0016770_1066_2151 345
156 3300048926 Ga0496123_0016506 Ga0496123_0016506_4090_5175 345
157 3300048928 Ga0496125_0024108 Ga0496125_0024108_2981_4066 345
158 3300048920 Ga0496117_0011794 Ga0496117_0011794_2448_3596 346
159 iso_pu_bacteria 2904479285 2904479847 346
160 3300025303 Ga0209051_1006880 Ga0209051_10068807 347
161 3300046694 Ga0495649_0043583 Ga0495649_0043583_193_1350 347
162 3300053117 Ga0500593_000441 Ga0500593_000441_5603_6679 347
163 3300009011 Ga0105251_10000659 Ga0105251_1000065910 348
164 3300027312 Ga0209371_1018037 Ga0209371_10180372 348
165 3300030500 Ga0268256_1020125 Ga0268256_10201252 348
166 3300042876 Ga0451577_0292037 Ga0451577_0292037_330_1406 348
167 3300046500 Ga0495596_0000876 Ga0495596_0000876_1038_2120 348
168 3300046524 Ga0495648_0002059 Ga0495648_0002059_12029_13111 348
169 3300046542 Ga0495597_0000087 Ga0495597_0000087_55033_56130 348
170 3300047323 Ga0495683_0006472 Ga0495683_0006472_848_1930 348
171 3300025939 Ga0207665_10154329 Ga0207665_101543292 349
172 3300042876 Ga0451577_0029453 Ga0451577_0029453_865_1941 349
173 3300046648 Ga0495611_0065802 Ga0495611_0065802_524_1600 349
174 iso_pu_bacteria 2585428057 2587729422 349
175 iso_pu_bacteria 2585428062 2587754930 349
176 iso_pu_bacteria 2588253510 2588293052 349
177 iso_pu_bacteria 2857576091 2857576839 349
178 iso_pu_bacteria 2858950400 2858950816 349
179 iso_pu_bacteria 2941479691 2941485587 349
180 3300005355 Ga0070671_100212534 Ga0070671_1002125342 350
181 3300005617 Ga0068859_100063973 Ga0068859_1000639734 350
182 3300005841 Ga0068863_100060151 Ga0068863_1000601513 350
183 3300006931 Ga0097620_100063974 Ga0097620_1000639744 350
184 3300021361 Ga0213872_10031309 Ga0213872_100313092 350
185 3300028794 Ga0307515_10000492 Ga0307515_1000049296 350
186 3300028794 Ga0307515_10000571 Ga0307515_1000057145 350
187 3300031456 Ga0307513_10013229 Ga0307513_100132292 350
188 3300031456 Ga0307513_10132353 Ga0307513_101323531 350
189 3300031649 Ga0307514_10000708 Ga0307514_1000070853 350
190 3300031731 Ga0307405_10268844 Ga0307405_102688441 350
191 3300031911 Ga0307412_10046935 Ga0307412_100469352 350
192 3300039447 Ga0436361_0456842 Ga0436361_0456842_507_1568 350
193 3300042115 Ga0450911_000247 Ga0450911_000247_4776_5867 350
194 3300048919 Ga0496116_0041603 Ga0496116_0041603_1065_2171 350
195 3300048923 Ga0496120_0011277 Ga0496120_0011277_4367_5473 350
196 3300048924 Ga0496121_0000478 Ga0496121_0000478_11626_12732 350
197 3300048924 Ga0496121_0015635 Ga0496121_0015635_4336_5427 350
198 3300048926 Ga0496123_0074480 Ga0496123_0074480_872_1978 350
199 3300048928 Ga0496125_0000146 Ga0496125_0000146_91944_93050 350
200 3300048928 Ga0496125_0053276 Ga0496125_0053276_1344_2435 350
201 3300048929 Ga0496126_0018095 Ga0496126_0018095_4462_5568 350
202 3300048929 Ga0496126_0079915 Ga0496126_0079915_455_1546 350
203 iso_pu_bacteria 2511231008 2511280457 350
204 iso_pu_bacteria 2511231021 2511353906 350
205 iso_pu_bacteria 2513237146 2513924051 350
206 iso_pu_bacteria 2599185170 2599416095 350
207 iso_pu_bacteria 2773857670 2774118941 350
208 iso_pu_bacteria 2784132072 2784312580 350
209 iso_pu_bacteria 2808606418 2809143189 350
210 iso_pu_bacteria 2818991449 2819614405 350
