F463541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 559 | 298 | 539 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100177921|Ga0068867_1001779212 |
| Length | 277 |
| Sequence | MALLQNRVGSAARACYRRLAWGVTKGEATVTISADQKDFDSSAVLGLREDLALALRAAALHGFAEGVCNHFSVELPDGSGRFLLNPRGLLWSEVHAGDIVLVDARGRTLAGRHPVEPTAMFIHGAIHRLGRKACVLHTHMPYATALTLTADRALDTTLSQNAMRFHGRVAVDANYNGLALDASEGERIATAMGGADVVFLGNHGIVVCGERMAHAYDDLYYLERACMAQVLAQSTGRPLVPVSASIAERVRDQTLGDRLQSELFFEALRRGTNVREK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 5 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 6 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 7 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 8 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 9 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 10 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 11 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 12 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 13 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 14 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 15 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 16 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 17 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 18 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 178 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 201 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 202 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 203 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 204 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 205 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 290 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 292 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 294 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 295 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 296 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 297 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 298 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.24 |
| Metatranscriptomes | 0 |
| Isolates | 3.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.55 |
| Nodule | 0 |
| Rhizoplane | 4.29 |
| Rhizosphere | 83.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10092629 | 3300003316 | Bacteria | 1196 |
| 2 | rootH1_10092629 | 3300003323 | Bacteria | 4461 |
| 3 | Ga0055538_1000016 | 3300003751 | Bacteria | 305460 |
| 4 | Ga0055539_1000021 | 3300003752 | Bacteria | 305460 |
| 5 | Ga0055533_1000029 | 3300003756 | Bacteria | 305460 |
| 6 | Ga0055525_1000033 | 3300003759 | Bacteria | 305460 |
| 7 | Ga0055526_1000408 | 3300003771 | Bacteria | 34699 |
| 8 | Ga0055540_1011166 | 3300003792 | Bacteria | 2923 |
| 9 | Ga0055531_10000335 | 3300003794 | Bacteria | 46442 |
| 10 | Ga0055541_1000029 | 3300003841 | Bacteria | 199874 |
| 11 | Ga0070658_10016034 | 3300005327 | Bacteria | 5993 |
| 12 | Ga0070658_10019434 | 3300005327 | Bacteria | 5440 |
| 13 | Ga0070676_10006948 | 3300005328 | Bacteria | 6060 |
| 14 | Ga0070676_10024066 | 3300005328 | Bacteria | 3427 |
| 15 | Ga0070676_10284427 | 3300005328 | Bacteria | 1115 |
| 16 | Ga0070683_100063997 | 3300005329 | Bacteria | 3422 |
| 17 | Ga0070683_100297509 | 3300005329 | Bacteria | 1535 |
| 18 | Ga0070690_100105668 | 3300005330 | Bacteria | 1872 |
| 19 | Ga0070670_100004394 | 3300005331 | Bacteria | 11799 |
| 20 | Ga0070670_100017775 | 3300005331 | Bacteria | 6101 |
| 21 | Ga0070670_100031309 | 3300005331 | Bacteria | 4581 |
| 22 | Ga0070670_100289376 | 3300005331 | Bacteria | 1431 |
| 23 | Ga0070670_100651970 | 3300005331 | Bacteria | 944 |
| 24 | Ga0070677_10042718 | 3300005333 | Bacteria | 1797 |
| 25 | Ga0070666_10038023 | 3300005335 | Bacteria | 3201 |
| 26 | Ga0068868_100001385 | 3300005338 | Bacteria | 16726 |
| 27 | Ga0068868_100014265 | 3300005338 | Bacteria | 5853 |
| 28 | Ga0068868_100126118 | 3300005338 | Bacteria | 2091 |
| 29 | Ga0070660_100537093 | 3300005339 | Bacteria | 975 |
| 30 | Ga0070689_100003084 | 3300005340 | Bacteria | 10987 |
| 31 | Ga0070687_100038672 | 3300005343 | Bacteria | 2393 |
| 32 | Ga0070661_100028113 | 3300005344 | Bacteria | 4055 |
| 33 | Ga0070661_100099626 | 3300005344 | Bacteria | 2160 |
| 34 | Ga0070661_100231958 | 3300005344 | Bacteria | 1419 |
| 35 | Ga0070661_100300839 | 3300005344 | Bacteria | 1249 |
| 36 | Ga0070668_100032340 | 3300005347 | Bacteria | 3981 |
| 37 | Ga0070668_100086213 | 3300005347 | Bacteria | 2469 |
| 38 | Ga0070669_100022316 | 3300005353 | Bacteria | 4527 |
| 39 | Ga0070669_100160686 | 3300005353 | Bacteria | 1746 |
| 40 | Ga0070669_100356796 | 3300005353 | Bacteria | 1188 |
| 41 | Ga0070669_100730641 | 3300005353 | Bacteria | 838 |
| 42 | Ga0070675_100002237 | 3300005354 | Bacteria | 14365 |
| 43 | Ga0070675_100072998 | 3300005354 | Bacteria | 2849 |
| 44 | Ga0070675_100111985 | 3300005354 | Bacteria | 2310 |
| 45 | Ga0070675_100227014 | 3300005354 | Bacteria | 1628 |
| 46 | Ga0070671_100002046 | 3300005355 | Bacteria | 15549 |
| 47 | Ga0070671_100007253 | 3300005355 | Bacteria | 8858 |
| 48 | Ga0070671_100007782 | 3300005355 | Bacteria | 8561 |
| 49 | Ga0070671_100034530 | 3300005355 | Bacteria | 4186 |
| 50 | Ga0070671_100039987 | 3300005355 | Bacteria | 3893 |
| 51 | Ga0070671_100156273 | 3300005355 | Bacteria | 1926 |
| 52 | Ga0070671_100248283 | 3300005355 | Bacteria | 1511 |
| 53 | Ga0070674_100287163 | 3300005356 | Bacteria | 1306 |
| 54 | Ga0070673_100000208 | 3300005364 | Bacteria | 29093 |
| 55 | Ga0070673_100002957 | 3300005364 | Bacteria | 10477 |
| 56 | Ga0070673_100304102 | 3300005364 | Bacteria | 1405 |
| 57 | Ga0070659_100028935 | 3300005366 | Bacteria | 4280 |
| 58 | Ga0070659_100046790 | 3300005366 | Bacteria | 3391 |
| 59 | Ga0070659_100058732 | 3300005366 | Bacteria | 3037 |
| 60 | Ga0070667_100001443 | 3300005367 | Bacteria | 21318 |
| 61 | Ga0070667_100028473 | 3300005367 | Bacteria | 4652 |
| 62 | Ga0070667_100051670 | 3300005367 | Bacteria | 3466 |
| 63 | Ga0070667_100077966 | 3300005367 | Bacteria | 2830 |
| 64 | Ga0070667_100089875 | 3300005367 | Bacteria | 2639 |
| 65 | Ga0070667_100415582 | 3300005367 | Bacteria | 1226 |
| 66 | Ga0070667_100548377 | 3300005367 | Bacteria | 1062 |
| 67 | Ga0070663_100002679 | 3300005455 | Bacteria | 10080 |
| 68 | Ga0070663_100011120 | 3300005455 | Bacteria | 5636 |
| 69 | Ga0070678_100001789 | 3300005456 | Bacteria | 11580 |
| 70 | Ga0070678_100006265 | 3300005456 | Bacteria | 6964 |
