F463541

General Info

Members Datasets Scaffolds Average Seq Length
559 298 539 246

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100177921|Ga0068867_1001779212
Length 277
Sequence MALLQNRVGSAARACYRRLAWGVTKGEATVTISADQKDFDSSAVLGLREDLALALRAAALHGFAEGVCNHFSVELPDGSGRFLLNPRGLLWSEVHAGDIVLVDARGRTLAGRHPVEPTAMFIHGAIHRLGRKACVLHTHMPYATALTLTADRALDTTLSQNAMRFHGRVAVDANYNGLALDASEGERIATAMGGADVVFLGNHGIVVCGERMAHAYDDLYYLERACMAQVLAQSTGRPLVPVSASIAERVRDQTLGDRLQSELFFEALRRGTNVREK

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
6 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
7 2643221569 Achromobacter sp. Root565 Isolate Unclassified
8 2643221594 Achromobacter sp. Root170 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2643221660 Methylibium sp. Root1272 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
14 2816332133 Acidovorax radicis 2721A Isolate Unclassified
15 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
16 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
17 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
18 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
202 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
205 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
290 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
294 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
295 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
296 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
297 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
298 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 0
Isolates 3.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.55
Nodule 0
Rhizoplane 4.29
Rhizosphere 83.01
Stem 0
Stem Tuber 0
Unclassified 7.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10092629 3300003316 Bacteria 1196
2 rootH1_10092629 3300003323 Bacteria 4461
3 Ga0055538_1000016 3300003751 Bacteria 305460
4 Ga0055539_1000021 3300003752 Bacteria 305460
5 Ga0055533_1000029 3300003756 Bacteria 305460
6 Ga0055525_1000033 3300003759 Bacteria 305460
7 Ga0055526_1000408 3300003771 Bacteria 34699
8 Ga0055540_1011166 3300003792 Bacteria 2923
9 Ga0055531_10000335 3300003794 Bacteria 46442
10 Ga0055541_1000029 3300003841 Bacteria 199874
11 Ga0070658_10016034 3300005327 Bacteria 5993
12 Ga0070658_10019434 3300005327 Bacteria 5440
13 Ga0070676_10006948 3300005328 Bacteria 6060
14 Ga0070676_10024066 3300005328 Bacteria 3427
15 Ga0070676_10284427 3300005328 Bacteria 1115
16 Ga0070683_100063997 3300005329 Bacteria 3422
17 Ga0070683_100297509 3300005329 Bacteria 1535
18 Ga0070690_100105668 3300005330 Bacteria 1872
19 Ga0070670_100004394 3300005331 Bacteria 11799
20 Ga0070670_100017775 3300005331 Bacteria 6101
21 Ga0070670_100031309 3300005331 Bacteria 4581
22 Ga0070670_100289376 3300005331 Bacteria 1431
23 Ga0070670_100651970 3300005331 Bacteria 944
24 Ga0070677_10042718 3300005333 Bacteria 1797
25 Ga0070666_10038023 3300005335 Bacteria 3201
26 Ga0068868_100001385 3300005338 Bacteria 16726
27 Ga0068868_100014265 3300005338 Bacteria 5853
28 Ga0068868_100126118 3300005338 Bacteria 2091
29 Ga0070660_100537093 3300005339 Bacteria 975
30 Ga0070689_100003084 3300005340 Bacteria 10987
31 Ga0070687_100038672 3300005343 Bacteria 2393
32 Ga0070661_100028113 3300005344 Bacteria 4055
33 Ga0070661_100099626 3300005344 Bacteria 2160
34 Ga0070661_100231958 3300005344 Bacteria 1419
35 Ga0070661_100300839 3300005344 Bacteria 1249
36 Ga0070668_100032340 3300005347 Bacteria 3981
37 Ga0070668_100086213 3300005347 Bacteria 2469
38 Ga0070669_100022316 3300005353 Bacteria 4527
39 Ga0070669_100160686 3300005353 Bacteria 1746
40 Ga0070669_100356796 3300005353 Bacteria 1188
41 Ga0070669_100730641 3300005353 Bacteria 838
42 Ga0070675_100002237 3300005354 Bacteria 14365
43 Ga0070675_100072998 3300005354 Bacteria 2849
44 Ga0070675_100111985 3300005354 Bacteria 2310
45 Ga0070675_100227014 3300005354 Bacteria 1628
46 Ga0070671_100002046 3300005355 Bacteria 15549
47 Ga0070671_100007253 3300005355 Bacteria 8858
48 Ga0070671_100007782 3300005355 Bacteria 8561
49 Ga0070671_100034530 3300005355 Bacteria 4186
50 Ga0070671_100039987 3300005355 Bacteria 3893
51 Ga0070671_100156273 3300005355 Bacteria 1926
52 Ga0070671_100248283 3300005355 Bacteria 1511
53 Ga0070674_100287163 3300005356 Bacteria 1306
54 Ga0070673_100000208 3300005364 Bacteria 29093
55 Ga0070673_100002957 3300005364 Bacteria 10477
56 Ga0070673_100304102 3300005364 Bacteria 1405
57 Ga0070659_100028935 3300005366 Bacteria 4280
58 Ga0070659_100046790 3300005366 Bacteria 3391
59 Ga0070659_100058732 3300005366 Bacteria 3037
60 Ga0070667_100001443 3300005367 Bacteria 21318
61 Ga0070667_100028473 3300005367 Bacteria 4652
62 Ga0070667_100051670 3300005367 Bacteria 3466
63 Ga0070667_100077966 3300005367 Bacteria 2830
64 Ga0070667_100089875 3300005367 Bacteria 2639
65 Ga0070667_100415582 3300005367 Bacteria 1226
66 Ga0070667_100548377 3300005367 Bacteria 1062
67 Ga0070663_100002679 3300005455 Bacteria 10080
68 Ga0070663_100011120 3300005455 Bacteria 5636
69 Ga0070678_100001789 3300005456 Bacteria 11580
70 Ga0070678_100006265 3300005456 Bacteria 6964
71 Ga0070678_100042065 3300005456 Bacteria 3244
72 Ga0070678_100220659 3300005456 Bacteria 1576
73 Ga0070662_100095082 3300005457 Bacteria 2245
74 Ga0068867_100022691 3300005459 Bacteria 4489
75 Ga0068867_100030684 3300005459 Bacteria 3877
76 Ga0068867_100139498 3300005459 Bacteria 1894
77 Ga0068867_100177921 3300005459 Bacteria 1689
78 Ga0070685_10123730 3300005466 Bacteria 1609
79 Ga0070679_100035171 3300005530 Bacteria 4969
80 Ga0070684_100004382 3300005535 Bacteria 10733
81 Ga0070684_100110198 3300005535 Bacteria 2468
82 Ga0068853_100045216 3300005539 Bacteria 3770
83 Ga0068853_100087443 3300005539 Bacteria 2735
84 Ga0068853_100091842 3300005539 Bacteria 2670
85 Ga0068853_100139656 3300005539 Bacteria 2174
86 Ga0068853_100219463 3300005539 Bacteria 1736
87 Ga0070672_100004392 3300005543 Bacteria 9238
88 Ga0070672_100015337 3300005543 Bacteria 5454
89 Ga0070672_100036554 3300005543 Bacteria 3742
90 Ga0070672_100074470 3300005543 Bacteria 2708
91 Ga0070672_100152265 3300005543 Bacteria 1914
92 Ga0070672_100307617 3300005543 Bacteria 1344
93 Ga0070672_100349897 3300005543 Bacteria 1259
94 Ga0070693_100119656 3300005547 Bacteria 1631
95 Ga0070665_100008015 3300005548 Bacteria 10701
96 Ga0070665_100208744 3300005548 Bacteria 1953
97 Ga0070665_100281548 3300005548 Bacteria 1665
98 Ga0070664_100094229 3300005564 Bacteria 2596
99 Ga0070664_100247488 3300005564 Bacteria 1602
100 Ga0070664_100324605 3300005564 Bacteria 1395
101 Ga0068857_100072028 3300005577 Bacteria 3080
102 Ga0068854_100015002 3300005578 Bacteria 5121
103 Ga0068854_100018839 3300005578 Bacteria 4640
104 Ga0068854_100021579 3300005578 Bacteria 4371
105 Ga0068854_100023928 3300005578 Bacteria 4176
106 Ga0068856_100009207 3300005614 Bacteria 9600
107 Ga0070702_100086493 3300005615 Bacteria 1891
108 Ga0068852_100029414 3300005616 Bacteria 4514
109 Ga0068852_100054609 3300005616 Bacteria 3444
110 Ga0068852_100067300 3300005616 Bacteria 3131
111 Ga0068852_100072431 3300005616 Bacteria 3028
112 Ga0068852_100233983 3300005616 Bacteria 1753
113 Ga0068852_100372871 3300005616 Bacteria 1398
114 Ga0068852_100488571 3300005616 Bacteria 1224
115 Ga0068859_100001157 3300005617 Bacteria 26939
116 Ga0068859_100407259 3300005617 Bacteria 1456
117 Ga0068859_100615070 3300005617 Bacteria 1179
118 Ga0068864_100000432 3300005618 Bacteria 36300
119 Ga0068864_100009444 3300005618 Bacteria 8049
120 Ga0068864_100011831 3300005618 Bacteria 7206
121 Ga0068864_100176567 3300005618 Bacteria 1950
122 Ga0068861_100004167 3300005719 Bacteria 9694
123 Ga0068861_100011766 3300005719 Bacteria 6090
124 Ga0068851_10001036 3300005834 Bacteria 12077
125 Ga0068851_10014446 3300005834 Bacteria 3749