211 iso_pu_bacteria 2838035591 2838036217 350
212 iso_pu_bacteria 2838661181 2838666487 350
213 iso_pu_bacteria 2857542790 2857545623 350
214 iso_pu_bacteria 2904530477 2904534065 350
215 iso_pu_bacteria 2904584206 2904589094 350
216 iso_pu_bacteria 2904589729 2904590424 350
217 iso_pu_bacteria 2904601388 2904603707 350
218 iso_pu_bacteria 2919046199 2919046786 350
219 iso_pu_bacteria 2919079590 2919080287 350
220 iso_pu_bacteria 2928084124 2928084309 350
221 iso_pu_bacteria 2928130867 2928131481 350
222 iso_pu_bacteria 2933016740 2933020363 350
223 3300003751 Ga0055538_1000002 Ga0055538_1000002198 351
224 3300003752 Ga0055539_1000002 Ga0055539_1000002198 351
225 3300003756 Ga0055533_1000004 Ga0055533_1000004198 351
226 3300003759 Ga0055525_1000002 Ga0055525_1000002198 351
227 3300003841 Ga0055541_1000002 Ga0055541_1000002644 351
228 3300005262 Ga0065165_1004320 Ga0065165_10043203 351
229 3300005367 Ga0070667_100012256 Ga0070667_1000122565 351
230 3300005843 Ga0068860_100208581 Ga0068860_1002085812 351
231 3300013308 Ga0157375_10210765 Ga0157375_102107652 351
232 3300025224 Ga0209784_100002 Ga0209784_100002431 351
233 3300025225 Ga0209566_100003 Ga0209566_100003431 351
234 3300025226 Ga0209674_100004 Ga0209674_100004431 351
235 3300025230 Ga0209563_100006 Ga0209563_100006431 351
236 3300025253 Ga0209677_100003 Ga0209677_100003431 351
237 3300025273 Ga0209673_1010739 Ga0209673_10107392 351
238 3300025303 Ga0209051_1005930 Ga0209051_10059302 351
239 3300025986 Ga0207658_10008255 Ga0207658_100082555 351
240 3300028381 Ga0268264_10163972 Ga0268264_101639722 351
241 3300028786 Ga0307517_10151891 Ga0307517_101518912 351
242 3300031507 Ga0307509_10000654 Ga0307509_1000065428 351
243 3300031507 Ga0307509_10008448 Ga0307509_1000844812 351
244 3300033180 Ga0307510_10001775 Ga0307510_100017754 351
245 3300033180 Ga0307510_10040139 Ga0307510_100401392 351
246 3300046524 Ga0495648_0146777 Ga0495648_0146777_37_1113 351
247 3300053086 Ga0500578_0000086 Ga0500578_0000086_60986_62071 351
248 3300053117 Ga0500593_000084 Ga0500593_000084_14182_15255 351
249 3300005288 Ga0065714_10000082 Ga0065714_100000829 352
250 3300005288 Ga0065714_10087023 Ga0065714_100870232 352
251 3300005288 Ga0065714_10098195 Ga0065714_100981952 352
252 3300005290 Ga0065712_10020728 Ga0065712_100207281 352
253 3300005719 Ga0068861_100210297 Ga0068861_1002102972 352
254 3300006195 Ga0075366_10064282 Ga0075366_100642823 352
255 3300009011 Ga0105251_10000114 Ga0105251_1000011458 352
256 3300009011 Ga0105251_10002850 Ga0105251_1000285010 352
257 3300009176 Ga0105242_10336382 Ga0105242_103363821 352
258 3300013104 Ga0157370_10009041 Ga0157370_100090418 352
259 3300013306 Ga0163162_10075638 Ga0163162_100756382 352
260 3300015261 Ga0182006_1002816 Ga0182006_10028163 352
261 3300015262 Ga0182007_10007393 Ga0182007_100073934 352
262 3300017792 Ga0163161_10015863 Ga0163161_100158631 352
263 3300017792 Ga0163161_10044079 Ga0163161_100440792 352
264 3300025728 Ga0207655_1021552 Ga0207655_10215522 352
265 3300025728 Ga0207655_1030571 Ga0207655_10305712 352
266 3300025735 Ga0207713_1000200 Ga0207713_100020014 352
267 3300025735 Ga0207713_1021002 Ga0207713_10210023 352