| 71 | Ga0070678_100042065 | 3300005456 | Bacteria | 3244 |
| 72 | Ga0070678_100220659 | 3300005456 | Bacteria | 1576 |
| 73 | Ga0070662_100095082 | 3300005457 | Bacteria | 2245 |
| 74 | Ga0068867_100022691 | 3300005459 | Bacteria | 4489 |
| 75 | Ga0068867_100030684 | 3300005459 | Bacteria | 3877 |
| 76 | Ga0068867_100139498 | 3300005459 | Bacteria | 1894 |
| 77 | Ga0068867_100177921 | 3300005459 | Bacteria | 1689 |
| 78 | Ga0070685_10123730 | 3300005466 | Bacteria | 1609 |
| 79 | Ga0070679_100035171 | 3300005530 | Bacteria | 4969 |
| 80 | Ga0070684_100004382 | 3300005535 | Bacteria | 10733 |
| 81 | Ga0070684_100110198 | 3300005535 | Bacteria | 2468 |
| 82 | Ga0068853_100045216 | 3300005539 | Bacteria | 3770 |
| 83 | Ga0068853_100087443 | 3300005539 | Bacteria | 2735 |
| 84 | Ga0068853_100091842 | 3300005539 | Bacteria | 2670 |
| 85 | Ga0068853_100139656 | 3300005539 | Bacteria | 2174 |
| 86 | Ga0068853_100219463 | 3300005539 | Bacteria | 1736 |
| 87 | Ga0070672_100004392 | 3300005543 | Bacteria | 9238 |
| 88 | Ga0070672_100015337 | 3300005543 | Bacteria | 5454 |
| 89 | Ga0070672_100036554 | 3300005543 | Bacteria | 3742 |
| 90 | Ga0070672_100074470 | 3300005543 | Bacteria | 2708 |
| 91 | Ga0070672_100152265 | 3300005543 | Bacteria | 1914 |
| 92 | Ga0070672_100307617 | 3300005543 | Bacteria | 1344 |
| 93 | Ga0070672_100349897 | 3300005543 | Bacteria | 1259 |
| 94 | Ga0070693_100119656 | 3300005547 | Bacteria | 1631 |
| 95 | Ga0070665_100008015 | 3300005548 | Bacteria | 10701 |
| 96 | Ga0070665_100208744 | 3300005548 | Bacteria | 1953 |
| 97 | Ga0070665_100281548 | 3300005548 | Bacteria | 1665 |
| 98 | Ga0070664_100094229 | 3300005564 | Bacteria | 2596 |
| 99 | Ga0070664_100247488 | 3300005564 | Bacteria | 1602 |
| 100 | Ga0070664_100324605 | 3300005564 | Bacteria | 1395 |
| 101 | Ga0068857_100072028 | 3300005577 | Bacteria | 3080 |
| 102 | Ga0068854_100015002 | 3300005578 | Bacteria | 5121 |
| 103 | Ga0068854_100018839 | 3300005578 | Bacteria | 4640 |
| 104 | Ga0068854_100021579 | 3300005578 | Bacteria | 4371 |
| 105 | Ga0068854_100023928 | 3300005578 | Bacteria | 4176 |
| 106 | Ga0068856_100009207 | 3300005614 | Bacteria | 9600 |
| 107 | Ga0070702_100086493 | 3300005615 | Bacteria | 1891 |
| 108 | Ga0068852_100029414 | 3300005616 | Bacteria | 4514 |
| 109 | Ga0068852_100054609 | 3300005616 | Bacteria | 3444 |
| 110 | Ga0068852_100067300 | 3300005616 | Bacteria | 3131 |
| 111 | Ga0068852_100072431 | 3300005616 | Bacteria | 3028 |
| 112 | Ga0068852_100233983 | 3300005616 | Bacteria | 1753 |
| 113 | Ga0068852_100372871 | 3300005616 | Bacteria | 1398 |
| 114 | Ga0068852_100488571 | 3300005616 | Bacteria | 1224 |
| 115 | Ga0068859_100001157 | 3300005617 | Bacteria | 26939 |
| 116 | Ga0068859_100407259 | 3300005617 | Bacteria | 1456 |
| 117 | Ga0068859_100615070 | 3300005617 | Bacteria | 1179 |
| 118 | Ga0068864_100000432 | 3300005618 | Bacteria | 36300 |
| 119 | Ga0068864_100009444 | 3300005618 | Bacteria | 8049 |
| 120 | Ga0068864_100011831 | 3300005618 | Bacteria | 7206 |
| 121 | Ga0068864_100176567 | 3300005618 | Bacteria | 1950 |
| 122 | Ga0068861_100004167 | 3300005719 | Bacteria | 9694 |
| 123 | Ga0068861_100011766 | 3300005719 | Bacteria | 6090 |
| 124 | Ga0068851_10001036 | 3300005834 | Bacteria | 12077 |
| 125 | Ga0068851_10014446 | 3300005834 | Bacteria | 3749 |
| 126 | Ga0068851_10049712 | 3300005834 | Bacteria | 2128 |
| 127 | Ga0068851_10079137 | 3300005834 | Bacteria | 1714 |
| 128 | Ga0068863_100027731 | 3300005841 | Bacteria | 5404 |
| 129 | Ga0068863_100113712 | 3300005841 | Bacteria | 2579 |
| 130 | Ga0068863_100217820 | 3300005841 | Bacteria | 1839 |
| 131 | Ga0068863_100625307 | 3300005841 | Bacteria | 1067 |
| 132 | Ga0068858_100000549 | 3300005842 | Bacteria | 39106 |
| 133 | Ga0068858_100002508 | 3300005842 | Bacteria | 18515 |
| 134 | Ga0068858_100046238 | 3300005842 | Bacteria | 4036 |
| 135 | Ga0068860_100003936 | 3300005843 | Bacteria | 15254 |
| 136 | Ga0068860_100103108 | 3300005843 | Bacteria | 2723 |
| 137 | Ga0068862_100076289 | 3300005844 | Bacteria | 2901 |
| 138 | Ga0068862_100105522 | 3300005844 | Bacteria | 2469 |
| 139 | Ga0070716_100140491 | 3300006173 | Unclassified | 1539 |
| 140 | Ga0070712_100090350 | 3300006175 | Bacteria | 2242 |
| 141 | Ga0075366_10054780 | 3300006195 | Bacteria | 2369 |
| 142 | Ga0097621_100008406 | 3300006237 | Bacteria | 7430 |
| 143 | Ga0097621_100009597 | 3300006237 | Bacteria | 7033 |
| 144 | Ga0097621_100103538 | 3300006237 | Bacteria | 2398 |
| 145 | Ga0097621_100144796 | 3300006237 | Bacteria | 2033 |
| 146 | Ga0068871_100005853 | 3300006358 | Bacteria | 8644 |
| 147 | Ga0068871_100016873 | 3300006358 | Bacteria | 5512 |
| 148 | Ga0068871_100030632 | 3300006358 | Bacteria | 4238 |
| 149 | Ga0068871_100057469 | 3300006358 | Bacteria | 3165 |
| 150 | Ga0068871_100176778 | 3300006358 | Bacteria | 1833 |
| 151 | Ga0075430_100026829 | 3300006846 | Bacteria | 4899 |
| 152 | Ga0075429_100001715 | 3300006880 | Bacteria | 18129 |
| 153 | Ga0068865_100034337 | 3300006881 | Bacteria | 3403 |
| 154 | Ga0068865_100215130 | 3300006881 | Bacteria | 1500 |
| 155 | Ga0068865_100493437 | 3300006881 | Bacteria | 1020 |
| 156 | Ga0097620_100001157 | 3300006931 | Bacteria | 26939 |
| 157 | Ga0097620_100407242 | 3300006931 | Bacteria | 1456 |
| 158 | Ga0097620_100615222 | 3300006931 | Bacteria | 1179 |
| 159 | Ga0111539_10755944 | 3300009094 | Bacteria | 1131 |
| 160 | Ga0105245_10175746 | 3300009098 | Bacteria | 2042 |
| 161 | Ga0105247_10226814 | 3300009101 | Bacteria | 1267 |
| 162 | Ga0114129_10444761 | 3300009147 | Bacteria | 1701 |
| 163 | Ga0105243_10146760 | 3300009148 | Bacteria | 2019 |
| 164 | Ga0105241_10035170 | 3300009174 | Bacteria | 3768 |
| 165 | Ga0105242_10112890 | 3300009176 | Bacteria | 2320 |
| 166 | Ga0105242_10255215 | 3300009176 | Bacteria | 1582 |
| 167 | Ga0105248_10000698 | 3300009177 | Bacteria | 37914 |
| 168 | Ga0105248_10004078 | 3300009177 | Bacteria | 16151 |
| 169 | Ga0105248_10016947 | 3300009177 | Bacteria | 8022 |
| 170 | Ga0105248_10026399 | 3300009177 | Bacteria | 6460 |
| 171 | Ga0105248_10031309 | 3300009177 | Bacteria | 5945 |
| 172 | Ga0105248_10438334 | 3300009177 | Bacteria | 1472 |
| 173 | Ga0105238_10014746 | 3300009551 | Bacteria | 7904 |
| 174 | Ga0105249_10152658 | 3300009553 | Bacteria | 2225 |
| 175 | Ga0105239_10037691 | 3300010375 | Bacteria | 5297 |
| 176 | Ga0157371_10053995 | 3300013102 | Bacteria | 2854 |