126 Ga0068851_10049712 3300005834 Bacteria 2128
127 Ga0068851_10079137 3300005834 Bacteria 1714
128 Ga0068863_100027731 3300005841 Bacteria 5404
129 Ga0068863_100113712 3300005841 Bacteria 2579
130 Ga0068863_100217820 3300005841 Bacteria 1839
131 Ga0068863_100625307 3300005841 Bacteria 1067
132 Ga0068858_100000549 3300005842 Bacteria 39106
133 Ga0068858_100002508 3300005842 Bacteria 18515
134 Ga0068858_100046238 3300005842 Bacteria 4036
135 Ga0068860_100003936 3300005843 Bacteria 15254
136 Ga0068860_100103108 3300005843 Bacteria 2723
137 Ga0068862_100076289 3300005844 Bacteria 2901
138 Ga0068862_100105522 3300005844 Bacteria 2469
139 Ga0070716_100140491 3300006173 Unclassified 1539
140 Ga0070712_100090350 3300006175 Bacteria 2242
141 Ga0075366_10054780 3300006195 Bacteria 2369
142 Ga0097621_100008406 3300006237 Bacteria 7430
143 Ga0097621_100009597 3300006237 Bacteria 7033
144 Ga0097621_100103538 3300006237 Bacteria 2398
145 Ga0097621_100144796 3300006237 Bacteria 2033
146 Ga0068871_100005853 3300006358 Bacteria 8644
147 Ga0068871_100016873 3300006358 Bacteria 5512
148 Ga0068871_100030632 3300006358 Bacteria 4238
149 Ga0068871_100057469 3300006358 Bacteria 3165
150 Ga0068871_100176778 3300006358 Bacteria 1833
151 Ga0075430_100026829 3300006846 Bacteria 4899
152 Ga0075429_100001715 3300006880 Bacteria 18129
153 Ga0068865_100034337 3300006881 Bacteria 3403
154 Ga0068865_100215130 3300006881 Bacteria 1500
155 Ga0068865_100493437 3300006881 Bacteria 1020
156 Ga0097620_100001157 3300006931 Bacteria 26939
157 Ga0097620_100407242 3300006931 Bacteria 1456
158 Ga0097620_100615222 3300006931 Bacteria 1179
159 Ga0111539_10755944 3300009094 Bacteria 1131
160 Ga0105245_10175746 3300009098 Bacteria 2042
161 Ga0105247_10226814 3300009101 Bacteria 1267
162 Ga0114129_10444761 3300009147 Bacteria 1701
163 Ga0105243_10146760 3300009148 Bacteria 2019
164 Ga0105241_10035170 3300009174 Bacteria 3768
165 Ga0105242_10112890 3300009176 Bacteria 2320
166 Ga0105242_10255215 3300009176 Bacteria 1582
167 Ga0105248_10000698 3300009177 Bacteria 37914
168 Ga0105248_10004078 3300009177 Bacteria 16151
169 Ga0105248_10016947 3300009177 Bacteria 8022
170 Ga0105248_10026399 3300009177 Bacteria 6460
171 Ga0105248_10031309 3300009177 Bacteria 5945
172 Ga0105248_10438334 3300009177 Bacteria 1472
173 Ga0105238_10014746 3300009551 Bacteria 7904
174 Ga0105249_10152658 3300009553 Bacteria 2225
175 Ga0105239_10037691 3300010375 Bacteria 5297
176 Ga0157371_10053995 3300013102 Bacteria 2854
177 Ga0157371_10204576 3300013102 Bacteria 1416
178 Ga0157370_10036973 3300013104 Bacteria 4736
179 Ga0157369_10128772 3300013105 Bacteria 2682
180 Ga0157374_10011772 3300013296 Bacteria 7588
181 Ga0157374_10028148 3300013296 Bacteria 5076
182 Ga0157374_10118105 3300013296 Bacteria 2557
183 Ga0157374_10121915 3300013296 Bacteria 2517
184 Ga0157374_10292886 3300013296 Bacteria 1609
185 Ga0157378_10615805 3300013297 Bacteria 1098
186 Ga0163162_10002262 3300013306 Bacteria 18081
187 Ga0163162_10012488 3300013306 Bacteria 8298
188 Ga0163162_10022159 3300013306 Bacteria 6261
189 Ga0163162_10137354 3300013306 Bacteria 2556
190 Ga0163162_10262341 3300013306 Bacteria 1859
191 Ga0157372_10011197 3300013307 Bacteria 9541
192 Ga0157372_10011573 3300013307 Bacteria 9388
193 Ga0157375_10006005 3300013308 Bacteria 10587
194 Ga0157375_10008130 3300013308 Bacteria 9179
195 Ga0157375_10147915 3300013308 Bacteria 2481
196 Ga0157375_10185609 3300013308 Bacteria 2233
197 Ga0157375_10187261 3300013308 Bacteria 2224
198 Ga0163163_10003225 3300014325 Bacteria 13825
199 Ga0163163_10180720 3300014325 Bacteria 2157
200 Ga0163163_10331047 3300014325 Bacteria 1577
201 Ga0157380_10004233 3300014326 Bacteria 9926
202 Ga0157380_10205266 3300014326 Bacteria 1752
203 Ga0157377_10022596 3300014745 Bacteria 3323
204 Ga0157377_10249070 3300014745 Bacteria 1150
205 Ga0157379_10002944 3300014968 Bacteria 14368
206 Ga0157379_10015400 3300014968 Bacteria 6708
207 Ga0157376_10009366 3300014969 Bacteria 7112
208 Ga0157376_10047096 3300014969 Bacteria 3559
209 Ga0182007_10001352 3300015262 Bacteria 13221
210 Ga0182005_1040114 3300015265 Bacteria 1273
211 Ga0213872_10069294 3300021361 Bacteria 1591
212 Ga0213874_10021415 3300021377 Bacteria 1783
213 Ga0213876_10165026 3300021384 Bacteria 1178
214 Ga0209784_100033 3300025224 Bacteria 305649
215 Ga0209566_100037 3300025225 Bacteria 305649
216 Ga0209674_100055 3300025226 Bacteria 305649
217 Ga0209563_100056 3300025230 Bacteria 305649
218 Ga0209677_100034 3300025253 Bacteria 305649
219 Ga0209759_1000085 3300025256 Bacteria 168382
220 Ga0209673_1015460 3300025273 Bacteria 2899
221 Ga0209676_1007163 3300025292 Bacteria 5320
222 Ga0209564_1000192 3300025295 Bacteria 142456
223 Ga0209050_1002492 3300025298 Bacteria 15567
224 Ga0209051_1000406 3300025303 Bacteria 59626
225 Ga0209051_1005054 3300025303 Bacteria 7852
226 Ga0209257_1000012 3300025304 Bacteria 1111138
227 Ga0207697_10021644 3300025315 Bacteria 2633
228 Ga0207656_10001964 3300025321 Bacteria 6841
229 Ga0207656_10015358 3300025321 Bacteria 2963
230 Ga0207682_10002757 3300025893 Bacteria 7782
231 Ga0207682_10027124 3300025893 Bacteria 2280
232 Ga0207682_10033308 3300025893 Bacteria 2074
233 Ga0207682_10034606 3300025893 Bacteria 2037
234 Ga0207682_10047669 3300025893 Bacteria 1765
235 Ga0207642_10155595 3300025899 Bacteria 1222
236 Ga0207642_10256240 3300025899 Bacteria 995
237 Ga0207688_10055828 3300025901 Bacteria 2218
238 Ga0207688_10109961 3300025901 Bacteria 1599
239 Ga0207680_10044296 3300025903 Bacteria 2616
240 Ga0207680_10064677 3300025903 Bacteria 2243
241 Ga0207680_10192416 3300025903 Bacteria 1385
242 Ga0207645_10029110 3300025907 Bacteria 3561
243 Ga0207645_10149246 3300025907 Bacteria 1525
244 Ga0207645_10189694 3300025907 Bacteria 1350
245 Ga0207654_10047274 3300025911 Bacteria 2458
246 Ga0207695_10356719 3300025913 Bacteria 1349
247 Ga0207660_10081127 3300025917 Bacteria 2383
248 Ga0207662_10114837 3300025918 Bacteria 1682
249 Ga0207657_10009270 3300025919 Bacteria 9915
250 Ga0207649_10104243 3300025920 Bacteria 1883
251 Ga0207649_10161323 3300025920 Bacteria 1554
252 Ga0207649_10218270 3300025920 Bacteria 1357
253 Ga0207649_10342222 3300025920 Bacteria 1105
254 Ga0207649_10558979 3300025920 Bacteria 876
255 Ga0207652_10006621 3300025921 Bacteria 9336
256 Ga0207681_10039991 3300025923 Bacteria 3117
257 Ga0207694_10052151 3300025924 Bacteria 3171
258 Ga0207694_10437154 3300025924 Bacteria 1091
259 Ga0207650_10001927 3300025925 Bacteria 14611
260 Ga0207650_10004463 3300025925 Bacteria 9563
261 Ga0207650_10167057 3300025925 Bacteria 1746
262 Ga0207650_10177651 3300025925 Bacteria 1695
263 Ga0207659_10000613 3300025926 Bacteria 21295
264 Ga0207659_10006804 3300025926 Bacteria 7028
265 Ga0207659_10006975 3300025926 Bacteria 6941
266 Ga0207659_10049646 3300025926 Bacteria 2977
267 Ga0207659_10476108 3300025926 Bacteria 1054
268 Ga0207687_10224758 3300025927 Bacteria 1480
269 Ga0207644_10001441 3300025931 Bacteria 15328
270 Ga0207644_10064177 3300025931 Bacteria 2668
271 Ga0207644_10098327 3300025931 Bacteria 2193
272 Ga0207644_10256093 3300025931 Bacteria 1398
273 Ga0207644_10312976 3300025931 Bacteria 1268
274 Ga0207644_10395575 3300025931 Bacteria 1129
275 Ga0207690_10005755 3300025932 Bacteria 7327
276 Ga0207690_10037500 3300025932 Bacteria 3147
277 Ga0207706_10002250 3300025933 Bacteria 18839
278 Ga0207706_10024015 3300025933 Bacteria 5470
279 Ga0207706_10070983 3300025933 Bacteria 3063
280 Ga0207706_10395110 3300025933 Bacteria 1199
281 Ga0207686_10007697 3300025934 Bacteria 5809
282 Ga0207709_10218256 3300025935 Bacteria 1373
283 Ga0207669_10089803 3300025937 Bacteria 1996
284 Ga0207704_10422108 3300025938 Bacteria 1057
285 Ga0207665_10140252 3300025939 Unclassified 1723
286 Ga0207665_10257557 3300025939 Bacteria 1291
287 Ga0207691_10009449 3300025940 Bacteria 9363