268 3300026089 Ga0207648_10020423 Ga0207648_100204235 352
269 3300028794 Ga0307515_10105341 Ga0307515_101053414 352
270 3300042009 Ga0439451_020130 Ga0439451_020130_144_1253 352
271 3300042137 Ga0450902_000035 Ga0450902_000035_8619_9728 352
272 3300042137 Ga0450902_000345 Ga0450902_000345_3290_4399 352
273 3300042138 Ga0450903_001670 Ga0450903_001670_2438_3547 352
274 3300042142 Ga0450905_000968 Ga0450905_000968_1611_2720 352
275 3300046452 Ga0495617_004568 Ga0495617_004568_2374_3483 352
276 3300046452 Ga0495617_026767 Ga0495617_026767_643_1755 352
277 3300046455 Ga0495603_0000827 Ga0495603_0000827_12955_14061 352
278 3300046455 Ga0495603_0011081 Ga0495603_0011081_1214_2323 352
279 3300046455 Ga0495603_0030596 Ga0495603_0030596_2071_3183 352
280 3300046457 Ga0495590_0002504 Ga0495590_0002504_2281_3393 352
281 3300046458 Ga0495591_000453 Ga0495591_000453_13117_14232 352
282 3300046458 Ga0495591_006075 Ga0495591_006075_3949_5061 352
283 3300046458 Ga0495591_007180 Ga0495591_007180_2303_3412 352
284 3300046460 Ga0495638_0000129 Ga0495638_0000129_24574_25686 352
285 3300046460 Ga0495638_0046061 Ga0495638_0046061_773_1882 352
286 3300046463 Ga0495653_0009746 Ga0495653_0009746_2554_3663 352
287 3300046471 Ga0495650_0001340 Ga0495650_0001340_4141_5250 352
288 3300046474 Ga0495605_0052114 Ga0495605_0052114_284_1393 352
289 3300046491 Ga0495584_0000517 Ga0495584_0000517_12997_14106 352
290 3300046491 Ga0495584_0003139 Ga0495584_0003139_3986_5095 352
291 3300046492 Ga0495585_0001302 Ga0495585_0001302_4385_5494 352
292 3300046492 Ga0495585_0021200 Ga0495585_0021200_1780_2892 352
293 3300046501 Ga0495607_0005001 Ga0495607_0005001_2303_3415 352
294 3300046506 Ga0495583_0001424 Ga0495583_0001424_4364_5473 352
295 3300046512 Ga0495610_0013173 Ga0495610_0013173_2023_3132 352
296 3300046513 Ga0495616_0006786 Ga0495616_0006786_4390_5499 352
297 3300046517 Ga0495630_0032332 Ga0495630_0032332_1244_2353 352
298 3300046518 Ga0495631_0086726 Ga0495631_0086726_197_1309 352
299 3300046519 Ga0495632_0000229 Ga0495632_0000229_51428_52537 352
300 3300046519 Ga0495632_0021728 Ga0495632_0021728_1861_2973 352
301 3300046520 Ga0495637_0001388 Ga0495637_0001388_12798_13907 352
302 3300046520 Ga0495637_0002621 Ga0495637_0002621_4296_5405 352
303 3300046522 Ga0495643_0004168 Ga0495643_0004168_5870_6979 352
304 3300046522 Ga0495643_0010338 Ga0495643_0010338_978_2090 352
305 3300046523 Ga0495644_0000248 Ga0495644_0000248_4043_5155 352
306 3300046523 Ga0495644_0036155 Ga0495644_0036155_510_1619 352
307 3300046524 Ga0495648_0080664 Ga0495648_0080664_696_1808 352
308 3300046528 Ga0495642_0000024 Ga0495642_0000024_4295_5404 352
309 3300046530 Ga0495654_0004143 Ga0495654_0004143_3411_4523 352
310 3300046530 Ga0495654_0005836 Ga0495654_0005836_1355_2467 352
311 3300046530 Ga0495654_0052383 Ga0495654_0052383_264_1373 352
312 3300046536 Ga0495587_0011494 Ga0495587_0011494_2222_3331 352
313 3300046538 Ga0495609_0012039 Ga0495609_0012039_1660_2772 352
314 3300046542 Ga0495597_0011499 Ga0495597_0011499_1384_2496 352
315 3300046542 Ga0495597_0013662 Ga0495597_0013662_2471_3580 352
316 3300046557 Ga0495622_0002201 Ga0495622_0002201_3683_4789 352