| 177 | Ga0157371_10204576 | 3300013102 | Bacteria | 1416 |
| 178 | Ga0157370_10036973 | 3300013104 | Bacteria | 4736 |
| 179 | Ga0157369_10128772 | 3300013105 | Bacteria | 2682 |
| 180 | Ga0157374_10011772 | 3300013296 | Bacteria | 7588 |
| 181 | Ga0157374_10028148 | 3300013296 | Bacteria | 5076 |
| 182 | Ga0157374_10118105 | 3300013296 | Bacteria | 2557 |
| 183 | Ga0157374_10121915 | 3300013296 | Bacteria | 2517 |
| 184 | Ga0157374_10292886 | 3300013296 | Bacteria | 1609 |
| 185 | Ga0157378_10615805 | 3300013297 | Bacteria | 1098 |
| 186 | Ga0163162_10002262 | 3300013306 | Bacteria | 18081 |
| 187 | Ga0163162_10012488 | 3300013306 | Bacteria | 8298 |
| 188 | Ga0163162_10022159 | 3300013306 | Bacteria | 6261 |
| 189 | Ga0163162_10137354 | 3300013306 | Bacteria | 2556 |
| 190 | Ga0163162_10262341 | 3300013306 | Bacteria | 1859 |
| 191 | Ga0157372_10011197 | 3300013307 | Bacteria | 9541 |
| 192 | Ga0157372_10011573 | 3300013307 | Bacteria | 9388 |
| 193 | Ga0157375_10006005 | 3300013308 | Bacteria | 10587 |
| 194 | Ga0157375_10008130 | 3300013308 | Bacteria | 9179 |
| 195 | Ga0157375_10147915 | 3300013308 | Bacteria | 2481 |
| 196 | Ga0157375_10185609 | 3300013308 | Bacteria | 2233 |
| 197 | Ga0157375_10187261 | 3300013308 | Bacteria | 2224 |
| 198 | Ga0163163_10003225 | 3300014325 | Bacteria | 13825 |
| 199 | Ga0163163_10180720 | 3300014325 | Bacteria | 2157 |
| 200 | Ga0163163_10331047 | 3300014325 | Bacteria | 1577 |
| 201 | Ga0157380_10004233 | 3300014326 | Bacteria | 9926 |
| 202 | Ga0157380_10205266 | 3300014326 | Bacteria | 1752 |
| 203 | Ga0157377_10022596 | 3300014745 | Bacteria | 3323 |
| 204 | Ga0157377_10249070 | 3300014745 | Bacteria | 1150 |
| 205 | Ga0157379_10002944 | 3300014968 | Bacteria | 14368 |
| 206 | Ga0157379_10015400 | 3300014968 | Bacteria | 6708 |
| 207 | Ga0157376_10009366 | 3300014969 | Bacteria | 7112 |
| 208 | Ga0157376_10047096 | 3300014969 | Bacteria | 3559 |
| 209 | Ga0182007_10001352 | 3300015262 | Bacteria | 13221 |
| 210 | Ga0182005_1040114 | 3300015265 | Bacteria | 1273 |
| 211 | Ga0213872_10069294 | 3300021361 | Bacteria | 1591 |
| 212 | Ga0213874_10021415 | 3300021377 | Bacteria | 1783 |
| 213 | Ga0213876_10165026 | 3300021384 | Bacteria | 1178 |
| 214 | Ga0209784_100033 | 3300025224 | Bacteria | 305649 |
| 215 | Ga0209566_100037 | 3300025225 | Bacteria | 305649 |
| 216 | Ga0209674_100055 | 3300025226 | Bacteria | 305649 |
| 217 | Ga0209563_100056 | 3300025230 | Bacteria | 305649 |
| 218 | Ga0209677_100034 | 3300025253 | Bacteria | 305649 |
| 219 | Ga0209759_1000085 | 3300025256 | Bacteria | 168382 |
| 220 | Ga0209673_1015460 | 3300025273 | Bacteria | 2899 |
| 221 | Ga0209676_1007163 | 3300025292 | Bacteria | 5320 |
| 222 | Ga0209564_1000192 | 3300025295 | Bacteria | 142456 |
| 223 | Ga0209050_1002492 | 3300025298 | Bacteria | 15567 |
| 224 | Ga0209051_1000406 | 3300025303 | Bacteria | 59626 |
| 225 | Ga0209051_1005054 | 3300025303 | Bacteria | 7852 |
| 226 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 227 | Ga0207697_10021644 | 3300025315 | Bacteria | 2633 |
| 228 | Ga0207656_10001964 | 3300025321 | Bacteria | 6841 |
| 229 | Ga0207656_10015358 | 3300025321 | Bacteria | 2963 |
| 230 | Ga0207682_10002757 | 3300025893 | Bacteria | 7782 |
| 231 | Ga0207682_10027124 | 3300025893 | Bacteria | 2280 |
| 232 | Ga0207682_10033308 | 3300025893 | Bacteria | 2074 |
| 233 | Ga0207682_10034606 | 3300025893 | Bacteria | 2037 |
| 234 | Ga0207682_10047669 | 3300025893 | Bacteria | 1765 |
| 235 | Ga0207642_10155595 | 3300025899 | Bacteria | 1222 |
| 236 | Ga0207642_10256240 | 3300025899 | Bacteria | 995 |
| 237 | Ga0207688_10055828 | 3300025901 | Bacteria | 2218 |
| 238 | Ga0207688_10109961 | 3300025901 | Bacteria | 1599 |
| 239 | Ga0207680_10044296 | 3300025903 | Bacteria | 2616 |
| 240 | Ga0207680_10064677 | 3300025903 | Bacteria | 2243 |
| 241 | Ga0207680_10192416 | 3300025903 | Bacteria | 1385 |
| 242 | Ga0207645_10029110 | 3300025907 | Bacteria | 3561 |
| 243 | Ga0207645_10149246 | 3300025907 | Bacteria | 1525 |
| 244 | Ga0207645_10189694 | 3300025907 | Bacteria | 1350 |
| 245 | Ga0207654_10047274 | 3300025911 | Bacteria | 2458 |
| 246 | Ga0207695_10356719 | 3300025913 | Bacteria | 1349 |
| 247 | Ga0207660_10081127 | 3300025917 | Bacteria | 2383 |
| 248 | Ga0207662_10114837 | 3300025918 | Bacteria | 1682 |
| 249 | Ga0207657_10009270 | 3300025919 | Bacteria | 9915 |
| 250 | Ga0207649_10104243 | 3300025920 | Bacteria | 1883 |
| 251 | Ga0207649_10161323 | 3300025920 | Bacteria | 1554 |
| 252 | Ga0207649_10218270 | 3300025920 | Bacteria | 1357 |
| 253 | Ga0207649_10342222 | 3300025920 | Bacteria | 1105 |
| 254 | Ga0207649_10558979 | 3300025920 | Bacteria | 876 |
| 255 | Ga0207652_10006621 | 3300025921 | Bacteria | 9336 |
| 256 | Ga0207681_10039991 | 3300025923 | Bacteria | 3117 |
| 257 | Ga0207694_10052151 | 3300025924 | Bacteria | 3171 |
| 258 | Ga0207694_10437154 | 3300025924 | Bacteria | 1091 |
| 259 | Ga0207650_10001927 | 3300025925 | Bacteria | 14611 |
| 260 | Ga0207650_10004463 | 3300025925 | Bacteria | 9563 |
| 261 | Ga0207650_10167057 | 3300025925 | Bacteria | 1746 |
| 262 | Ga0207650_10177651 | 3300025925 | Bacteria | 1695 |
| 263 | Ga0207659_10000613 | 3300025926 | Bacteria | 21295 |
| 264 | Ga0207659_10006804 | 3300025926 | Bacteria | 7028 |
| 265 | Ga0207659_10006975 | 3300025926 | Bacteria | 6941 |
| 266 | Ga0207659_10049646 | 3300025926 | Bacteria | 2977 |
| 267 | Ga0207659_10476108 | 3300025926 | Bacteria | 1054 |
| 268 | Ga0207687_10224758 | 3300025927 | Bacteria | 1480 |
| 269 | Ga0207644_10001441 | 3300025931 | Bacteria | 15328 |
| 270 | Ga0207644_10064177 | 3300025931 | Bacteria | 2668 |
| 271 | Ga0207644_10098327 | 3300025931 | Bacteria | 2193 |
| 272 | Ga0207644_10256093 | 3300025931 | Bacteria | 1398 |
| 273 | Ga0207644_10312976 | 3300025931 | Bacteria | 1268 |
| 274 | Ga0207644_10395575 | 3300025931 | Bacteria | 1129 |
| 275 | Ga0207690_10005755 | 3300025932 | Bacteria | 7327 |
| 276 | Ga0207690_10037500 | 3300025932 | Bacteria | 3147 |
| 277 | Ga0207706_10002250 | 3300025933 | Bacteria | 18839 |
| 278 | Ga0207706_10024015 | 3300025933 | Bacteria | 5470 |
| 279 | Ga0207706_10070983 | 3300025933 | Bacteria | 3063 |
| 280 | Ga0207706_10395110 | 3300025933 | Bacteria | 1199 |
| 281 | Ga0207686_10007697 | 3300025934 | Bacteria | 5809 |
| 282 | Ga0207709_10218256 | 3300025935 | Bacteria | 1373 |
| 283 | Ga0207669_10089803 | 3300025937 | Bacteria | 1996 |