288 Ga0207691_10017950 3300025940 Bacteria 6703
289 Ga0207691_10033902 3300025940 Bacteria 4753
290 Ga0207691_10036793 3300025940 Bacteria 4534
291 Ga0207691_10039782 3300025940 Bacteria 4349
292 Ga0207691_10045914 3300025940 Bacteria 4016
293 Ga0207691_10163186 3300025940 Bacteria 1954
294 Ga0207691_10179535 3300025940 Bacteria 1850
295 Ga0207691_10605636 3300025940 Bacteria 927
296 Ga0207711_10021652 3300025941 Bacteria 5370
297 Ga0207711_10156430 3300025941 Bacteria 2060
298 Ga0207711_10235702 3300025941 Bacteria 1677
299 Ga0207689_10002016 3300025942 Bacteria 19197
300 Ga0207689_10114186 3300025942 Bacteria 2220
301 Ga0207661_10140324 3300025944 Bacteria 2079
302 Ga0207679_10052675 3300025945 Bacteria 2986
303 Ga0207679_10067811 3300025945 Bacteria 2678
304 Ga0207679_10183446 3300025945 Bacteria 1733
305 Ga0207679_10281676 3300025945 Bacteria 1426
306 Ga0207679_10384702 3300025945 Bacteria 1231
307 Ga0207679_10495270 3300025945 Bacteria 1090
308 Ga0207667_10012340 3300025949 Bacteria 9855
309 Ga0207667_10399417 3300025949 Bacteria 1400
310 Ga0207651_10001658 3300025960 Bacteria 10220
311 Ga0207651_10016755 3300025960 Bacteria 4305
312 Ga0207712_10062405 3300025961 Bacteria 2649
313 Ga0207668_10775860 3300025972 Bacteria 847
314 Ga0207640_10031947 3300025981 Bacteria 3260
315 Ga0207640_10094930 3300025981 Bacteria 2075
316 Ga0207640_10104194 3300025981 Bacteria 1996
317 Ga0207658_10020131 3300025986 Bacteria 4620
318 Ga0207658_10037102 3300025986 Bacteria 3499
319 Ga0207658_10052288 3300025986 Bacteria 3014
320 Ga0207658_10078940 3300025986 Bacteria 2516
321 Ga0207658_10171845 3300025986 Bacteria 1786
322 Ga0207658_10574046 3300025986 Bacteria 1011
323 Ga0207677_10005023 3300026023 Bacteria 7147
324 Ga0207677_10018002 3300026023 Bacteria 4230
325 Ga0207677_10060915 3300026023 Bacteria 2611
326 Ga0207703_10004113 3300026035 Bacteria 12014
327 Ga0207703_10004562 3300026035 Bacteria 11356
328 Ga0207703_10051221 3300026035 Bacteria 3344
329 Ga0207639_10016858 3300026041 Bacteria 5176
330 Ga0207639_10063375 3300026041 Bacteria 2862
331 Ga0207639_10097035 3300026041 Bacteria 2373
332 Ga0207639_10099327 3300026041 Bacteria 2348
333 Ga0207639_10335176 3300026041 Bacteria 1347
334 Ga0207639_10995212 3300026041 Bacteria 785
335 Ga0207678_10002002 3300026067 Bacteria 18551
336 Ga0207678_10003973 3300026067 Bacteria 13303
337 Ga0207678_10148811 3300026067 Bacteria 1999
338 Ga0207708_10466257 3300026075 Bacteria 1054
339 Ga0207641_10019319 3300026088 Bacteria 5592
340 Ga0207641_10022727 3300026088 Bacteria 5163
341 Ga0207641_10299484 3300026088 Bacteria 1518
342 Ga0207641_10708079 3300026088 Bacteria 992
343 Ga0207648_10003265 3300026089 Bacteria 17047
344 Ga0207648_10066499 3300026089 Bacteria 3144
345 Ga0207648_10157255 3300026089 Bacteria 2006
346 Ga0207676_10026552 3300026095 Bacteria 4308
347 Ga0207676_10032370 3300026095 Bacteria 3939
348 Ga0207676_10139127 3300026095 Bacteria 2076
349 Ga0207675_100002143 3300026118 Bacteria 19595
350 Ga0207675_100101122 3300026118 Bacteria 2716
351 Ga0207675_100404460 3300026118 Bacteria 1346
352 Ga0207675_100587362 3300026118 Bacteria 1116
353 Ga0207683_10000445 3300026121 Bacteria 38259
354 Ga0207683_10004867 3300026121 Bacteria 11556
355 Ga0207683_10007627 3300026121 Bacteria 9267
356 Ga0207683_10028982 3300026121 Bacteria 4791
357 Ga0207683_10038099 3300026121 Bacteria 4188
358 Ga0207683_10039290 3300026121 Bacteria 4128
359 Ga0207683_10099350 3300026121 Bacteria 2597
360 Ga0207683_10111363 3300026121 Bacteria 2451
361 Ga0207698_10002093 3300026142 Bacteria 11776
362 Ga0207698_10039238 3300026142 Bacteria 3506
363 Ga0207698_10045721 3300026142 Bacteria 3300
364 Ga0207698_10145524 3300026142 Bacteria 2049
365 Ga0207698_10208566 3300026142 Bacteria 1756
366 Ga0207698_10223599 3300026142 Bacteria 1703
367 Ga0207698_10225474 3300026142 Bacteria 1697
368 Ga0207698_10497478 3300026142 Bacteria 1186
369 Ga0207428_10026770 3300027907 Bacteria 4807
370 Ga0268266_10071852 3300028379 Bacteria 2999
371 Ga0268266_10138278 3300028379 Bacteria 2184
372 Ga0268266_10658572 3300028379 Bacteria 1008
373 Ga0268265_10222954 3300028380 Bacteria 1651
374 Ga0268264_10011062 3300028381 Bacteria 7452
375 Ga0268264_10715738 3300028381 Bacteria 995
376 Ga0307515_10000734 3300028794 Bacteria 75701
377 Ga0307509_10028460 3300031507 Bacteria 6212
378 Ga0307516_10147395 3300031730 Bacteria 2118
379 Ga0307405_10000985 3300031731 Bacteria 11438
380 Ga0307410_10041726 3300031852 Bacteria 3027
381 Ga0307410_10255142 3300031852 Bacteria 1365
382 Ga0307406_10136771 3300031901 Bacteria 1728
383 Ga0307406_10232028 3300031901 Bacteria 1379
384 Ga0307412_10000270 3300031911 Bacteria 33288
385 Ga0307412_10221628 3300031911 Bacteria 1450
386 Ga0307412_10403393 3300031911 Bacteria 1114
387 Ga0307409_100039179 3300031995 Bacteria 3514
388 Ga0307416_100003852 3300032002 Bacteria 8926
389 Ga0307416_100250526 3300032002 Bacteria 1723
390 Ga0307416_100382439 3300032002 Bacteria 1438
391 Ga0307411_10188189 3300032005 Bacteria 1573
392 Ga0307411_10631236 3300032005 Bacteria 925
393 Ga0307415_100024939 3300032126 Bacteria 3744
394 Ga0307415_100043558 3300032126 Bacteria 2995
395 Ga0373960_0013118 3300035121 Bacteria 2073
396 Ga0373943_0040716 3300035170 Bacteria 2244
397 Ga0373955_0026317 3300035172 Bacteria 2996
398 Ga0373924_0158271 3300035410 Bacteria 993
399 Ga0373927_0232350 3300035695 Bacteria 1212
400 Ga0373947_0057500 3300035725 Bacteria 2354
401 Ga0373937_0088970 3300036401 Bacteria 2859
402 Ga0373937_0951305 3300036401 Bacteria 808
403 Ga0373925_0001876 3300037068 Bacteria 17464
404 Ga0395899_0165916 3300037312 Bacteria 1558
405 Ga0395900_0044024 3300037418 Bacteria 4601
406 Ga0395900_0180361 3300037418 Bacteria 2146
407 Ga0395900_0371117 3300037418 Bacteria 1401
408 Ga0395900_0656895 3300037418 Bacteria 985
409 Ga0395905_0000312 3300037471 Bacteria 70621
410 Ga0395905_0025035 3300037471 Bacteria 5629
411 Ga0395905_0036400 3300037471 Bacteria 4622
412 Ga0395905_0218271 3300037471 Bacteria 1785
413 Ga0395905_0574995 3300037471 Bacteria 1028
414 Ga0436365_1313220 3300039437 Bacteria 3150
415 Ga0436363_0656129 3300039450 Bacteria 2044
416 Ga0451807_0127149 3300041486 Bacteria 1274
417 Ga0439437_010440 3300042000 Bacteria 1056
418 Ga0439454_017509 3300042011 Bacteria 1024
419 Ga0439455_0028235 3300042012 Bacteria 1380
420 Ga0450923_019358 3300042125 Bacteria 1311
421 Ga0450897_008939 3300042128 Bacteria 940
422 Ga0439446_0018488 3300042156 Bacteria 1953
423 Ga0439464_0016497 3300042439 Bacteria 1997
424 Ga0451577_0001585 3300042876 Bacteria 29675
425 Ga0451577_0045792 3300042876 Bacteria 3915
426 Ga0466969_0010651 3300044656 Bacteria 4872
427 Ga0466980_0320303 3300044668 Bacteria 921
428 Ga0466961_0064192 3300044693 Bacteria 2333
429 Ga0453684_0101796 3300044712 Bacteria 3514
430 Ga0466968_0085038 3300044735 Bacteria 1395
431 Ga0466959_0010943 3300045049 Bacteria 6508
432 Ga0451576_0006641 3300045051 Bacteria 14132
433 Ga0495629_0000097 3300046459 Bacteria 76355
434 Ga0495638_0023425 3300046460 Bacteria 4038
435 Ga0495651_0053412 3300046462 Bacteria 3110
436 Ga0495653_0000492 3300046463 Bacteria 30476
437 Ga0495580_0016480 3300046472 Bacteria 5543
438 Ga0495585_0135291 3300046492 Bacteria 1294
439 Ga0495608_0013471 3300046511 Bacteria 5671
440 Ga0495610_0025864 3300046512 Bacteria 3142
441 Ga0495628_0012727 3300046516 Bacteria 7088
442 Ga0495628_0070195 3300046516 Bacteria 2731
443 Ga0495632_0011183 3300046519 Bacteria 5255
444 Ga0495648_0125269 3300046524 Bacteria 1374
445 Ga0495652_0025575 3300046529 Bacteria 5219
446 Ga0495665_0045421 3300046531 Bacteria 2333
447 Ga0495586_0040380 3300046535 Bacteria 2510
448 Ga0495598_0019164 3300046537 Bacteria 1790
449 Ga0495598_0040206 3300046537 Bacteria 1363
450 Ga0495621_0010291 3300046539 Bacteria 2855