317 3300046615 Ga0495656_0003448 Ga0495656_0003448_211_1320 352
318 3300046648 Ga0495611_0000967 Ga0495611_0000967_3081_4193 352
319 3300046663 Ga0495635_0084994 Ga0495635_0084994_704_1813 352
320 3300046664 Ga0495659_0004103 Ga0495659_0004103_2935_4044 352
321 3300046684 Ga0495669_0000568 Ga0495669_0000568_13481_14590 352
322 3300046691 Ga0495670_0004932 Ga0495670_0004932_1141_2253 352
323 3300046691 Ga0495670_0009461 Ga0495670_0009461_1922_3037 352
324 3300046692 Ga0495671_0000995 Ga0495671_0000995_16205_17314 352
325 3300046692 Ga0495671_0002467 Ga0495671_0002467_4039_5151 352
326 3300046692 Ga0495671_0092893 Ga0495671_0092893_130_1242 352
327 3300046694 Ga0495649_0000412 Ga0495649_0000412_4045_5157 352
328 3300046809 Ga0495600_0003625 Ga0495600_0003625_4054_5163 352
329 3300046810 Ga0495660_0004264 Ga0495660_0004264_4993_6105 352
330 3300046810 Ga0495660_0004950 Ga0495660_0004950_3911_5023 352
331 3300046810 Ga0495660_0016432 Ga0495660_0016432_1828_2937 352
332 3300046810 Ga0495660_0023656 Ga0495660_0023656_860_1969 352
333 3300047320 Ga0495672_0014016 Ga0495672_0014016_2878_3987 352
334 3300047320 Ga0495672_0054614 Ga0495672_0054614_346_1458 352
335 3300047322 Ga0495680_0003258 Ga0495680_0003258_4313_5422 352
336 3300047322 Ga0495680_0010186 Ga0495680_0010186_5263_6372 352
337 3300047323 Ga0495683_0023169 Ga0495683_0023169_891_1997 352
338 3300047323 Ga0495683_0043265 Ga0495683_0043265_542_1654 352
339 3300047323 Ga0495683_0045977 Ga0495683_0045977_991_2100 352
340 3300047444 Ga0495675_0001160 Ga0495675_0001160_10584_11693 352
341 3300047445 Ga0495677_0002281 Ga0495677_0002281_4462_5571 352
342 3300047446 Ga0495679_032664 Ga0495679_032664_494_1603 352
343 3300047469 Ga0495673_0015526 Ga0495673_0015526_38_1156 352
344 3300047470 Ga0495681_0007412 Ga0495681_0007412_84_1193 352
345 3300047470 Ga0495681_0055665 Ga0495681_0055665_170_1279 352
346 3300047673 Ga0495593_0002097 Ga0495593_0002097_7631_8740 352
347 3300048089 Ga0495614_0089265 Ga0495614_0089265_80_1186 352
348 3300048913 Ga0496110_0202129 Ga0496110_0202129_107_1213 352
349 3300048914 Ga0496111_0063328 Ga0496111_0063328_1552_2664 352
350 3300048914 Ga0496111_0113421 Ga0496111_0113421_289_1395 352
351 3300048921 Ga0496118_0019324 Ga0496118_0019324_2439_3554 352
352 3300048924 Ga0496121_0003781 Ga0496121_0003781_9017_10132 352
353 3300048925 Ga0496122_0001544 Ga0496122_0001544_9912_11027 352
354 3300048926 Ga0496123_0000432 Ga0496123_0000432_64704_65819 352
355 3300048927 Ga0496124_0013134 Ga0496124_0013134_5498_6610 352
356 3300048927 Ga0496124_0081505 Ga0496124_0081505_1209_2315 352
357 3300048928 Ga0496125_0006650 Ga0496125_0006650_4065_5171 352
358 3300049459 Ga0495678_004938 Ga0495678_004938_4065_5177 352
359 3300049571 Ga0501034_0000353 Ga0501034_0000353_4002_5114 352
360 3300053135 Ga0500659_0002710 Ga0500659_0002710_3864_4976 352
361 iso_pu_bacteria 2511231003 2511249039 352
362 iso_pu_bacteria 2548876994 2550696000 352
363 iso_pu_bacteria 2818991445 2819593500 352
364 iso_pu_bacteria 2884811622 2884816523 352
365 iso_pu_bacteria 2884836552 2884837729 352
366 iso_pu_bacteria 2884852848 2884854021 352
367 iso_pu_bacteria 2896154374 2896154862 352