| 284 | Ga0207704_10422108 | 3300025938 | Bacteria | 1057 |
| 285 | Ga0207665_10140252 | 3300025939 | Unclassified | 1723 |
| 286 | Ga0207665_10257557 | 3300025939 | Bacteria | 1291 |
| 287 | Ga0207691_10009449 | 3300025940 | Bacteria | 9363 |
| 288 | Ga0207691_10017950 | 3300025940 | Bacteria | 6703 |
| 289 | Ga0207691_10033902 | 3300025940 | Bacteria | 4753 |
| 290 | Ga0207691_10036793 | 3300025940 | Bacteria | 4534 |
| 291 | Ga0207691_10039782 | 3300025940 | Bacteria | 4349 |
| 292 | Ga0207691_10045914 | 3300025940 | Bacteria | 4016 |
| 293 | Ga0207691_10163186 | 3300025940 | Bacteria | 1954 |
| 294 | Ga0207691_10179535 | 3300025940 | Bacteria | 1850 |
| 295 | Ga0207691_10605636 | 3300025940 | Bacteria | 927 |
| 296 | Ga0207711_10021652 | 3300025941 | Bacteria | 5370 |
| 297 | Ga0207711_10156430 | 3300025941 | Bacteria | 2060 |
| 298 | Ga0207711_10235702 | 3300025941 | Bacteria | 1677 |
| 299 | Ga0207689_10002016 | 3300025942 | Bacteria | 19197 |
| 300 | Ga0207689_10114186 | 3300025942 | Bacteria | 2220 |
| 301 | Ga0207661_10140324 | 3300025944 | Bacteria | 2079 |
| 302 | Ga0207679_10052675 | 3300025945 | Bacteria | 2986 |
| 303 | Ga0207679_10067811 | 3300025945 | Bacteria | 2678 |
| 304 | Ga0207679_10183446 | 3300025945 | Bacteria | 1733 |
| 305 | Ga0207679_10281676 | 3300025945 | Bacteria | 1426 |
| 306 | Ga0207679_10384702 | 3300025945 | Bacteria | 1231 |
| 307 | Ga0207679_10495270 | 3300025945 | Bacteria | 1090 |
| 308 | Ga0207667_10012340 | 3300025949 | Bacteria | 9855 |
| 309 | Ga0207667_10399417 | 3300025949 | Bacteria | 1400 |
| 310 | Ga0207651_10001658 | 3300025960 | Bacteria | 10220 |
| 311 | Ga0207651_10016755 | 3300025960 | Bacteria | 4305 |
| 312 | Ga0207712_10062405 | 3300025961 | Bacteria | 2649 |
| 313 | Ga0207668_10775860 | 3300025972 | Bacteria | 847 |
| 314 | Ga0207640_10031947 | 3300025981 | Bacteria | 3260 |
| 315 | Ga0207640_10094930 | 3300025981 | Bacteria | 2075 |
| 316 | Ga0207640_10104194 | 3300025981 | Bacteria | 1996 |
| 317 | Ga0207658_10020131 | 3300025986 | Bacteria | 4620 |
| 318 | Ga0207658_10037102 | 3300025986 | Bacteria | 3499 |
| 319 | Ga0207658_10052288 | 3300025986 | Bacteria | 3014 |
| 320 | Ga0207658_10078940 | 3300025986 | Bacteria | 2516 |
| 321 | Ga0207658_10171845 | 3300025986 | Bacteria | 1786 |
| 322 | Ga0207658_10574046 | 3300025986 | Bacteria | 1011 |
| 323 | Ga0207677_10005023 | 3300026023 | Bacteria | 7147 |
| 324 | Ga0207677_10018002 | 3300026023 | Bacteria | 4230 |
| 325 | Ga0207677_10060915 | 3300026023 | Bacteria | 2611 |
| 326 | Ga0207703_10004113 | 3300026035 | Bacteria | 12014 |
| 327 | Ga0207703_10004562 | 3300026035 | Bacteria | 11356 |
| 328 | Ga0207703_10051221 | 3300026035 | Bacteria | 3344 |
| 329 | Ga0207639_10016858 | 3300026041 | Bacteria | 5176 |
| 330 | Ga0207639_10063375 | 3300026041 | Bacteria | 2862 |
| 331 | Ga0207639_10097035 | 3300026041 | Bacteria | 2373 |
| 332 | Ga0207639_10099327 | 3300026041 | Bacteria | 2348 |
| 333 | Ga0207639_10335176 | 3300026041 | Bacteria | 1347 |
| 334 | Ga0207639_10995212 | 3300026041 | Bacteria | 785 |
| 335 | Ga0207678_10002002 | 3300026067 | Bacteria | 18551 |
| 336 | Ga0207678_10003973 | 3300026067 | Bacteria | 13303 |
| 337 | Ga0207678_10148811 | 3300026067 | Bacteria | 1999 |
| 338 | Ga0207708_10466257 | 3300026075 | Bacteria | 1054 |
| 339 | Ga0207641_10019319 | 3300026088 | Bacteria | 5592 |
| 340 | Ga0207641_10022727 | 3300026088 | Bacteria | 5163 |
| 341 | Ga0207641_10299484 | 3300026088 | Bacteria | 1518 |
| 342 | Ga0207641_10708079 | 3300026088 | Bacteria | 992 |
| 343 | Ga0207648_10003265 | 3300026089 | Bacteria | 17047 |
| 344 | Ga0207648_10066499 | 3300026089 | Bacteria | 3144 |
| 345 | Ga0207648_10157255 | 3300026089 | Bacteria | 2006 |
| 346 | Ga0207676_10026552 | 3300026095 | Bacteria | 4308 |
| 347 | Ga0207676_10032370 | 3300026095 | Bacteria | 3939 |
| 348 | Ga0207676_10139127 | 3300026095 | Bacteria | 2076 |
| 349 | Ga0207675_100002143 | 3300026118 | Bacteria | 19595 |
| 350 | Ga0207675_100101122 | 3300026118 | Bacteria | 2716 |
| 351 | Ga0207675_100404460 | 3300026118 | Bacteria | 1346 |
| 352 | Ga0207675_100587362 | 3300026118 | Bacteria | 1116 |
| 353 | Ga0207683_10000445 | 3300026121 | Bacteria | 38259 |
| 354 | Ga0207683_10004867 | 3300026121 | Bacteria | 11556 |
| 355 | Ga0207683_10007627 | 3300026121 | Bacteria | 9267 |
| 356 | Ga0207683_10028982 | 3300026121 | Bacteria | 4791 |
| 357 | Ga0207683_10038099 | 3300026121 | Bacteria | 4188 |
| 358 | Ga0207683_10039290 | 3300026121 | Bacteria | 4128 |
| 359 | Ga0207683_10099350 | 3300026121 | Bacteria | 2597 |
| 360 | Ga0207683_10111363 | 3300026121 | Bacteria | 2451 |
| 361 | Ga0207698_10002093 | 3300026142 | Bacteria | 11776 |
| 362 | Ga0207698_10039238 | 3300026142 | Bacteria | 3506 |
| 363 | Ga0207698_10045721 | 3300026142 | Bacteria | 3300 |
| 364 | Ga0207698_10145524 | 3300026142 | Bacteria | 2049 |
| 365 | Ga0207698_10208566 | 3300026142 | Bacteria | 1756 |
| 366 | Ga0207698_10223599 | 3300026142 | Bacteria | 1703 |
| 367 | Ga0207698_10225474 | 3300026142 | Bacteria | 1697 |
| 368 | Ga0207698_10497478 | 3300026142 | Bacteria | 1186 |
| 369 | Ga0207428_10026770 | 3300027907 | Bacteria | 4807 |
| 370 | Ga0268266_10071852 | 3300028379 | Bacteria | 2999 |
| 371 | Ga0268266_10138278 | 3300028379 | Bacteria | 2184 |
| 372 | Ga0268266_10658572 | 3300028379 | Bacteria | 1008 |
| 373 | Ga0268265_10222954 | 3300028380 | Bacteria | 1651 |
| 374 | Ga0268264_10011062 | 3300028381 | Bacteria | 7452 |
| 375 | Ga0268264_10715738 | 3300028381 | Bacteria | 995 |
| 376 | Ga0307515_10000734 | 3300028794 | Bacteria | 75701 |
| 377 | Ga0307509_10028460 | 3300031507 | Bacteria | 6212 |
| 378 | Ga0307516_10147395 | 3300031730 | Bacteria | 2118 |
| 379 | Ga0307405_10000985 | 3300031731 | Bacteria | 11438 |
| 380 | Ga0307410_10041726 | 3300031852 | Bacteria | 3027 |
| 381 | Ga0307410_10255142 | 3300031852 | Bacteria | 1365 |
| 382 | Ga0307406_10136771 | 3300031901 | Bacteria | 1728 |
| 383 | Ga0307406_10232028 | 3300031901 | Bacteria | 1379 |
| 384 | Ga0307412_10000270 | 3300031911 | Bacteria | 33288 |
| 385 | Ga0307412_10221628 | 3300031911 | Bacteria | 1450 |
| 386 | Ga0307412_10403393 | 3300031911 | Bacteria | 1114 |
| 387 | Ga0307409_100039179 | 3300031995 | Bacteria | 3514 |
| 388 | Ga0307416_100003852 | 3300032002 | Bacteria | 8926 |
| 389 | Ga0307416_100250526 | 3300032002 | Bacteria | 1723 |
| 390 | Ga0307416_100382439 | 3300032002 | Bacteria | 1438 |