451 Ga0495645_0099226 3300046543 Bacteria 2072
452 Ga0495645_0278768 3300046543 Bacteria 1100
453 Ga0495633_0002088 3300046558 Bacteria 14370
454 Ga0495668_0142450 3300046616 Bacteria 1312
455 Ga0495623_0002148 3300046679 Bacteria 13170
456 Ga0495623_0004122 3300046679 Bacteria 9577
457 Ga0495646_0012250 3300046680 Bacteria 5452
458 Ga0495647_0063980 3300046681 Bacteria 1458
459 Ga0495658_0376679 3300046683 Bacteria 903
460 Ga0495613_0013480 3300046689 Bacteria 6071
461 Ga0495624_0003071 3300046690 Bacteria 12500
462 Ga0495624_0057483 3300046690 Bacteria 2445
463 Ga0495670_0274542 3300046691 Bacteria 901
464 Ga0495649_0143761 3300046694 Bacteria 1254
465 Ga0495604_0000652 3300047317 Bacteria 29535
466 Ga0495604_0408087 3300047317 Bacteria 894
467 Ga0495636_0155742 3300047318 Bacteria 1027
468 Ga0495674_0018134 3300047319 Bacteria 6551
469 Ga0495674_0024704 3300047319 Bacteria 5515
470 Ga0495676_0039607 3300047321 Bacteria 3901
471 Ga0495680_0007557 3300047322 Bacteria 9940
472 Ga0495675_0199475 3300047444 Bacteria 1218
473 Ga0495684_0125177 3300047471 Bacteria 1934
474 Ga0495593_0005339 3300047673 Bacteria 7600
475 Ga0495602_0031604 3300048088 Bacteria 5001
476 Ga0495602_0050048 3300048088 Bacteria 3737
477 Ga0495602_0052361 3300048088 Bacteria 3627
478 Ga0495614_0057743 3300048089 Bacteria 1666
479 Ga0496100_0024378 3300048903 Bacteria 3690
480 Ga0496101_0006534 3300048904 Bacteria 7509
481 Ga0496101_0186403 3300048904 Bacteria 1600
482 Ga0496101_0218236 3300048904 Bacteria 1479
483 Ga0496102_0007822 3300048905 Bacteria 9137
484 Ga0496103_0225803 3300048906 Bacteria 1204
485 Ga0496104_0000665 3300048907 Bacteria 29449
486 Ga0496104_0026891 3300048907 Bacteria 5319
487 Ga0496105_0006488 3300048908 Bacteria 8995
488 Ga0496105_0028317 3300048908 Bacteria 4582
489 Ga0496106_0026787 3300048909 Bacteria 4293
490 Ga0496106_0028482 3300048909 Bacteria 4161
491 Ga0496107_0013186 3300048910 Bacteria 5775
492 Ga0496108_0121203 3300048911 Bacteria 2243
493 Ga0496108_0315426 3300048911 Bacteria 1363
494 Ga0496109_0050836 3300048912 Bacteria 3774
495 Ga0496110_0238787 3300048913 Bacteria 1653
496 Ga0496110_0554392 3300048913 Bacteria 1044
497 Ga0496111_0423926 3300048914 Bacteria 983
498 Ga0496114_0234667 3300048917 Bacteria 1612
499 Ga0496114_0309552 3300048917 Bacteria 1395
500 Ga0496115_0013108 3300048918 Bacteria 6260
501 Ga0496116_0049936 3300048919 Bacteria 2791
502 Ga0496117_0105676 3300048920 Bacteria 1769
503 Ga0496118_0121396 3300048921 Bacteria 1702
504 Ga0496118_0165585 3300048921 Bacteria 1359
505 Ga0496120_0043328 3300048923 Bacteria 2622
506 Ga0496121_0010185 3300048924 Bacteria 10645
507 Ga0496121_0024346 3300048924 Bacteria 5793
508 Ga0496121_0224226 3300048924 Bacteria 1321
509 Ga0496122_0036642 3300048925 Bacteria 3961
510 Ga0496123_0001524 3300048926 Bacteria 32014
511 Ga0496123_0097718 3300048926 Bacteria 1719
512 Ga0496124_0148175 3300048927 Bacteria 1844
513 Ga0496124_0220984 3300048927 Bacteria 1424
514 Ga0496125_0000259 3300048928 Bacteria 109184
515 Ga0496125_0038754 3300048928 Bacteria 4116
516 Ga0495682_0041071 3300049460 Bacteria 1695
517 Ga0501034_0660059 3300049571 Bacteria 947
518 Ga0501036_0524661 3300049572 Bacteria 985
519 Ga0501037_0510445 3300049573 Bacteria 815
520 Ga0501039_0299750 3300049575 Bacteria 1264
521 Ga0501035_0117684 3300049822 Bacteria 2325
522 Ga0501035_0534063 3300049822 Bacteria 962
523 Ga0501044_0069189 3300049823 Bacteria 3594
524 Ga0501044_0155156 3300049823 Bacteria 2269
525 nmdc:mga0yw44_3473_c1 3300050492 Bacteria 7002
526 nmdc:mga0k408_25505_c1 3300050493 Bacteria 3348
527 nmdc:mga09592_2210_c1 3300050508 Bacteria 15665
528 nmdc:mga0qj67_45649_c1 3300050509 Bacteria 3457
529 Ga0495601_0080332 3300053077 Bacteria 2092
530 Ga0495619_0137102 3300053085 Bacteria 1684
531 Ga0500643_001038 3300053087 Bacteria 16880
532 Ga0500643_005966 3300053087 Bacteria 5161
533 Ga0500644_0026805 3300053088 Bacteria 1786
534 Ga0500651_0038196 3300053093 Bacteria 3025
535 Ga0500559_0000407 3300053136 Bacteria 30942
536 Ga0500586_030430 3300053145 Bacteria 1775
537 Ga0500622_0002189 3300053156 Bacteria 14442
538 Ga0500587_002215 3300053739 Bacteria 2768
539 Ga0466962_0109182 3300061719 Bacteria 1331

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0274542 Ga0495670_0274542_171_887 216
2 3300053085 Ga0495619_0137102 Ga0495619_0137102_148_825 225
3 3300006173 Ga0070716_100140491 Ga0070716_1001404912 226
4 3300006175 Ga0070712_100090350 Ga0070712_1000903502 226
5 3300025939 Ga0207665_10140252 Ga0207665_101402522 226
6 3300005355 Ga0070671_100248283 Ga0070671_1002482832 227
7 3300005367 Ga0070667_100089875 Ga0070667_1000898753 227
8 3300005841 Ga0068863_100625307 Ga0068863_1006253071 227
9 3300013306 Ga0163162_10012488 Ga0163162_100124885 227
10 3300025986 Ga0207658_10037102 Ga0207658_100371024 227
11 3300026088 Ga0207641_10708079 Ga0207641_107080791 227
12 3300026121 Ga0207683_10039290 Ga0207683_100392901 227
13 3300037418 Ga0395900_0371117 Ga0395900_0371117_65_769 227
14 3300037471 Ga0395905_0000312 Ga0395905_0000312_25288_25992 227
15 3300048904 Ga0496101_0006534 Ga0496101_0006534_6675_7424 227
16 3300048905 Ga0496102_0007822 Ga0496102_0007822_2188_2937 227
17 3300048907 Ga0496104_0000665 Ga0496104_0000665_23798_24547 227
18 3300048908 Ga0496105_0006488 Ga0496105_0006488_6710_7459 227
19 3300048909 Ga0496106_0028482 Ga0496106_0028482_1368_2117 227
20 3300046543 Ga0495645_0099226 Ga0495645_0099226_1089_1841 229
21 3300031911 Ga0307412_10403393 Ga0307412_104033931 231
22 3300015265 Ga0182005_1040114 Ga0182005_10401141 232
23 3300028794 Ga0307515_10000734 Ga0307515_1000073442 232
24 3300049571 Ga0501034_0660059 Ga0501034_0660059_18_728 232
25 3300005354 Ga0070675_100227014 Ga0070675_1002270143 236
26 3300005367 Ga0070667_100415582 Ga0070667_1004155822 236
27 3300005578 Ga0068854_100021579 Ga0068854_1000215795 236
28 3300005616 Ga0068852_100233983 Ga0068852_1002339833 236
29 3300053087 Ga0500643_001038 Ga0500643_001038_9317_10042 236
30 3300053087 Ga0500643_005966 Ga0500643_005966_626_1351 236
31 3300025893 Ga0207682_10033308 Ga0207682_100333083 237
32 3300025920 Ga0207649_10558979 Ga0207649_105589791 237
33 3300025926 Ga0207659_10476108 Ga0207659_104761081 237
34 3300025986 Ga0207658_10574046 Ga0207658_105740462 237
35 3300026142 Ga0207698_10497478 Ga0207698_104974782 237
36 3300037471 Ga0395905_0036400 Ga0395905_0036400_2503_3288 237
37 iso_pu_bacteria 2501025502 2501077356 237
38 iso_pu_bacteria 2643221609 2644057964 237
39 iso_pu_bacteria 2738543012 2739242249 237
40 iso_pu_bacteria 2816332133 2816470133 237
41 iso_pu_bacteria 2932422444 2932425228 237
42 3300005539 Ga0068853_100139656 Ga0068853_1001396561 239
43 3300025303 Ga0209051_1005054 Ga0209051_10050545 239
44 3300026041 Ga0207639_10995212 Ga0207639_109952121 239
45 3300037418 Ga0395900_0656895 Ga0395900_0656895_194_913 239
46 3300042876 Ga0451577_0001585 Ga0451577_0001585_25826_26560 239
47 3300042876 Ga0451577_0045792 Ga0451577_0045792_1391_2146 239
48 3300044712 Ga0453684_0101796 Ga0453684_0101796_2267_3022 239
49 3300045051 Ga0451576_0006641 Ga0451576_0006641_9888_10643 239
50 3300046492 Ga0495585_0135291 Ga0495585_0135291_413_1132 239
51 3300046616 Ga0495668_0142450 Ga0495668_0142450_19_738 239
52 3300050492 nmdc:mga0yw44_3473_c1 nmdc:mga0yw44_3473_c1_50_781 239
53 iso_pu_bacteria 2599185292 2599907797 239
54 iso_pu_bacteria 2643221569 2643861058 239
55 iso_pu_bacteria 2643221594 2643981022 239
56 iso_pu_bacteria 2643221621 2644124358 239
57 iso_pu_bacteria 2808606395 2809034890 239
58 iso_pu_bacteria 2857537821 2857540472 239
59 iso_pu_bacteria 2900634093 2900634733 239
60 iso_pu_bacteria 2941479691 2941484380 239
61 iso_pu_bacteria 8055225921 8055228305 239
62 3300031852 Ga0307410_10255142 Ga0307410_102551422 240
63 3300031911 Ga0307412_10221628 Ga0307412_102216282 240