368 3300006177 Ga0075362_10033262 Ga0075362_100332622 353
369 3300014968 Ga0157379_10016569 Ga0157379_100165693 353
370 3300028794 Ga0307515_10000492 Ga0307515_1000049297 353
371 3300031730 Ga0307516_10053150 Ga0307516_100531502 353
372 3300041456 Ga0451795_1074212 Ga0451795_1074212_51_1136 353
373 3300044683 Ga0466965_0064287 Ga0466965_0064287_500_1585 353
374 3300044901 Ga0466960_0038620 Ga0466960_0038620_1111_2196 353
375 3300046519 Ga0495632_0005181 Ga0495632_0005181_5582_6667 353
376 3300046660 Ga0495625_0004068 Ga0495625_0004068_12088_13173 353
377 3300046683 Ga0495658_0065593 Ga0495658_0065593_979_2064 353
378 3300047472 Ga0495686_0075378 Ga0495686_0075378_676_1761 353
379 3300048905 Ga0496102_0025839 Ga0496102_0025839_936_2021 353
380 3300050496 nmdc:mga07m45_80102_c1 nmdc:mga07m45_80102_c1_306_1391 353
381 iso_pu_bacteria 2510917026 2511169760 353
382 iso_pu_bacteria 2510917028 2511183908 353
383 iso_pu_bacteria 2894652903 2894656872 353
384 3300002704 JGI25155J39150_1000432 JGI25155J39150_10004322 354
385 3300002704 JGI25155J39150_1000469 JGI25155J39150_10004693 354
386 3300002705 JGI25156J39149_1001147 JGI25156J39149_100114710 354
387 3300002705 JGI25156J39149_1001292 JGI25156J39149_10012928 354
388 3300002738 JGI25154J39366_1000961 JGI25154J39366_10009612 354
389 3300002738 JGI25154J39366_1001064 JGI25154J39366_10010648 354
390 3300002741 JGI25157J39369_1000990 JGI25157J39369_10009909 354
391 3300003758 Ga0055532_1000102 Ga0055532_10001024 354
392 3300003761 Ga0055535_1003187 Ga0055535_10031874 354
393 3300005456 Ga0070678_100018058 Ga0070678_1000180583 354
394 3300005539 Ga0068853_100050351 Ga0068853_1000503513 354
395 3300005563 Ga0068855_100109586 Ga0068855_1001095864 354
396 3300005616 Ga0068852_100061870 Ga0068852_1000618701 354
397 3300009036 Ga0105244_10064484 Ga0105244_100644842 354
398 3300009093 Ga0105240_10006815 Ga0105240_100068157 354
399 3300009093 Ga0105240_10063805 Ga0105240_100638052 354
400 3300009545 Ga0105237_10000564 Ga0105237_1000056416 354
401 3300009551 Ga0105238_10019161 Ga0105238_100191612 354
402 3300010375 Ga0105239_10005868 Ga0105239_1000586811 354
403 3300017792 Ga0163161_10092736 Ga0163161_100927362 354
404 3300025206 Ga0209435_100030 Ga0209435_100030152 354
405 3300025206 Ga0209435_100134 Ga0209435_10013425 354
406 3300025229 Ga0209147_100159 Ga0209147_10015973 354
407 3300025233 Ga0209437_100317 Ga0209437_1003177 354
408 3300025242 Ga0209258_100259 Ga0209258_10025973 354
409 3300025246 Ga0209646_1000057 Ga0209646_10000573 354
410 3300025246 Ga0209646_1000100 Ga0209646_1000100152 354
411 3300025250 Ga0209026_1000091 Ga0209026_10000914 354
412 3300025256 Ga0209759_1000084 Ga0209759_1000084150 354
413 3300025256 Ga0209759_1000141 Ga0209759_10001413 354
414 3300025272 Ga0209455_1008345 Ga0209455_10083453 354
415 3300025913 Ga0207695_10005698 Ga0207695_1000569812 354
416 3300025913 Ga0207695_10060576 Ga0207695_100605762 354
417 3300025914 Ga0207671_10006250 Ga0207671_1000625012 354
418 3300025924 Ga0207694_10026948 Ga0207694_100269482 354
419 3300025933 Ga0207706_10215203 Ga0207706_102152032 354
420 3300026121 Ga0207683_10031236 Ga0207683_100312362 354
421 3300026142 Ga0207698_10044170 Ga0207698_100441704 354