| 391 | Ga0307411_10188189 | 3300032005 | Bacteria | 1573 |
| 392 | Ga0307411_10631236 | 3300032005 | Bacteria | 925 |
| 393 | Ga0307415_100024939 | 3300032126 | Bacteria | 3744 |
| 394 | Ga0307415_100043558 | 3300032126 | Bacteria | 2995 |
| 395 | Ga0373960_0013118 | 3300035121 | Bacteria | 2073 |
| 396 | Ga0373943_0040716 | 3300035170 | Bacteria | 2244 |
| 397 | Ga0373955_0026317 | 3300035172 | Bacteria | 2996 |
| 398 | Ga0373924_0158271 | 3300035410 | Bacteria | 993 |
| 399 | Ga0373927_0232350 | 3300035695 | Bacteria | 1212 |
| 400 | Ga0373947_0057500 | 3300035725 | Bacteria | 2354 |
| 401 | Ga0373937_0088970 | 3300036401 | Bacteria | 2859 |
| 402 | Ga0373937_0951305 | 3300036401 | Bacteria | 808 |
| 403 | Ga0373925_0001876 | 3300037068 | Bacteria | 17464 |
| 404 | Ga0395899_0165916 | 3300037312 | Bacteria | 1558 |
| 405 | Ga0395900_0044024 | 3300037418 | Bacteria | 4601 |
| 406 | Ga0395900_0180361 | 3300037418 | Bacteria | 2146 |
| 407 | Ga0395900_0371117 | 3300037418 | Bacteria | 1401 |
| 408 | Ga0395900_0656895 | 3300037418 | Bacteria | 985 |
| 409 | Ga0395905_0000312 | 3300037471 | Bacteria | 70621 |
| 410 | Ga0395905_0025035 | 3300037471 | Bacteria | 5629 |
| 411 | Ga0395905_0036400 | 3300037471 | Bacteria | 4622 |
| 412 | Ga0395905_0218271 | 3300037471 | Bacteria | 1785 |
| 413 | Ga0395905_0574995 | 3300037471 | Bacteria | 1028 |
| 414 | Ga0436365_1313220 | 3300039437 | Bacteria | 3150 |
| 415 | Ga0436363_0656129 | 3300039450 | Bacteria | 2044 |
| 416 | Ga0451807_0127149 | 3300041486 | Bacteria | 1274 |
| 417 | Ga0439437_010440 | 3300042000 | Bacteria | 1056 |
| 418 | Ga0439454_017509 | 3300042011 | Bacteria | 1024 |
| 419 | Ga0439455_0028235 | 3300042012 | Bacteria | 1380 |
| 420 | Ga0450923_019358 | 3300042125 | Bacteria | 1311 |
| 421 | Ga0450897_008939 | 3300042128 | Bacteria | 940 |
| 422 | Ga0439446_0018488 | 3300042156 | Bacteria | 1953 |
| 423 | Ga0439464_0016497 | 3300042439 | Bacteria | 1997 |
| 424 | Ga0451577_0001585 | 3300042876 | Bacteria | 29675 |
| 425 | Ga0451577_0045792 | 3300042876 | Bacteria | 3915 |
| 426 | Ga0466969_0010651 | 3300044656 | Bacteria | 4872 |
| 427 | Ga0466980_0320303 | 3300044668 | Bacteria | 921 |
| 428 | Ga0466961_0064192 | 3300044693 | Bacteria | 2333 |
| 429 | Ga0453684_0101796 | 3300044712 | Bacteria | 3514 |
| 430 | Ga0466968_0085038 | 3300044735 | Bacteria | 1395 |
| 431 | Ga0466959_0010943 | 3300045049 | Bacteria | 6508 |
| 432 | Ga0451576_0006641 | 3300045051 | Bacteria | 14132 |
| 433 | Ga0495629_0000097 | 3300046459 | Bacteria | 76355 |
| 434 | Ga0495638_0023425 | 3300046460 | Bacteria | 4038 |
| 435 | Ga0495651_0053412 | 3300046462 | Bacteria | 3110 |
| 436 | Ga0495653_0000492 | 3300046463 | Bacteria | 30476 |
| 437 | Ga0495580_0016480 | 3300046472 | Bacteria | 5543 |
| 438 | Ga0495585_0135291 | 3300046492 | Bacteria | 1294 |
| 439 | Ga0495608_0013471 | 3300046511 | Bacteria | 5671 |
| 440 | Ga0495610_0025864 | 3300046512 | Bacteria | 3142 |
| 441 | Ga0495628_0012727 | 3300046516 | Bacteria | 7088 |
| 442 | Ga0495628_0070195 | 3300046516 | Bacteria | 2731 |
| 443 | Ga0495632_0011183 | 3300046519 | Bacteria | 5255 |
| 444 | Ga0495648_0125269 | 3300046524 | Bacteria | 1374 |
| 445 | Ga0495652_0025575 | 3300046529 | Bacteria | 5219 |
| 446 | Ga0495665_0045421 | 3300046531 | Bacteria | 2333 |
| 447 | Ga0495586_0040380 | 3300046535 | Bacteria | 2510 |
| 448 | Ga0495598_0019164 | 3300046537 | Bacteria | 1790 |
| 449 | Ga0495598_0040206 | 3300046537 | Bacteria | 1363 |
| 450 | Ga0495621_0010291 | 3300046539 | Bacteria | 2855 |
| 451 | Ga0495645_0099226 | 3300046543 | Bacteria | 2072 |
| 452 | Ga0495645_0278768 | 3300046543 | Bacteria | 1100 |
| 453 | Ga0495633_0002088 | 3300046558 | Bacteria | 14370 |
| 454 | Ga0495668_0142450 | 3300046616 | Bacteria | 1312 |
| 455 | Ga0495623_0002148 | 3300046679 | Bacteria | 13170 |
| 456 | Ga0495623_0004122 | 3300046679 | Bacteria | 9577 |
| 457 | Ga0495646_0012250 | 3300046680 | Bacteria | 5452 |
| 458 | Ga0495647_0063980 | 3300046681 | Bacteria | 1458 |
| 459 | Ga0495658_0376679 | 3300046683 | Bacteria | 903 |
| 460 | Ga0495613_0013480 | 3300046689 | Bacteria | 6071 |
| 461 | Ga0495624_0003071 | 3300046690 | Bacteria | 12500 |
| 462 | Ga0495624_0057483 | 3300046690 | Bacteria | 2445 |
| 463 | Ga0495670_0274542 | 3300046691 | Bacteria | 901 |
| 464 | Ga0495649_0143761 | 3300046694 | Bacteria | 1254 |
| 465 | Ga0495604_0000652 | 3300047317 | Bacteria | 29535 |
| 466 | Ga0495604_0408087 | 3300047317 | Bacteria | 894 |
| 467 | Ga0495636_0155742 | 3300047318 | Bacteria | 1027 |
| 468 | Ga0495674_0018134 | 3300047319 | Bacteria | 6551 |
| 469 | Ga0495674_0024704 | 3300047319 | Bacteria | 5515 |
| 470 | Ga0495676_0039607 | 3300047321 | Bacteria | 3901 |
| 471 | Ga0495680_0007557 | 3300047322 | Bacteria | 9940 |
| 472 | Ga0495675_0199475 | 3300047444 | Bacteria | 1218 |
| 473 | Ga0495684_0125177 | 3300047471 | Bacteria | 1934 |
| 474 | Ga0495593_0005339 | 3300047673 | Bacteria | 7600 |
| 475 | Ga0495602_0031604 | 3300048088 | Bacteria | 5001 |
| 476 | Ga0495602_0050048 | 3300048088 | Bacteria | 3737 |
| 477 | Ga0495602_0052361 | 3300048088 | Bacteria | 3627 |
| 478 | Ga0495614_0057743 | 3300048089 | Bacteria | 1666 |
| 479 | Ga0496100_0024378 | 3300048903 | Bacteria | 3690 |
| 480 | Ga0496101_0006534 | 3300048904 | Bacteria | 7509 |
| 481 | Ga0496101_0186403 | 3300048904 | Bacteria | 1600 |
| 482 | Ga0496101_0218236 | 3300048904 | Bacteria | 1479 |
| 483 | Ga0496102_0007822 | 3300048905 | Bacteria | 9137 |
| 484 | Ga0496103_0225803 | 3300048906 | Bacteria | 1204 |
| 485 | Ga0496104_0000665 | 3300048907 | Bacteria | 29449 |
| 486 | Ga0496104_0026891 | 3300048907 | Bacteria | 5319 |
| 487 | Ga0496105_0006488 | 3300048908 | Bacteria | 8995 |
| 488 | Ga0496105_0028317 | 3300048908 | Bacteria | 4582 |
| 489 | Ga0496106_0026787 | 3300048909 | Bacteria | 4293 |
| 490 | Ga0496106_0028482 | 3300048909 | Bacteria | 4161 |
| 491 | Ga0496107_0013186 | 3300048910 | Bacteria | 5775 |
| 492 | Ga0496108_0121203 | 3300048911 | Bacteria | 2243 |
| 493 | Ga0496108_0315426 | 3300048911 | Bacteria | 1363 |
| 494 | Ga0496109_0050836 | 3300048912 | Bacteria | 3774 |
| 495 | Ga0496110_0238787 | 3300048913 | Bacteria | 1653 |
| 496 | Ga0496110_0554392 | 3300048913 | Bacteria | 1044 |
| 497 | Ga0496111_0423926 | 3300048914 | Bacteria | 983 |
| 498 | Ga0496114_0234667 | 3300048917 | Bacteria | 1612 |
| 499 | Ga0496114_0309552 | 3300048917 | Bacteria | 1395 |