64 3300031995 Ga0307409_100039179 Ga0307409_1000391793 240
65 3300032002 Ga0307416_100003852 Ga0307416_1000038526 240
66 3300032126 Ga0307415_100024939 Ga0307415_1000249393 240
67 3300037312 Ga0395899_0165916 Ga0395899_0165916_426_1157 240
68 3300037418 Ga0395900_0044024 Ga0395900_0044024_3005_3736 240
69 3300037471 Ga0395905_0025035 Ga0395905_0025035_183_914 240
70 3300046558 Ga0495633_0002088 Ga0495633_0002088_12295_13077 240
71 iso_pu_bacteria 2643221660 2644338327 240
72 3300005328 Ga0070676_10024066 Ga0070676_100240662 241
73 3300005331 Ga0070670_100289376 Ga0070670_1002893762 241
74 3300005331 Ga0070670_100651970 Ga0070670_1006519701 241
75 3300005338 Ga0068868_100126118 Ga0068868_1001261182 241
76 3300005339 Ga0070660_100537093 Ga0070660_1005370931 241
77 3300005347 Ga0070668_100086213 Ga0070668_1000862132 241
78 3300005353 Ga0070669_100022316 Ga0070669_1000223163 241
79 3300005366 Ga0070659_100028935 Ga0070659_1000289352 241
80 3300005455 Ga0070663_100011120 Ga0070663_1000111203 241
81 3300005539 Ga0068853_100045216 Ga0068853_1000452163 241
82 3300005543 Ga0070672_100307617 Ga0070672_1003076171 241
83 3300005564 Ga0070664_100324605 Ga0070664_1003246052 241
84 3300005578 Ga0068854_100018839 Ga0068854_1000188394 241
85 3300005615 Ga0070702_100086493 Ga0070702_1000864932 241
86 3300005616 Ga0068852_100067300 Ga0068852_1000673003 241
87 3300005617 Ga0068859_100615070 Ga0068859_1006150702 241
88 3300005719 Ga0068861_100004167 Ga0068861_1000041677 241
89 3300005834 Ga0068851_10014446 Ga0068851_100144462 241
90 3300005842 Ga0068858_100046238 Ga0068858_1000462382 241
91 3300005843 Ga0068860_100103108 Ga0068860_1001031082 241
92 3300005844 Ga0068862_100076289 Ga0068862_1000762891 241
93 3300006195 Ga0075366_10054780 Ga0075366_100547802 241
94 3300006237 Ga0097621_100103538 Ga0097621_1001035382 241
95 3300006358 Ga0068871_100005853 Ga0068871_1000058532 241
96 3300006931 Ga0097620_100615222 Ga0097620_1006152222 241
97 3300009147 Ga0114129_10444761 Ga0114129_104447611 241
98 3300009174 Ga0105241_10035170 Ga0105241_100351703 241
99 3300009177 Ga0105248_10004078 Ga0105248_100040783 241
100 3300010375 Ga0105239_10037691 Ga0105239_100376915 241
101 3300013102 Ga0157371_10053995 Ga0157371_100539953 241
102 3300013296 Ga0157374_10011772 Ga0157374_100117728 241
103 3300013306 Ga0163162_10022159 Ga0163162_100221592 241
104 3300013307 Ga0157372_10011197 Ga0157372_100111971 241
105 3300014745 Ga0157377_10022596 Ga0157377_100225962 241
106 3300014968 Ga0157379_10015400 Ga0157379_100154002 241
107 3300014969 Ga0157376_10047096 Ga0157376_100470963 241
108 3300025893 Ga0207682_10034606 Ga0207682_100346062 241
109 3300025901 Ga0207688_10055828 Ga0207688_100558283 241
110 3300025907 Ga0207645_10029110 Ga0207645_100291102 241
111 3300025911 Ga0207654_10047274 Ga0207654_100472742 241
112 3300025923 Ga0207681_10039991 Ga0207681_100399912 241
113 3300025924 Ga0207694_10052151 Ga0207694_100521511 241
114 3300025926 Ga0207659_10006975 Ga0207659_100069752 241
115 3300025926 Ga0207659_10049646 Ga0207659_100496463 241
116 3300025932 Ga0207690_10005755 Ga0207690_100057552 241
117 3300025933 Ga0207706_10002250 Ga0207706_100022508 241
118 3300025933 Ga0207706_10395110 Ga0207706_103951102 241
119 3300025939 Ga0207665_10257557 Ga0207665_102575572 241
120 3300025940 Ga0207691_10163186 Ga0207691_101631863 241
121 3300025941 Ga0207711_10156430 Ga0207711_101564302 241
122 3300025942 Ga0207689_10002016 Ga0207689_1000201611 241
123 3300025945 Ga0207679_10183446 Ga0207679_101834463 241
124 3300025945 Ga0207679_10384702 Ga0207679_103847022 241
125 3300025949 Ga0207667_10012340 Ga0207667_100123405 241
126 3300026035 Ga0207703_10051221 Ga0207703_100512212 241
127 3300026041 Ga0207639_10335176 Ga0207639_103351762 241
128 3300026067 Ga0207678_10003973 Ga0207678_100039733 241
129 3300026095 Ga0207676_10032370 Ga0207676_100323703 241
130 3300026118 Ga0207675_100002143 Ga0207675_10000214311 241
131 3300026121 Ga0207683_10099350 Ga0207683_100993503 241
132 3300026142 Ga0207698_10039238 Ga0207698_100392383 241
133 3300028380 Ga0268265_10222954 Ga0268265_102229542 241
134 3300031507 Ga0307509_10028460 Ga0307509_100284602 241
135 3300035121 Ga0373960_0013118 Ga0373960_0013118_601_1335 241
136 3300035172 Ga0373955_0026317 Ga0373955_0026317_81_848 241
137 3300035410 Ga0373924_0158271 Ga0373924_0158271_210_977 241
138 3300035695 Ga0373927_0232350 Ga0373927_0232350_370_1098 241
139 3300036401 Ga0373937_0088970 Ga0373937_0088970_1910_2677 241
140 3300046519 Ga0495632_0011183 Ga0495632_0011183_4300_5031 241
141 3300046543 Ga0495645_0278768 Ga0495645_0278768_273_1040 241
142 3300047317 Ga0495604_0408087 Ga0495604_0408087_60_785 241
143 3300047471 Ga0495684_0125177 Ga0495684_0125177_973_1740 241
144 3300048903 Ga0496100_0024378 Ga0496100_0024378_2157_2891 241
145 3300048904 Ga0496101_0218236 Ga0496101_0218236_603_1337 241
146 3300048906 Ga0496103_0225803 Ga0496103_0225803_155_889 241
147 3300048909 Ga0496106_0026787 Ga0496106_0026787_654_1388 241
148 3300048910 Ga0496107_0013186 Ga0496107_0013186_2576_3310 241
149 3300048911 Ga0496108_0121203 Ga0496108_0121203_45_779 241
150 3300048912 Ga0496109_0050836 Ga0496109_0050836_722_1456 241
151 3300048913 Ga0496110_0238787 Ga0496110_0238787_671_1405 241
152 3300048917 Ga0496114_0234667 Ga0496114_0234667_795_1529 241
153 3300048918 Ga0496115_0013108 Ga0496115_0013108_4821_5555 241
154 3300050493 nmdc:mga0k408_25505_c1 nmdc:mga0k408_25505_c1_1121_1864 241
155 iso_pu_bacteria 2501025504 2501414436 241
156 iso_pu_bacteria 2510917014 2511099689 241
157 3300003771 Ga0055526_1000408 Ga0055526_100040812 242
158 3300005327 Ga0070658_10016034 Ga0070658_100160347 242
159 3300005331 Ga0070670_100017775 Ga0070670_1000177757 242
160 3300005338 Ga0068868_100014265 Ga0068868_1000142653 242
161 3300005353 Ga0070669_100730641 Ga0070669_1007306411 242
162 3300005355 Ga0070671_100002046 Ga0070671_1000020463 242
163 3300005355 Ga0070671_100034530 Ga0070671_1000345303 242
164 3300005364 Ga0070673_100002957 Ga0070673_1000029577 242
165 3300005455 Ga0070663_100002679 Ga0070663_1000026797 242
166 3300005456 Ga0070678_100006265 Ga0070678_1000062658 242
167 3300005539 Ga0068853_100087443 Ga0068853_1000874433 242
168 3300005543 Ga0070672_100349897 Ga0070672_1003498972 242
169 3300005564 Ga0070664_100247488 Ga0070664_1002474882 242
170 3300005616 Ga0068852_100054609 Ga0068852_1000546096 242
171 3300005834 Ga0068851_10001036 Ga0068851_1000103615 242
172 3300005841 Ga0068863_100217820 Ga0068863_1002178202 242
173 3300006358 Ga0068871_100176778 Ga0068871_1001767782 242
174 3300006846 Ga0075430_100026829 Ga0075430_1000268292 242
175 3300006880 Ga0075429_100001715 Ga0075429_1000017152 242
176 3300013296 Ga0157374_10028148 Ga0157374_100281485 242
177 3300013308 Ga0157375_10008130 Ga0157375_100081307 242
178 3300014325 Ga0163163_10331047 Ga0163163_103310471 242
179 3300021377 Ga0213874_10021415 Ga0213874_100214152 242
180 3300021384 Ga0213876_10165026 Ga0213876_101650262 242
181 3300025295 Ga0209564_1000192 Ga0209564_1000192120 242
182 3300025321 Ga0207656_10001964 Ga0207656_100019647 242
183 3300025907 Ga0207645_10189694 Ga0207645_101896942 242
184 3300025925 Ga0207650_10177651 Ga0207650_101776512 242
185 3300025931 Ga0207644_10064177 Ga0207644_100641772 242
186 3300025931 Ga0207644_10098327 Ga0207644_100983272 242
187 3300025931 Ga0207644_10312976 Ga0207644_103129761 242
188 3300025933 Ga0207706_10024015 Ga0207706_100240152 242
189 3300025940 Ga0207691_10039782 Ga0207691_100397822 242
190 3300025945 Ga0207679_10281676 Ga0207679_102816762 242
191 3300025960 Ga0207651_10001658 Ga0207651_100016589 242
192 3300026023 Ga0207677_10018002 Ga0207677_100180024 242
193 3300026023 Ga0207677_10060915 Ga0207677_100609153 242
194 3300026041 Ga0207639_10063375 Ga0207639_100633753 242