422 3300026142 Ga0207698_10119392 Ga0207698_101193921 354
423 3300028794 Ga0307515_10132008 Ga0307515_101320082 354
424 3300031456 Ga0307513_10123405 Ga0307513_101234052 354
425 3300041413 Ga0439465_0004220 Ga0439465_0004220_1301_2365 354
426 3300046512 Ga0495610_0048013 Ga0495610_0048013_83_1177 354
427 3300046513 Ga0495616_0006880 Ga0495616_0006880_3922_5016 354
428 3300046530 Ga0495654_0106488 Ga0495654_0106488_70_1158 354
429 3300046660 Ga0495625_0001843 Ga0495625_0001843_13087_14175 354
430 3300046674 Ga0495588_0107541 Ga0495588_0107541_336_1430 354
431 3300046683 Ga0495658_0059223 Ga0495658_0059223_231_1325 354
432 3300046692 Ga0495671_0044243 Ga0495671_0044243_545_1639 354
433 3300047321 Ga0495676_0027229 Ga0495676_0027229_1466_2560 354
434 3300047673 Ga0495593_0017702 Ga0495593_0017702_877_1971 354
435 3300048919 Ga0496116_0007831 Ga0496116_0007831_3435_4523 354
436 3300048924 Ga0496121_0009279 Ga0496121_0009279_8229_9317 354
437 3300048924 Ga0496121_0039492 Ga0496121_0039492_3013_4107 354
438 3300048925 Ga0496122_0000748 Ga0496122_0000748_57356_58444 354
439 3300048926 Ga0496123_0001196 Ga0496123_0001196_4848_5936 354
440 3300048926 Ga0496123_0037366 Ga0496123_0037366_327_1421 354
441 3300048928 Ga0496125_0007191 Ga0496125_0007191_9462_10550 354
442 3300048929 Ga0496126_0113381 Ga0496126_0113381_1230_2324 354
443 3300053079 Ga0500610_0000927 Ga0500610_0000927_2727_3821 354
444 3300053087 Ga0500643_004909 Ga0500643_004909_810_1904 354
445 3300053093 Ga0500651_0000338 Ga0500651_0000338_18515_19609 354
446 3300053094 Ga0500566_0089066 Ga0500566_0089066_460_1554 354
447 3300053110 Ga0500571_000087 Ga0500571_000087_10931_12025 354
448 3300053117 Ga0500593_001716 Ga0500593_001716_1108_2202 354
449 3300053121 Ga0500607_003436 Ga0500607_003436_3411_4505 354
450 3300053133 Ga0500655_001139 Ga0500655_001139_3622_4716 354
451 3300053134 Ga0500658_0001599 Ga0500658_0001599_801_1895 354
452 3300053161 Ga0500634_0009930 Ga0500634_0009930_1054_2148 354
453 3300053161 Ga0500634_0027305 Ga0500634_0027305_443_1537 354
454 iso_pu_bacteria 2510917022 2511132226 354
455 iso_pu_bacteria 2511231027 2511390974 354
456 iso_pu_bacteria 2513237138 2513867214 354
457 iso_pu_bacteria 2582581294 2585204694 354
458 iso_pu_bacteria 2582581316 2585334464 354
459 iso_pu_bacteria 2582581867 2585402603 354
460 iso_pu_bacteria 2585427531 2585560958 354
461 iso_pu_bacteria 2585427590 2585820472 354
462 iso_pu_bacteria 2585427608 2585899833 354
463 iso_pu_bacteria 2585427609 2585908455 354
464 iso_pu_bacteria 2585428125 2587983509 354
465 iso_pu_bacteria 2615840698 2616557503 354
466 iso_pu_bacteria 2617270742 2617385280 354
467 iso_pu_bacteria 2643221643 2644237777 354
468 iso_pu_bacteria 2751185821 2753459220 354
469 iso_pu_bacteria 2767802442 2770200212 354
470 iso_pu_bacteria 2775506902 2776268751 354
471 iso_pu_bacteria 2775506904 2776285131 354
472 iso_pu_bacteria 2840764183 2840770426 354
473 iso_pu_bacteria 2842871566 2842874302 354
474 iso_pu_bacteria 2850079185 2850083620 354
475 iso_pu_bacteria 2904578770 2904583673 354
476 iso_pu_bacteria 2919119836 2919124814 354
477 iso_pu_bacteria 2919408235 2919413497 354