| 500 | Ga0496115_0013108 | 3300048918 | Bacteria | 6260 |
| 501 | Ga0496116_0049936 | 3300048919 | Bacteria | 2791 |
| 502 | Ga0496117_0105676 | 3300048920 | Bacteria | 1769 |
| 503 | Ga0496118_0121396 | 3300048921 | Bacteria | 1702 |
| 504 | Ga0496118_0165585 | 3300048921 | Bacteria | 1359 |
| 505 | Ga0496120_0043328 | 3300048923 | Bacteria | 2622 |
| 506 | Ga0496121_0010185 | 3300048924 | Bacteria | 10645 |
| 507 | Ga0496121_0024346 | 3300048924 | Bacteria | 5793 |
| 508 | Ga0496121_0224226 | 3300048924 | Bacteria | 1321 |
| 509 | Ga0496122_0036642 | 3300048925 | Bacteria | 3961 |
| 510 | Ga0496123_0001524 | 3300048926 | Bacteria | 32014 |
| 511 | Ga0496123_0097718 | 3300048926 | Bacteria | 1719 |
| 512 | Ga0496124_0148175 | 3300048927 | Bacteria | 1844 |
| 513 | Ga0496124_0220984 | 3300048927 | Bacteria | 1424 |
| 514 | Ga0496125_0000259 | 3300048928 | Bacteria | 109184 |
| 515 | Ga0496125_0038754 | 3300048928 | Bacteria | 4116 |
| 516 | Ga0495682_0041071 | 3300049460 | Bacteria | 1695 |
| 517 | Ga0501034_0660059 | 3300049571 | Bacteria | 947 |
| 518 | Ga0501036_0524661 | 3300049572 | Bacteria | 985 |
| 519 | Ga0501037_0510445 | 3300049573 | Bacteria | 815 |
| 520 | Ga0501039_0299750 | 3300049575 | Bacteria | 1264 |
| 521 | Ga0501035_0117684 | 3300049822 | Bacteria | 2325 |
| 522 | Ga0501035_0534063 | 3300049822 | Bacteria | 962 |
| 523 | Ga0501044_0069189 | 3300049823 | Bacteria | 3594 |
| 524 | Ga0501044_0155156 | 3300049823 | Bacteria | 2269 |
| 525 | nmdc:mga0yw44_3473_c1 | 3300050492 | Bacteria | 7002 |
| 526 | nmdc:mga0k408_25505_c1 | 3300050493 | Bacteria | 3348 |
| 527 | nmdc:mga09592_2210_c1 | 3300050508 | Bacteria | 15665 |
| 528 | nmdc:mga0qj67_45649_c1 | 3300050509 | Bacteria | 3457 |
| 529 | Ga0495601_0080332 | 3300053077 | Bacteria | 2092 |
| 530 | Ga0495619_0137102 | 3300053085 | Bacteria | 1684 |
| 531 | Ga0500643_001038 | 3300053087 | Bacteria | 16880 |
| 532 | Ga0500643_005966 | 3300053087 | Bacteria | 5161 |
| 533 | Ga0500644_0026805 | 3300053088 | Bacteria | 1786 |
| 534 | Ga0500651_0038196 | 3300053093 | Bacteria | 3025 |
| 535 | Ga0500559_0000407 | 3300053136 | Bacteria | 30942 |
| 536 | Ga0500586_030430 | 3300053145 | Bacteria | 1775 |
| 537 | Ga0500622_0002189 | 3300053156 | Bacteria | 14442 |
| 538 | Ga0500587_002215 | 3300053739 | Bacteria | 2768 |
| 539 | Ga0466962_0109182 | 3300061719 | Bacteria | 1331 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046691 | Ga0495670_0274542 | Ga0495670_0274542_171_887 | 216 |
| 2 | 3300053085 | Ga0495619_0137102 | Ga0495619_0137102_148_825 | 225 |
| 3 | 3300006173 | Ga0070716_100140491 | Ga0070716_1001404912 | 226 |
| 4 | 3300006175 | Ga0070712_100090350 | Ga0070712_1000903502 | 226 |
| 5 | 3300025939 | Ga0207665_10140252 | Ga0207665_101402522 | 226 |
| 6 | 3300005355 | Ga0070671_100248283 | Ga0070671_1002482832 | 227 |
| 7 | 3300005367 | Ga0070667_100089875 | Ga0070667_1000898753 | 227 |
| 8 | 3300005841 | Ga0068863_100625307 | Ga0068863_1006253071 | 227 |
| 9 | 3300013306 | Ga0163162_10012488 | Ga0163162_100124885 | 227 |
| 10 | 3300025986 | Ga0207658_10037102 | Ga0207658_100371024 | 227 |
| 11 | 3300026088 | Ga0207641_10708079 | Ga0207641_107080791 | 227 |
| 12 | 3300026121 | Ga0207683_10039290 | Ga0207683_100392901 | 227 |
| 13 | 3300037418 | Ga0395900_0371117 | Ga0395900_0371117_65_769 | 227 |
| 14 | 3300037471 | Ga0395905_0000312 | Ga0395905_0000312_25288_25992 | 227 |
| 15 | 3300048904 | Ga0496101_0006534 | Ga0496101_0006534_6675_7424 | 227 |
| 16 | 3300048905 | Ga0496102_0007822 | Ga0496102_0007822_2188_2937 | 227 |
| 17 | 3300048907 | Ga0496104_0000665 | Ga0496104_0000665_23798_24547 | 227 |
| 18 | 3300048908 | Ga0496105_0006488 | Ga0496105_0006488_6710_7459 | 227 |
| 19 | 3300048909 | Ga0496106_0028482 | Ga0496106_0028482_1368_2117 | 227 |
| 20 | 3300046543 | Ga0495645_0099226 | Ga0495645_0099226_1089_1841 | 229 |
| 21 | 3300031911 | Ga0307412_10403393 | Ga0307412_104033931 | 231 |
| 22 | 3300015265 | Ga0182005_1040114 | Ga0182005_10401141 | 232 |
| 23 | 3300028794 | Ga0307515_10000734 | Ga0307515_1000073442 | 232 |
| 24 | 3300049571 | Ga0501034_0660059 | Ga0501034_0660059_18_728 | 232 |
| 25 | 3300005354 | Ga0070675_100227014 | Ga0070675_1002270143 | 236 |
| 26 | 3300005367 | Ga0070667_100415582 | Ga0070667_1004155822 | 236 |
| 27 | 3300005578 | Ga0068854_100021579 | Ga0068854_1000215795 | 236 |
| 28 | 3300005616 | Ga0068852_100233983 | Ga0068852_1002339833 | 236 |
| 29 | 3300053087 | Ga0500643_001038 | Ga0500643_001038_9317_10042 | 236 |
| 30 | 3300053087 | Ga0500643_005966 | Ga0500643_005966_626_1351 | 236 |
| 31 | 3300025893 | Ga0207682_10033308 | Ga0207682_100333083 | 237 |
| 32 | 3300025920 | Ga0207649_10558979 | Ga0207649_105589791 | 237 |
| 33 | 3300025926 | Ga0207659_10476108 | Ga0207659_104761081 | 237 |
| 34 | 3300025986 | Ga0207658_10574046 | Ga0207658_105740462 | 237 |
| 35 | 3300026142 | Ga0207698_10497478 | Ga0207698_104974782 | 237 |
| 36 | 3300037471 | Ga0395905_0036400 | Ga0395905_0036400_2503_3288 | 237 |
| 37 | iso_pu_bacteria | 2501025502 | 2501077356 | 237 |
| 38 | iso_pu_bacteria | 2643221609 | 2644057964 | 237 |
| 39 | iso_pu_bacteria | 2738543012 | 2739242249 | 237 |
| 40 | iso_pu_bacteria | 2816332133 | 2816470133 | 237 |
| 41 | iso_pu_bacteria | 2932422444 | 2932425228 | 237 |
| 42 | 3300005539 | Ga0068853_100139656 | Ga0068853_1001396561 | 239 |
| 43 | 3300025303 | Ga0209051_1005054 | Ga0209051_10050545 | 239 |
| 44 | 3300026041 | Ga0207639_10995212 | Ga0207639_109952121 | 239 |
| 45 | 3300037418 | Ga0395900_0656895 | Ga0395900_0656895_194_913 | 239 |
| 46 | 3300042876 | Ga0451577_0001585 | Ga0451577_0001585_25826_26560 | 239 |
| 47 | 3300042876 | Ga0451577_0045792 | Ga0451577_0045792_1391_2146 | 239 |
| 48 | 3300044712 | Ga0453684_0101796 | Ga0453684_0101796_2267_3022 | 239 |
| 49 | 3300045051 | Ga0451576_0006641 | Ga0451576_0006641_9888_10643 | 239 |
| 50 | 3300046492 | Ga0495585_0135291 | Ga0495585_0135291_413_1132 | 239 |
| 51 | 3300046616 | Ga0495668_0142450 | Ga0495668_0142450_19_738 | 239 |
| 52 | 3300050492 | nmdc:mga0yw44_3473_c1 | nmdc:mga0yw44_3473_c1_50_781 | 239 |
| 53 | iso_pu_bacteria | 2599185292 | 2599907797 | 239 |
| 54 | iso_pu_bacteria | 2643221569 | 2643861058 | 239 |
| 55 | iso_pu_bacteria | 2643221594 | 2643981022 | 239 |
| 56 | iso_pu_bacteria | 2643221621 | 2644124358 | 239 |
| 57 | iso_pu_bacteria | 2808606395 | 2809034890 | 239 |
| 58 | iso_pu_bacteria | 2857537821 | 2857540472 | 239 |