195 3300026067 Ga0207678_10002002 Ga0207678_1000200217 242
196 3300026067 Ga0207678_10148811 Ga0207678_101488113 242
197 3300026088 Ga0207641_10299484 Ga0207641_102994842 242
198 3300026121 Ga0207683_10007627 Ga0207683_100076277 242
199 3300026142 Ga0207698_10002093 Ga0207698_1000209310 242
200 3300032005 Ga0307411_10631236 Ga0307411_106312362 242
201 3300035170 Ga0373943_0040716 Ga0373943_0040716_65_793 242
202 3300035725 Ga0373947_0057500 Ga0373947_0057500_1378_2106 242
203 3300037068 Ga0373925_0001876 Ga0373925_0001876_12589_13317 242
204 3300037418 Ga0395900_0180361 Ga0395900_0180361_1293_2030 242
205 3300037471 Ga0395905_0218271 Ga0395905_0218271_540_1271 242
206 3300037471 Ga0395905_0574995 Ga0395905_0574995_271_1008 242
207 3300039437 Ga0436365_1313220 Ga0436365_1313220_2186_2914 242
208 3300039450 Ga0436363_0656129 Ga0436363_0656129_439_1176 242
209 3300042000 Ga0439437_010440 Ga0439437_010440_18_752 242
210 3300042011 Ga0439454_017509 Ga0439454_017509_44_778 242
211 3300042012 Ga0439455_0028235 Ga0439455_0028235_429_1163 242
212 3300042125 Ga0450923_019358 Ga0450923_019358_470_1204 242
213 3300042128 Ga0450897_008939 Ga0450897_008939_162_896 242
214 3300042156 Ga0439446_0018488 Ga0439446_0018488_652_1386 242
215 3300042439 Ga0439464_0016497 Ga0439464_0016497_975_1709 242
216 3300044656 Ga0466969_0010651 Ga0466969_0010651_338_1069 242
217 3300044693 Ga0466961_0064192 Ga0466961_0064192_627_1358 242
218 3300044735 Ga0466968_0085038 Ga0466968_0085038_145_876 242
219 3300046535 Ga0495586_0040380 Ga0495586_0040380_1631_2359 242
220 3300046537 Ga0495598_0040206 Ga0495598_0040206_402_1133 242
221 3300046539 Ga0495621_0010291 Ga0495621_0010291_827_1558 242
222 3300048914 Ga0496111_0423926 Ga0496111_0423926_52_780 242
223 3300049572 Ga0501036_0524661 Ga0501036_0524661_108_878 242
224 3300049573 Ga0501037_0510445 Ga0501037_0510445_58_795 242
225 3300049575 Ga0501039_0299750 Ga0501039_0299750_229_999 242
226 3300049822 Ga0501035_0117684 Ga0501035_0117684_228_965 242
227 3300049822 Ga0501035_0534063 Ga0501035_0534063_167_937 242
228 3300049823 Ga0501044_0069189 Ga0501044_0069189_1792_2529 242
229 3300049823 Ga0501044_0155156 Ga0501044_0155156_1235_2005 242
230 3300050508 nmdc:mga09592_2210_c1 nmdc:mga09592_2210_c1_2374_3114 242
231 3300050509 nmdc:mga0qj67_45649_c1 nmdc:mga0qj67_45649_c1_1321_2061 242
232 3300061719 Ga0466962_0109182 Ga0466962_0109182_536_1267 242
233 iso_pu_bacteria 2904434214 2904437764 242
234 3300003316 rootH1_10092629 rootH1_100926292 243
235 3300003751 Ga0055538_1000016 Ga0055538_1000016192 243
236 3300003752 Ga0055539_1000021 Ga0055539_1000021192 243
237 3300003756 Ga0055533_1000029 Ga0055533_1000029192 243
238 3300003759 Ga0055525_1000033 Ga0055525_1000033192 243
239 3300003792 Ga0055540_1011166 Ga0055540_10111665 243
240 3300003794 Ga0055531_10000335 Ga0055531_1000033522 243
241 3300003841 Ga0055541_1000029 Ga0055541_100002997 243
242 3300005327 Ga0070658_10019434 Ga0070658_100194347 243
243 3300005328 Ga0070676_10006948 Ga0070676_100069481 243
244 3300005328 Ga0070676_10284427 Ga0070676_102844272 243
245 3300005329 Ga0070683_100063997 Ga0070683_1000639973 243
246 3300005329 Ga0070683_100297509 Ga0070683_1002975091 243
247 3300005330 Ga0070690_100105668 Ga0070690_1001056681 243
248 3300005331 Ga0070670_100004394 Ga0070670_10000439413 243
249 3300005331 Ga0070670_100031309 Ga0070670_1000313091 243
250 3300005333 Ga0070677_10042718 Ga0070677_100427181 243
251 3300005335 Ga0070666_10038023 Ga0070666_100380234 243
252 3300005338 Ga0068868_100001385 Ga0068868_1000013857 243
253 3300005340 Ga0070689_100003084 Ga0070689_1000030847 243
254 3300005343 Ga0070687_100038672 Ga0070687_1000386724 243
255 3300005344 Ga0070661_100028113 Ga0070661_1000281132 243
256 3300005344 Ga0070661_100099626 Ga0070661_1000996261 243
257 3300005344 Ga0070661_100231958 Ga0070661_1002319582 243
258 3300005344 Ga0070661_100300839 Ga0070661_1003008392 243
259 3300005347 Ga0070668_100032340 Ga0070668_1000323402 243
260 3300005353 Ga0070669_100160686 Ga0070669_1001606862 243
261 3300005353 Ga0070669_100356796 Ga0070669_1003567962 243
262 3300005354 Ga0070675_100002237 Ga0070675_1000022377 243
263 3300005354 Ga0070675_100072998 Ga0070675_1000729982 243
264 3300005354 Ga0070675_100111985 Ga0070675_1001119853 243
265 3300005355 Ga0070671_100007253 Ga0070671_1000072535 243
266 3300005355 Ga0070671_100007782 Ga0070671_1000077824 243
267 3300005355 Ga0070671_100039987 Ga0070671_1000399875 243
268 3300005355 Ga0070671_100156273 Ga0070671_1001562733 243
269 3300005356 Ga0070674_100287163 Ga0070674_1002871632 243
270 3300005364 Ga0070673_100000208 Ga0070673_10000020814 243
271 3300005364 Ga0070673_100304102 Ga0070673_1003041022 243
272 3300005366 Ga0070659_100046790 Ga0070659_1000467903 243
273 3300005366 Ga0070659_100058732 Ga0070659_1000587325 243
274 3300005367 Ga0070667_100001443 Ga0070667_10000144321 243
275 3300005367 Ga0070667_100028473 Ga0070667_1000284735 243
276 3300005367 Ga0070667_100051670 Ga0070667_1000516702 243
277 3300005367 Ga0070667_100077966 Ga0070667_1000779663 243
278 3300005367 Ga0070667_100548377 Ga0070667_1005483772 243
279 3300005456 Ga0070678_100001789 Ga0070678_1000017896 243
280 3300005456 Ga0070678_100042065 Ga0070678_1000420652 243
281 3300005456 Ga0070678_100220659 Ga0070678_1002206593 243
282 3300005457 Ga0070662_100095082 Ga0070662_1000950821 243
283 3300005459 Ga0068867_100022691 Ga0068867_1000226914 243
284 3300005459 Ga0068867_100030684 Ga0068867_1000306844 243
285 3300005459 Ga0068867_100139498 Ga0068867_1001394983 243
286 3300005459 Ga0068867_100177921 Ga0068867_1001779212 243
287 3300005466 Ga0070685_10123730 Ga0070685_101237302 243
288 3300005530 Ga0070679_100035171 Ga0070679_1000351711 243
289 3300005535 Ga0070684_100004382 Ga0070684_1000043829 243
290 3300005535 Ga0070684_100110198 Ga0070684_1001101984 243
291 3300005539 Ga0068853_100091842 Ga0068853_1000918423 243
292 3300005539 Ga0068853_100219463 Ga0068853_1002194633 243
293 3300005543 Ga0070672_100004392 Ga0070672_1000043928 243
294 3300005543 Ga0070672_100015337 Ga0070672_1000153376 243
295 3300005543 Ga0070672_100036554 Ga0070672_1000365543 243
296 3300005543 Ga0070672_100074470 Ga0070672_1000744704 243
297 3300005543 Ga0070672_100152265 Ga0070672_1001522653 243
298 3300005547 Ga0070693_100119656 Ga0070693_1001196561 243
299 3300005548 Ga0070665_100008015 Ga0070665_1000080158 243
300 3300005548 Ga0070665_100208744 Ga0070665_1002087443 243
301 3300005548 Ga0070665_100281548 Ga0070665_1002815482 243
302 3300005564 Ga0070664_100094229 Ga0070664_1000942292 243
303 3300005577 Ga0068857_100072028 Ga0068857_1000720282 243
304 3300005578 Ga0068854_100015002 Ga0068854_1000150024 243
305 3300005578 Ga0068854_100023928 Ga0068854_1000239285 243
306 3300005614 Ga0068856_100009207 Ga0068856_1000092078 243
307 3300005616 Ga0068852_100029414 Ga0068852_1000294145 243
308 3300005616 Ga0068852_100072431 Ga0068852_1000724314 243
309 3300005616 Ga0068852_100372871 Ga0068852_1003728711 243
310 3300005616 Ga0068852_100488571 Ga0068852_1004885712 243
311 3300005617 Ga0068859_100001157 Ga0068859_10000115725 243
312 3300005617 Ga0068859_100407259 Ga0068859_1004072591 243
313 3300005618 Ga0068864_100000432 Ga0068864_10000043214 243
314 3300005618 Ga0068864_100009444 Ga0068864_1000094443 243
315 3300005618 Ga0068864_100011831 Ga0068864_1000118318 243
316 3300005618 Ga0068864_100176567 Ga0068864_1001765673 243
317 3300005719 Ga0068861_100011766 Ga0068861_1000117663 243
318 3300005834 Ga0068851_10049712 Ga0068851_100497124 243
319 3300005834 Ga0068851_10079137 Ga0068851_100791372 243
320 3300005841 Ga0068863_100027731 Ga0068863_1000277314 243
321 3300005841 Ga0068863_100113712 Ga0068863_1001137122 243
322 3300005842 Ga0068858_100000549 Ga0068858_10000054910 243
323 3300005842 Ga0068858_100002508 Ga0068858_1000025089 243