478 iso_pu_bacteria 2920760137 2920762031 354
479 iso_pu_bacteria 2954011201 2954011631 354
480 iso_pu_bacteria 8005484373 8005486451 354
481 iso_pu_bacteria 8005682033 8005685638 354
482 iso_pu_bacteria 8018150411 8018153858 354
483 iso_pu_bacteria 8057575449 8057576224 354
484 iso_pu_bacteria 2513237087 2513589772 356
485 iso_pu_bacteria 2547132374 2548498690 356
486 iso_pu_bacteria 2643221717 2644649422 356
487 3300006038 Ga0075365_10006192 Ga0075365_100061924 357
488 3300006186 Ga0075369_10000377 Ga0075369_100003775 357
489 3300050492 nmdc:mga0yw44_4186_c1 nmdc:mga0yw44_4186_c1_2216_3289 357
490 3300053153 Ga0500616_0000308 Ga0500616_0000308_10764_11849 357
491 3300001979 JGI24740J21852_10000424 JGI24740J21852_1000042410 358
492 3300002737 JGI25162J39368_1000356 JGI25162J39368_10003564 358
493 3300002773 JGI25152J39213_1003697 JGI25152J39213_10036974 358
494 3300002773 JGI25152J39213_1008691 JGI25152J39213_10086912 358
495 3300002987 JGI25159J45721_1002018 JGI25159J45721_10020186 358
496 3300003187 JGI25151J46595_10000625 JGI25151J46595_100006258 358
497 3300003214 JGI25165J46597_1000450 JGI25165J46597_10004506 358
498 3300003354 JGI25160J50197_1000018 JGI25160J50197_1000018183 358
499 3300003374 JGI25161J50226_1000020 JGI25161J50226_100002045 358
500 3300003771 Ga0055526_1025242 Ga0055526_10252422 358
501 3300003771 Ga0055526_1029305 Ga0055526_10293051 358
502 3300003790 Ga0055528_1000273 Ga0055528_100027331 358
503 3300003790 Ga0055528_1013773 Ga0055528_10137732 358
504 3300003792 Ga0055540_1026204 Ga0055540_10262041 358
505 3300004625 Ga0055543_1000004 Ga0055543_1000004184 358
506 3300005262 Ga0065165_1000429 Ga0065165_100042920 358
507 3300005347 Ga0070668_100337278 Ga0070668_1003372781 358
508 3300005355 Ga0070671_100062170 Ga0070671_1000621702 358
509 3300005455 Ga0070663_100068038 Ga0070663_1000680382 358
510 3300006042 Ga0075368_10020547 Ga0075368_100205473 358
511 3300006178 Ga0075367_10000621 Ga0075367_100006216 358
512 3300009011 Ga0105251_10039735 Ga0105251_100397352 358
513 3300009177 Ga0105248_10511151 Ga0105248_105111512 358
514 3300009553 Ga0105249_10242913 Ga0105249_102429132 358
515 3300009766 Ga0123342_1020141 Ga0123342_10201413 358
516 3300014325 Ga0163163_10368378 Ga0163163_103683781 358
517 3300025233 Ga0209437_100286 Ga0209437_10028634 358
518 3300025254 Ga0209148_1005591 Ga0209148_10055913 358
519 3300025258 Ga0209129_1000182 Ga0209129_100018234 358
520 3300025258 Ga0209129_1003600 Ga0209129_10036006 358
521 3300025261 Ga0209233_1000249 Ga0209233_100024942 358
522 3300025273 Ga0209673_1000691 Ga0209673_100069115 358
523 3300025284 Ga0209130_1000035 Ga0209130_100003543 358
524 3300025294 Ga0209025_1000461 Ga0209025_100046134 358
525 3300025295 Ga0209564_1002222 Ga0209564_100222215 358
526 3300025295 Ga0209564_1015018 Ga0209564_10150182 358
527 3300025297 Ga0209758_1029740 Ga0209758_10297401 358
528 3300025299 Ga0209256_1000648 Ga0209256_100064817 358
529 3300025302 Ga0207426_1000017 Ga0207426_100001743 358
530 3300025302 Ga0207426_1001839 Ga0207426_10018398 358
531 3300025303 Ga0209051_1000932 Ga0209051_100093225 358
532 3300031911 Ga0307412_10010053 Ga0307412_100100532 358