| 59 | iso_pu_bacteria | 2900634093 | 2900634733 | 239 |
| 60 | iso_pu_bacteria | 2941479691 | 2941484380 | 239 |
| 61 | iso_pu_bacteria | 8055225921 | 8055228305 | 239 |
| 62 | 3300031852 | Ga0307410_10255142 | Ga0307410_102551422 | 240 |
| 63 | 3300031911 | Ga0307412_10221628 | Ga0307412_102216282 | 240 |
| 64 | 3300031995 | Ga0307409_100039179 | Ga0307409_1000391793 | 240 |
| 65 | 3300032002 | Ga0307416_100003852 | Ga0307416_1000038526 | 240 |
| 66 | 3300032126 | Ga0307415_100024939 | Ga0307415_1000249393 | 240 |
| 67 | 3300037312 | Ga0395899_0165916 | Ga0395899_0165916_426_1157 | 240 |
| 68 | 3300037418 | Ga0395900_0044024 | Ga0395900_0044024_3005_3736 | 240 |
| 69 | 3300037471 | Ga0395905_0025035 | Ga0395905_0025035_183_914 | 240 |
| 70 | 3300046558 | Ga0495633_0002088 | Ga0495633_0002088_12295_13077 | 240 |
| 71 | iso_pu_bacteria | 2643221660 | 2644338327 | 240 |
| 72 | 3300005328 | Ga0070676_10024066 | Ga0070676_100240662 | 241 |
| 73 | 3300005331 | Ga0070670_100289376 | Ga0070670_1002893762 | 241 |
| 74 | 3300005331 | Ga0070670_100651970 | Ga0070670_1006519701 | 241 |
| 75 | 3300005338 | Ga0068868_100126118 | Ga0068868_1001261182 | 241 |
| 76 | 3300005339 | Ga0070660_100537093 | Ga0070660_1005370931 | 241 |
| 77 | 3300005347 | Ga0070668_100086213 | Ga0070668_1000862132 | 241 |
| 78 | 3300005353 | Ga0070669_100022316 | Ga0070669_1000223163 | 241 |
| 79 | 3300005366 | Ga0070659_100028935 | Ga0070659_1000289352 | 241 |
| 80 | 3300005455 | Ga0070663_100011120 | Ga0070663_1000111203 | 241 |
| 81 | 3300005539 | Ga0068853_100045216 | Ga0068853_1000452163 | 241 |
| 82 | 3300005543 | Ga0070672_100307617 | Ga0070672_1003076171 | 241 |
| 83 | 3300005564 | Ga0070664_100324605 | Ga0070664_1003246052 | 241 |
| 84 | 3300005578 | Ga0068854_100018839 | Ga0068854_1000188394 | 241 |
| 85 | 3300005615 | Ga0070702_100086493 | Ga0070702_1000864932 | 241 |
| 86 | 3300005616 | Ga0068852_100067300 | Ga0068852_1000673003 | 241 |
| 87 | 3300005617 | Ga0068859_100615070 | Ga0068859_1006150702 | 241 |
| 88 | 3300005719 | Ga0068861_100004167 | Ga0068861_1000041677 | 241 |
| 89 | 3300005834 | Ga0068851_10014446 | Ga0068851_100144462 | 241 |
| 90 | 3300005842 | Ga0068858_100046238 | Ga0068858_1000462382 | 241 |
| 91 | 3300005843 | Ga0068860_100103108 | Ga0068860_1001031082 | 241 |
| 92 | 3300005844 | Ga0068862_100076289 | Ga0068862_1000762891 | 241 |
| 93 | 3300006195 | Ga0075366_10054780 | Ga0075366_100547802 | 241 |
| 94 | 3300006237 | Ga0097621_100103538 | Ga0097621_1001035382 | 241 |
| 95 | 3300006358 | Ga0068871_100005853 | Ga0068871_1000058532 | 241 |
| 96 | 3300006931 | Ga0097620_100615222 | Ga0097620_1006152222 | 241 |
| 97 | 3300009147 | Ga0114129_10444761 | Ga0114129_104447611 | 241 |
| 98 | 3300009174 | Ga0105241_10035170 | Ga0105241_100351703 | 241 |
| 99 | 3300009177 | Ga0105248_10004078 | Ga0105248_100040783 | 241 |
| 100 | 3300010375 | Ga0105239_10037691 | Ga0105239_100376915 | 241 |
| 101 | 3300013102 | Ga0157371_10053995 | Ga0157371_100539953 | 241 |
| 102 | 3300013296 | Ga0157374_10011772 | Ga0157374_100117728 | 241 |
| 103 | 3300013306 | Ga0163162_10022159 | Ga0163162_100221592 | 241 |
| 104 | 3300013307 | Ga0157372_10011197 | Ga0157372_100111971 | 241 |
| 105 | 3300014745 | Ga0157377_10022596 | Ga0157377_100225962 | 241 |
| 106 | 3300014968 | Ga0157379_10015400 | Ga0157379_100154002 | 241 |
| 107 | 3300014969 | Ga0157376_10047096 | Ga0157376_100470963 | 241 |
| 108 | 3300025893 | Ga0207682_10034606 | Ga0207682_100346062 | 241 |
| 109 | 3300025901 | Ga0207688_10055828 | Ga0207688_100558283 | 241 |
| 110 | 3300025907 | Ga0207645_10029110 | Ga0207645_100291102 | 241 |
| 111 | 3300025911 | Ga0207654_10047274 | Ga0207654_100472742 | 241 |
| 112 | 3300025923 | Ga0207681_10039991 | Ga0207681_100399912 | 241 |
| 113 | 3300025924 | Ga0207694_10052151 | Ga0207694_100521511 | 241 |
| 114 | 3300025926 | Ga0207659_10006975 | Ga0207659_100069752 | 241 |
| 115 | 3300025926 | Ga0207659_10049646 | Ga0207659_100496463 | 241 |
| 116 | 3300025932 | Ga0207690_10005755 | Ga0207690_100057552 | 241 |
| 117 | 3300025933 | Ga0207706_10002250 | Ga0207706_100022508 | 241 |
| 118 | 3300025933 | Ga0207706_10395110 | Ga0207706_103951102 | 241 |
| 119 | 3300025939 | Ga0207665_10257557 | Ga0207665_102575572 | 241 |
| 120 | 3300025940 | Ga0207691_10163186 | Ga0207691_101631863 | 241 |
| 121 | 3300025941 | Ga0207711_10156430 | Ga0207711_101564302 | 241 |
| 122 | 3300025942 | Ga0207689_10002016 | Ga0207689_1000201611 | 241 |
| 123 | 3300025945 | Ga0207679_10183446 | Ga0207679_101834463 | 241 |
| 124 | 3300025945 | Ga0207679_10384702 | Ga0207679_103847022 | 241 |
| 125 | 3300025949 | Ga0207667_10012340 | Ga0207667_100123405 | 241 |
| 126 | 3300026035 | Ga0207703_10051221 | Ga0207703_100512212 | 241 |
| 127 | 3300026041 | Ga0207639_10335176 | Ga0207639_103351762 | 241 |
| 128 | 3300026067 | Ga0207678_10003973 | Ga0207678_100039733 | 241 |
| 129 | 3300026095 | Ga0207676_10032370 | Ga0207676_100323703 | 241 |
| 130 | 3300026118 | Ga0207675_100002143 | Ga0207675_10000214311 | 241 |
| 131 | 3300026121 | Ga0207683_10099350 | Ga0207683_100993503 | 241 |
| 132 | 3300026142 | Ga0207698_10039238 | Ga0207698_100392383 | 241 |
| 133 | 3300028380 | Ga0268265_10222954 | Ga0268265_102229542 | 241 |
| 134 | 3300031507 | Ga0307509_10028460 | Ga0307509_100284602 | 241 |
| 135 | 3300035121 | Ga0373960_0013118 | Ga0373960_0013118_601_1335 | 241 |
| 136 | 3300035172 | Ga0373955_0026317 | Ga0373955_0026317_81_848 | 241 |
| 137 | 3300035410 | Ga0373924_0158271 | Ga0373924_0158271_210_977 | 241 |
| 138 | 3300035695 | Ga0373927_0232350 | Ga0373927_0232350_370_1098 | 241 |
| 139 | 3300036401 | Ga0373937_0088970 | Ga0373937_0088970_1910_2677 | 241 |
| 140 | 3300046519 | Ga0495632_0011183 | Ga0495632_0011183_4300_5031 | 241 |
| 141 | 3300046543 | Ga0495645_0278768 | Ga0495645_0278768_273_1040 | 241 |
| 142 | 3300047317 | Ga0495604_0408087 | Ga0495604_0408087_60_785 | 241 |
| 143 | 3300047471 | Ga0495684_0125177 | Ga0495684_0125177_973_1740 | 241 |
| 144 | 3300048903 | Ga0496100_0024378 | Ga0496100_0024378_2157_2891 | 241 |
| 145 | 3300048904 | Ga0496101_0218236 | Ga0496101_0218236_603_1337 | 241 |
| 146 | 3300048906 | Ga0496103_0225803 | Ga0496103_0225803_155_889 | 241 |
| 147 | 3300048909 | Ga0496106_0026787 | Ga0496106_0026787_654_1388 | 241 |
| 148 | 3300048910 | Ga0496107_0013186 | Ga0496107_0013186_2576_3310 | 241 |