324 3300005843 Ga0068860_100003936 Ga0068860_10000393610 243
325 3300005844 Ga0068862_100105522 Ga0068862_1001055224 243
326 3300006237 Ga0097621_100008406 Ga0097621_1000084066 243
327 3300006237 Ga0097621_100009597 Ga0097621_1000095979 243
328 3300006237 Ga0097621_100144796 Ga0097621_1001447963 243
329 3300006358 Ga0068871_100016873 Ga0068871_1000168734 243
330 3300006358 Ga0068871_100030632 Ga0068871_1000306324 243
331 3300006358 Ga0068871_100057469 Ga0068871_1000574692 243
332 3300006881 Ga0068865_100034337 Ga0068865_1000343375 243
333 3300006881 Ga0068865_100215130 Ga0068865_1002151302 243
334 3300006881 Ga0068865_100493437 Ga0068865_1004934371 243
335 3300006931 Ga0097620_100001157 Ga0097620_10000115725 243
336 3300006931 Ga0097620_100407242 Ga0097620_1004072422 243
337 3300009094 Ga0111539_10755944 Ga0111539_107559441 243
338 3300009098 Ga0105245_10175746 Ga0105245_101757463 243
339 3300009101 Ga0105247_10226814 Ga0105247_102268141 243
340 3300009148 Ga0105243_10146760 Ga0105243_101467603 243
341 3300009176 Ga0105242_10112890 Ga0105242_101128903 243
342 3300009176 Ga0105242_10255215 Ga0105242_102552151 243
343 3300009177 Ga0105248_10000698 Ga0105248_1000069830 243
344 3300009177 Ga0105248_10016947 Ga0105248_1001694710 243
345 3300009177 Ga0105248_10026399 Ga0105248_100263993 243
346 3300009177 Ga0105248_10031309 Ga0105248_100313096 243
347 3300009177 Ga0105248_10438334 Ga0105248_104383342 243
348 3300009551 Ga0105238_10014746 Ga0105238_100147463 243
349 3300009553 Ga0105249_10152658 Ga0105249_101526583 243
350 3300013102 Ga0157371_10204576 Ga0157371_102045763 243
351 3300013104 Ga0157370_10036973 Ga0157370_100369733 243
352 3300013105 Ga0157369_10128772 Ga0157369_101287723 243
353 3300013296 Ga0157374_10118105 Ga0157374_101181053 243
354 3300013296 Ga0157374_10121915 Ga0157374_101219153 243
355 3300013296 Ga0157374_10292886 Ga0157374_102928863 243
356 3300013297 Ga0157378_10615805 Ga0157378_106158051 243
357 3300013306 Ga0163162_10002262 Ga0163162_1000226211 243
358 3300013306 Ga0163162_10137354 Ga0163162_101373542 243
359 3300013306 Ga0163162_10262341 Ga0163162_102623413 243
360 3300013307 Ga0157372_10011573 Ga0157372_100115732 243
361 3300013308 Ga0157375_10006005 Ga0157375_100060057 243
362 3300013308 Ga0157375_10147915 Ga0157375_101479154 243
363 3300013308 Ga0157375_10185609 Ga0157375_101856092 243
364 3300013308 Ga0157375_10187261 Ga0157375_101872612 243
365 3300014325 Ga0163163_10003225 Ga0163163_1000322513 243
366 3300014325 Ga0163163_10180720 Ga0163163_101807203 243
367 3300014326 Ga0157380_10004233 Ga0157380_1000423311 243
368 3300014326 Ga0157380_10205266 Ga0157380_102052663 243
369 3300014745 Ga0157377_10249070 Ga0157377_102490702 243
370 3300014968 Ga0157379_10002944 Ga0157379_100029449 243
371 3300014969 Ga0157376_10009366 Ga0157376_100093667 243
372 3300015262 Ga0182007_10001352 Ga0182007_1000135217 243
373 3300021361 Ga0213872_10069294 Ga0213872_100692942 243
374 3300025224 Ga0209784_100033 Ga0209784_100033191 243
375 3300025225 Ga0209566_100037 Ga0209566_100037191 243
376 3300025226 Ga0209674_100055 Ga0209674_100055191 243
377 3300025230 Ga0209563_100056 Ga0209563_100056191 243
378 3300025253 Ga0209677_100034 Ga0209677_100034191 243
379 3300025256 Ga0209759_1000085 Ga0209759_1000085133 243
380 3300025273 Ga0209673_1015460 Ga0209673_10154604 243
381 3300025292 Ga0209676_1007163 Ga0209676_10071636 243
382 3300025298 Ga0209050_1002492 Ga0209050_100249217 243
383 3300025303 Ga0209051_1000406 Ga0209051_100040646 243
384 3300025304 Ga0209257_1000012 Ga0209257_1000012512 243
385 3300025315 Ga0207697_10021644 Ga0207697_100216443 243
386 3300025321 Ga0207656_10015358 Ga0207656_100153583 243
387 3300025893 Ga0207682_10002757 Ga0207682_100027578 243
388 3300025893 Ga0207682_10027124 Ga0207682_100271243 243
389 3300025893 Ga0207682_10047669 Ga0207682_100476693 243
390 3300025899 Ga0207642_10155595 Ga0207642_101555951 243
391 3300025899 Ga0207642_10256240 Ga0207642_102562401 243
392 3300025901 Ga0207688_10109961 Ga0207688_101099612 243
393 3300025903 Ga0207680_10044296 Ga0207680_100442963 243
394 3300025903 Ga0207680_10064677 Ga0207680_100646771 243
395 3300025903 Ga0207680_10192416 Ga0207680_101924161 243
396 3300025907 Ga0207645_10149246 Ga0207645_101492462 243
397 3300025913 Ga0207695_10356719 Ga0207695_103567192 243
398 3300025917 Ga0207660_10081127 Ga0207660_100811272 243
399 3300025918 Ga0207662_10114837 Ga0207662_101148372 243
400 3300025919 Ga0207657_10009270 Ga0207657_100092703 243
401 3300025920 Ga0207649_10104243 Ga0207649_101042433 243
402 3300025920 Ga0207649_10161323 Ga0207649_101613232 243
403 3300025920 Ga0207649_10218270 Ga0207649_102182702 243
404 3300025920 Ga0207649_10342222 Ga0207649_103422221 243
405 3300025921 Ga0207652_10006621 Ga0207652_100066212 243
406 3300025924 Ga0207694_10437154 Ga0207694_104371542 243
407 3300025925 Ga0207650_10001927 Ga0207650_1000192718 243
408 3300025925 Ga0207650_10004463 Ga0207650_100044636 243
409 3300025925 Ga0207650_10167057 Ga0207650_101670573 243
410 3300025926 Ga0207659_10000613 Ga0207659_1000061319 243
411 3300025926 Ga0207659_10006804 Ga0207659_100068047 243
412 3300025927 Ga0207687_10224758 Ga0207687_102247582 243
413 3300025931 Ga0207644_10001441 Ga0207644_100014418 243
414 3300025931 Ga0207644_10256093 Ga0207644_102560931 243
415 3300025931 Ga0207644_10395575 Ga0207644_103955751 243
416 3300025932 Ga0207690_10037500 Ga0207690_100375005 243
417 3300025933 Ga0207706_10070983 Ga0207706_100709834 243
418 3300025934 Ga0207686_10007697 Ga0207686_100076973 243
419 3300025935 Ga0207709_10218256 Ga0207709_102182562 243
420 3300025937 Ga0207669_10089803 Ga0207669_100898032 243
421 3300025938 Ga0207704_10422108 Ga0207704_104221081 243
422 3300025940 Ga0207691_10009449 Ga0207691_100094499 243
423 3300025940 Ga0207691_10017950 Ga0207691_100179507 243
424 3300025940 Ga0207691_10033902 Ga0207691_100339022 243
425 3300025940 Ga0207691_10036793 Ga0207691_100367934 243
426 3300025940 Ga0207691_10045914 Ga0207691_100459144 243
427 3300025940 Ga0207691_10179535 Ga0207691_101795352 243
428 3300025940 Ga0207691_10605636 Ga0207691_106056361 243
429 3300025941 Ga0207711_10021652 Ga0207711_100216522 243
430 3300025941 Ga0207711_10235702 Ga0207711_102357022 243
431 3300025942 Ga0207689_10114186 Ga0207689_101141861 243
432 3300025944 Ga0207661_10140324 Ga0207661_101403243 243
433 3300025945 Ga0207679_10052675 Ga0207679_100526754 243
434 3300025945 Ga0207679_10067811 Ga0207679_100678113 243
435 3300025945 Ga0207679_10495270 Ga0207679_104952702 243
436 3300025949 Ga0207667_10399417 Ga0207667_103994172 243
437 3300025960 Ga0207651_10016755 Ga0207651_100167552 243
438 3300025961 Ga0207712_10062405 Ga0207712_100624053 243
439 3300025972 Ga0207668_10775860 Ga0207668_107758601 243
440 3300025981 Ga0207640_10031947 Ga0207640_100319475 243
441 3300025981 Ga0207640_10094930 Ga0207640_100949302 243
442 3300025981 Ga0207640_10104194 Ga0207640_101041943 243
443 3300025986 Ga0207658_10020131 Ga0207658_100201314 243
444 3300025986 Ga0207658_10052288 Ga0207658_100522882 243
445 3300025986 Ga0207658_10078940 Ga0207658_100789403 243
446 3300025986 Ga0207658_10171845 Ga0207658_101718452 243
447 3300026023 Ga0207677_10005023 Ga0207677_100050234 243
448 3300026035 Ga0207703_10004113 Ga0207703_100041137 243
449 3300026035 Ga0207703_10004562 Ga0207703_100045625 243
450 3300026041 Ga0207639_10016858 Ga0207639_100168584 243
451 3300026041 Ga0207639_10097035 Ga0207639_100970352 243
452 3300026041 Ga0207639_10099327 Ga0207639_100993275 243
453 3300026075 Ga0207708_10466257 Ga0207708_104662571 243
454 3300026088 Ga0207641_10019319 Ga0207641_100193198 243
455 3300026088 Ga0207641_10022727 Ga0207641_100227273 243
456 3300026089 Ga0207648_10003265 Ga0207648_1000326511 243
457 3300026089 Ga0207648_10066499 Ga0207648_100664992 243