533 3300046460 Ga0495638_0000163 Ga0495638_0000163_82246_83322 358
534 3300046474 Ga0495605_0001903 Ga0495605_0001903_814_1890 358
535 3300046506 Ga0495583_0025577 Ga0495583_0025577_798_1874 358
536 3300046515 Ga0495620_0059236 Ga0495620_0059236_363_1439 358
537 3300046616 Ga0495668_0004657 Ga0495668_0004657_5372_6448 358
538 3300046660 Ga0495625_0013786 Ga0495625_0013786_3933_5009 358
539 3300046691 Ga0495670_0078157 Ga0495670_0078157_570_1646 358
540 3300048905 Ga0496102_0078191 Ga0496102_0078191_1163_2239 358
541 3300048907 Ga0496104_0002548 Ga0496104_0002548_12650_13726 358
542 3300048908 Ga0496105_0007903 Ga0496105_0007903_1131_2207 358
543 3300048913 Ga0496110_0029915 Ga0496110_0029915_1722_2798 358
544 3300048915 Ga0496112_0343842 Ga0496112_0343842_224_1300 358
545 3300048916 Ga0496113_0010853 Ga0496113_0010853_2932_4008 358
546 3300048919 Ga0496116_0007962 Ga0496116_0007962_1865_2941 358
547 3300048922 Ga0496119_0009017 Ga0496119_0009017_1694_2770 358
548 3300048924 Ga0496121_0154606 Ga0496121_0154606_367_1443 358
549 3300048926 Ga0496123_0016224 Ga0496123_0016224_2141_3217 358
550 3300048927 Ga0496124_0014294 Ga0496124_0014294_5396_6472 358
551 3300048928 Ga0496125_0034410 Ga0496125_0034410_2524_3600 358
552 3300048929 Ga0496126_0057911 Ga0496126_0057911_983_2059 358
553 3300050494 nmdc:mga06z11_4960_c1 nmdc:mga06z11_4960_c1_618_1694 358
554 3300053105 Ga0500557_000312 Ga0500557_000312_2394_3470 358
555 3300053109 Ga0500569_000738 Ga0500569_000738_2772_3848 358
556 3300053125 Ga0500618_000790 Ga0500618_000790_14945_16021 358
557 3300053139 Ga0500568_0000587 Ga0500568_0000587_20029_21105 358
558 3300053153 Ga0500616_0001233 Ga0500616_0001233_4568_5644 358
559 3300053177 Ga0500636_0034147 Ga0500636_0034147_240_1316 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

60

256

0.88

PF13379

NMT1_2

NMT1-like family

48

265

0.84

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

70

245

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uif-assembly1.cif.gz_A crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt 0.8845 28 350
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8656 28 330
3uif-assembly1.cif.gz_A crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt 0.8647 28 350
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8546 28 330
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8175 29 327
ID Description Score Start End Superfamily
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.959 124 224 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9411 124 224 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9204 126 218 3.40.190.10
3uifA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8847 28 350 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8646 125 213 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1I4IA24-F1-model_v4 Sulfonate transport system substrate-binding protein 0.9536 232 358
AF-A0A561L3T3-F1-model_v4 deleted 0.9524 24 358
AF-A0A561L3T3-F1-model_v4 deleted 0.9469 24 358
AF-A0A3S0YIY9-F1-model_v4 deleted 0.9425 23 336
AF-A0A7K1PMB1-F1-model_v4 deleted 0.9371 1 358

Feature Viewer

pLDDT pTM Quality
91.05 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map