458 3300026089 Ga0207648_10157255 Ga0207648_101572553 243
459 3300026095 Ga0207676_10026552 Ga0207676_100265525 243
460 3300026095 Ga0207676_10139127 Ga0207676_101391273 243
461 3300026118 Ga0207675_100101122 Ga0207675_1001011222 243
462 3300026118 Ga0207675_100404460 Ga0207675_1004044601 243
463 3300026118 Ga0207675_100587362 Ga0207675_1005873621 243
464 3300026121 Ga0207683_10000445 Ga0207683_1000044522 243
465 3300026121 Ga0207683_10004867 Ga0207683_100048676 243
466 3300026121 Ga0207683_10028982 Ga0207683_100289825 243
467 3300026121 Ga0207683_10038099 Ga0207683_100380994 243
468 3300026121 Ga0207683_10111363 Ga0207683_101113631 243
469 3300026142 Ga0207698_10045721 Ga0207698_100457212 243
470 3300026142 Ga0207698_10145524 Ga0207698_101455242 243
471 3300026142 Ga0207698_10208566 Ga0207698_102085663 243
472 3300026142 Ga0207698_10223599 Ga0207698_102235991 243
473 3300026142 Ga0207698_10225474 Ga0207698_102254743 243
474 3300027907 Ga0207428_10026770 Ga0207428_100267705 243
475 3300028379 Ga0268266_10071852 Ga0268266_100718521 243
476 3300028379 Ga0268266_10138278 Ga0268266_101382782 243
477 3300028379 Ga0268266_10658572 Ga0268266_106585722 243
478 3300028381 Ga0268264_10011062 Ga0268264_100110625 243
479 3300028381 Ga0268264_10715738 Ga0268264_107157382 243
480 3300031730 Ga0307516_10147395 Ga0307516_101473952 243
481 3300031731 Ga0307405_10000985 Ga0307405_1000098510 243
482 3300031852 Ga0307410_10041726 Ga0307410_100417264 243
483 3300031901 Ga0307406_10136771 Ga0307406_101367712 243
484 3300031901 Ga0307406_10232028 Ga0307406_102320281 243
485 3300031911 Ga0307412_10000270 Ga0307412_100002701 243
486 3300032002 Ga0307416_100250526 Ga0307416_1002505262 243
487 3300032002 Ga0307416_100382439 Ga0307416_1003824392 243
488 3300032005 Ga0307411_10188189 Ga0307411_101881893 243
489 3300032126 Ga0307415_100043558 Ga0307415_1000435582 243
490 3300036401 Ga0373937_0951305 Ga0373937_0951305_41_772 243
491 3300041486 Ga0451807_0127149 Ga0451807_0127149_146_892 243
492 3300044668 Ga0466980_0320303 Ga0466980_0320303_118_882 243
493 3300045049 Ga0466959_0010943 Ga0466959_0010943_601_1365 243
494 3300046459 Ga0495629_0000097 Ga0495629_0000097_24954_25700 243
495 3300046460 Ga0495638_0023425 Ga0495638_0023425_3251_3985 243
496 3300046462 Ga0495651_0053412 Ga0495651_0053412_1134_1880 243
497 3300046463 Ga0495653_0000492 Ga0495653_0000492_12546_13292 243
498 3300046472 Ga0495580_0016480 Ga0495580_0016480_4071_4817 243
499 3300046511 Ga0495608_0013471 Ga0495608_0013471_1352_2098 243
500 3300046512 Ga0495610_0025864 Ga0495610_0025864_1467_2201 243
501 3300046516 Ga0495628_0012727 Ga0495628_0012727_206_952 243
502 3300046516 Ga0495628_0070195 Ga0495628_0070195_168_914 243
503 3300046524 Ga0495648_0125269 Ga0495648_0125269_401_1147 243
504 3300046529 Ga0495652_0025575 Ga0495652_0025575_2630_3376 243
505 3300046531 Ga0495665_0045421 Ga0495665_0045421_333_1082 243
506 3300046537 Ga0495598_0019164 Ga0495598_0019164_617_1363 243
507 3300046679 Ga0495623_0002148 Ga0495623_0002148_5051_5824 243
508 3300046679 Ga0495623_0004122 Ga0495623_0004122_818_1564 243
509 3300046680 Ga0495646_0012250 Ga0495646_0012250_1246_1992 243
510 3300046681 Ga0495647_0063980 Ga0495647_0063980_221_967 243
511 3300046683 Ga0495658_0376679 Ga0495658_0376679_72_839 243
512 3300046689 Ga0495613_0013480 Ga0495613_0013480_5310_6056 243
513 3300046690 Ga0495624_0003071 Ga0495624_0003071_4071_4817 243
514 3300046690 Ga0495624_0057483 Ga0495624_0057483_1342_2091 243
515 3300046694 Ga0495649_0143761 Ga0495649_0143761_276_1025 243
516 3300047317 Ga0495604_0000652 Ga0495604_0000652_13178_13951 243
517 3300047318 Ga0495636_0155742 Ga0495636_0155742_56_790 243
518 3300047319 Ga0495674_0018134 Ga0495674_0018134_5076_5825 243
519 3300047319 Ga0495674_0024704 Ga0495674_0024704_4043_4789 243
520 3300047321 Ga0495676_0039607 Ga0495676_0039607_2021_2767 243
521 3300047322 Ga0495680_0007557 Ga0495680_0007557_5159_5932 243
522 3300047444 Ga0495675_0199475 Ga0495675_0199475_430_1203 243
523 3300047673 Ga0495593_0005339 Ga0495593_0005339_6147_6893 243
524 3300048088 Ga0495602_0031604 Ga0495602_0031604_3680_4453 243
525 3300048088 Ga0495602_0050048 Ga0495602_0050048_927_1673 243
526 3300048088 Ga0495602_0052361 Ga0495602_0052361_423_1172 243
527 3300048089 Ga0495614_0057743 Ga0495614_0057743_399_1148 243
528 3300048904 Ga0496101_0186403 Ga0496101_0186403_733_1467 243
529 3300048907 Ga0496104_0026891 Ga0496104_0026891_605_1339 243
530 3300048908 Ga0496105_0028317 Ga0496105_0028317_922_1656 243
531 3300048911 Ga0496108_0315426 Ga0496108_0315426_154_909 243
532 3300048913 Ga0496110_0554392 Ga0496110_0554392_150_890 243
533 3300048917 Ga0496114_0309552 Ga0496114_0309552_270_1004 243
534 3300048919 Ga0496116_0049936 Ga0496116_0049936_1814_2554 243
535 3300048920 Ga0496117_0105676 Ga0496117_0105676_306_1055 243
536 3300048921 Ga0496118_0121396 Ga0496118_0121396_764_1513 243
537 3300048921 Ga0496118_0165585 Ga0496118_0165585_268_1023 243
538 3300048923 Ga0496120_0043328 Ga0496120_0043328_149_889 243
539 3300048924 Ga0496121_0010185 Ga0496121_0010185_211_951 243
540 3300048924 Ga0496121_0024346 Ga0496121_0024346_4050_4799 243
541 3300048924 Ga0496121_0224226 Ga0496121_0224226_537_1277 243
542 3300048925 Ga0496122_0036642 Ga0496122_0036642_327_1067 243
543 3300048926 Ga0496123_0001524 Ga0496123_0001524_350_1090 243
544 3300048926 Ga0496123_0097718 Ga0496123_0097718_810_1550 243
545 3300048927 Ga0496124_0148175 Ga0496124_0148175_333_1073 243
546 3300048927 Ga0496124_0220984 Ga0496124_0220984_228_968 243
547 3300048928 Ga0496125_0000259 Ga0496125_0000259_108229_108969 243
548 3300048928 Ga0496125_0038754 Ga0496125_0038754_3246_3986 243
549 3300049460 Ga0495682_0041071 Ga0495682_0041071_304_1053 243
550 3300053077 Ga0495601_0080332 Ga0495601_0080332_464_1210 243
551 3300053088 Ga0500644_0026805 Ga0500644_0026805_327_1064 243
552 3300053093 Ga0500651_0038196 Ga0500651_0038196_314_1048 243
553 3300053136 Ga0500559_0000407 Ga0500559_0000407_2484_3218 243
554 3300053145 Ga0500586_030430 Ga0500586_030430_752_1489 243
555 3300053156 Ga0500622_0002189 Ga0500622_0002189_8910_9644 243
556 3300053739 Ga0500587_002215 Ga0500587_002215_247_981 243
557 iso_pu_bacteria 2510917013 2511088849 243
558 iso_pu_bacteria 2515154189 2516024380 243
559 iso_pu_bacteria 642555113 642621667 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

49

230

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9162 12 242
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.916 12 242
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.8723 15 224
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.8696 12 242
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.8691 12 242
ID Description Score Start End Superfamily
3ocrB00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9146 12 242 3.40.225.10
af_Q9U9K0_112_366_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9027 7 243 3.40.225.10
af_Q20952_347_604_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9017 8 242 3.40.225.10
af_F1QW07_135_388_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8986 12 216 3.40.225.10
af_Q7LKY2_67_324_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8964 12 243 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A4Z0BQ36-F1-model_v4 Aldolase 0.9898 9 243 GO:0005856
GO:0051015
AF-A0A3N7CBP8-F1-model_v4 Aldolase 0.9883 10 243 GO:0005856
GO:0051015
AF-I3UF68-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.988 10 243 GO:0005856
GO:0051015
AF-A0A5E4Z1N0-F1-model_v4 Decarboxylase NovR (EC 4.1.-.-) 0.983 91 243 GO:0005856
GO:0016829
GO:0051015
AF-A0A317H672-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9796 16 243 GO:0005856
GO:0051015

Feature Viewer

pLDDT pTM Quality
93.18 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map