| 149 | 3300048911 | Ga0496108_0121203 | Ga0496108_0121203_45_779 | 241 |
| 150 | 3300048912 | Ga0496109_0050836 | Ga0496109_0050836_722_1456 | 241 |
| 151 | 3300048913 | Ga0496110_0238787 | Ga0496110_0238787_671_1405 | 241 |
| 152 | 3300048917 | Ga0496114_0234667 | Ga0496114_0234667_795_1529 | 241 |
| 153 | 3300048918 | Ga0496115_0013108 | Ga0496115_0013108_4821_5555 | 241 |
| 154 | 3300050493 | nmdc:mga0k408_25505_c1 | nmdc:mga0k408_25505_c1_1121_1864 | 241 |
| 155 | iso_pu_bacteria | 2501025504 | 2501414436 | 241 |
| 156 | iso_pu_bacteria | 2510917014 | 2511099689 | 241 |
| 157 | 3300003771 | Ga0055526_1000408 | Ga0055526_100040812 | 242 |
| 158 | 3300005327 | Ga0070658_10016034 | Ga0070658_100160347 | 242 |
| 159 | 3300005331 | Ga0070670_100017775 | Ga0070670_1000177757 | 242 |
| 160 | 3300005338 | Ga0068868_100014265 | Ga0068868_1000142653 | 242 |
| 161 | 3300005353 | Ga0070669_100730641 | Ga0070669_1007306411 | 242 |
| 162 | 3300005355 | Ga0070671_100002046 | Ga0070671_1000020463 | 242 |
| 163 | 3300005355 | Ga0070671_100034530 | Ga0070671_1000345303 | 242 |
| 164 | 3300005364 | Ga0070673_100002957 | Ga0070673_1000029577 | 242 |
| 165 | 3300005455 | Ga0070663_100002679 | Ga0070663_1000026797 | 242 |
| 166 | 3300005456 | Ga0070678_100006265 | Ga0070678_1000062658 | 242 |
| 167 | 3300005539 | Ga0068853_100087443 | Ga0068853_1000874433 | 242 |
| 168 | 3300005543 | Ga0070672_100349897 | Ga0070672_1003498972 | 242 |
| 169 | 3300005564 | Ga0070664_100247488 | Ga0070664_1002474882 | 242 |
| 170 | 3300005616 | Ga0068852_100054609 | Ga0068852_1000546096 | 242 |
| 171 | 3300005834 | Ga0068851_10001036 | Ga0068851_1000103615 | 242 |
| 172 | 3300005841 | Ga0068863_100217820 | Ga0068863_1002178202 | 242 |
| 173 | 3300006358 | Ga0068871_100176778 | Ga0068871_1001767782 | 242 |
| 174 | 3300006846 | Ga0075430_100026829 | Ga0075430_1000268292 | 242 |
| 175 | 3300006880 | Ga0075429_100001715 | Ga0075429_1000017152 | 242 |
| 176 | 3300013296 | Ga0157374_10028148 | Ga0157374_100281485 | 242 |
| 177 | 3300013308 | Ga0157375_10008130 | Ga0157375_100081307 | 242 |
| 178 | 3300014325 | Ga0163163_10331047 | Ga0163163_103310471 | 242 |
| 179 | 3300021377 | Ga0213874_10021415 | Ga0213874_100214152 | 242 |
| 180 | 3300021384 | Ga0213876_10165026 | Ga0213876_101650262 | 242 |
| 181 | 3300025295 | Ga0209564_1000192 | Ga0209564_1000192120 | 242 |
| 182 | 3300025321 | Ga0207656_10001964 | Ga0207656_100019647 | 242 |
| 183 | 3300025907 | Ga0207645_10189694 | Ga0207645_101896942 | 242 |
| 184 | 3300025925 | Ga0207650_10177651 | Ga0207650_101776512 | 242 |
| 185 | 3300025931 | Ga0207644_10064177 | Ga0207644_100641772 | 242 |
| 186 | 3300025931 | Ga0207644_10098327 | Ga0207644_100983272 | 242 |
| 187 | 3300025931 | Ga0207644_10312976 | Ga0207644_103129761 | 242 |
| 188 | 3300025933 | Ga0207706_10024015 | Ga0207706_100240152 | 242 |
| 189 | 3300025940 | Ga0207691_10039782 | Ga0207691_100397822 | 242 |
| 190 | 3300025945 | Ga0207679_10281676 | Ga0207679_102816762 | 242 |
| 191 | 3300025960 | Ga0207651_10001658 | Ga0207651_100016589 | 242 |
| 192 | 3300026023 | Ga0207677_10018002 | Ga0207677_100180024 | 242 |
| 193 | 3300026023 | Ga0207677_10060915 | Ga0207677_100609153 | 242 |
| 194 | 3300026041 | Ga0207639_10063375 | Ga0207639_100633753 | 242 |
| 195 | 3300026067 | Ga0207678_10002002 | Ga0207678_1000200217 | 242 |
| 196 | 3300026067 | Ga0207678_10148811 | Ga0207678_101488113 | 242 |
| 197 | 3300026088 | Ga0207641_10299484 | Ga0207641_102994842 | 242 |
| 198 | 3300026121 | Ga0207683_10007627 | Ga0207683_100076277 | 242 |
| 199 | 3300026142 | Ga0207698_10002093 | Ga0207698_1000209310 | 242 |
| 200 | 3300032005 | Ga0307411_10631236 | Ga0307411_106312362 | 242 |
| 201 | 3300035170 | Ga0373943_0040716 | Ga0373943_0040716_65_793 | 242 |
| 202 | 3300035725 | Ga0373947_0057500 | Ga0373947_0057500_1378_2106 | 242 |
| 203 | 3300037068 | Ga0373925_0001876 | Ga0373925_0001876_12589_13317 | 242 |
| 204 | 3300037418 | Ga0395900_0180361 | Ga0395900_0180361_1293_2030 | 242 |
| 205 | 3300037471 | Ga0395905_0218271 | Ga0395905_0218271_540_1271 | 242 |
| 206 | 3300037471 | Ga0395905_0574995 | Ga0395905_0574995_271_1008 | 242 |
| 207 | 3300039437 | Ga0436365_1313220 | Ga0436365_1313220_2186_2914 | 242 |
| 208 | 3300039450 | Ga0436363_0656129 | Ga0436363_0656129_439_1176 | 242 |
| 209 | 3300042000 | Ga0439437_010440 | Ga0439437_010440_18_752 | 242 |
| 210 | 3300042011 | Ga0439454_017509 | Ga0439454_017509_44_778 | 242 |
| 211 | 3300042012 | Ga0439455_0028235 | Ga0439455_0028235_429_1163 | 242 |
| 212 | 3300042125 | Ga0450923_019358 | Ga0450923_019358_470_1204 | 242 |
| 213 | 3300042128 | Ga0450897_008939 | Ga0450897_008939_162_896 | 242 |
| 214 | 3300042156 | Ga0439446_0018488 | Ga0439446_0018488_652_1386 | 242 |
| 215 | 3300042439 | Ga0439464_0016497 | Ga0439464_0016497_975_1709 | 242 |
| 216 | 3300044656 | Ga0466969_0010651 | Ga0466969_0010651_338_1069 | 242 |
| 217 | 3300044693 | Ga0466961_0064192 | Ga0466961_0064192_627_1358 | 242 |
| 218 | 3300044735 | Ga0466968_0085038 | Ga0466968_0085038_145_876 | 242 |
| 219 | 3300046535 | Ga0495586_0040380 | Ga0495586_0040380_1631_2359 | 242 |
| 220 | 3300046537 | Ga0495598_0040206 | Ga0495598_0040206_402_1133 | 242 |
| 221 | 3300046539 | Ga0495621_0010291 | Ga0495621_0010291_827_1558 | 242 |
| 222 | 3300048914 | Ga0496111_0423926 | Ga0496111_0423926_52_780 | 242 |
| 223 | 3300049572 | Ga0501036_0524661 | Ga0501036_0524661_108_878 | 242 |
| 224 | 3300049573 | Ga0501037_0510445 | Ga0501037_0510445_58_795 | 242 |
| 225 | 3300049575 | Ga0501039_0299750 | Ga0501039_0299750_229_999 | 242 |
| 226 | 3300049822 | Ga0501035_0117684 | Ga0501035_0117684_228_965 | 242 |
| 227 | 3300049822 | Ga0501035_0534063 | Ga0501035_0534063_167_937 | 242 |
| 228 | 3300049823 | Ga0501044_0069189 | Ga0501044_0069189_1792_2529 | 242 |
| 229 | 3300049823 | Ga0501044_0155156 | Ga0501044_0155156_1235_2005 | 242 |
| 230 | 3300050508 | nmdc:mga09592_2210_c1 | nmdc:mga09592_2210_c1_2374_3114 | 242 |
| 231 | 3300050509 | nmdc:mga0qj67_45649_c1 | nmdc:mga0qj67_45649_c1_1321_2061 | 242 |
| 232 | 3300061719 | Ga0466962_0109182 | Ga0466962_0109182_536_1267 | 242 |
| 233 | iso_pu_bacteria | 2904434214 | 2904437764 | 242 |
| 234 | 3300003316 | rootH1_10092629 | rootH1_100926292 | 243 |
| 235 | 3300003751 | Ga0055538_1000016 | Ga0055538_1000016192 | 243 |
| 236 | 3300003752 | Ga0055539_1000021 | Ga0055539_1000021192 | 243 |
| 237 | 3300003756 | Ga0055533_1000029 | Ga0055533_1000029192 | 243 |
| 238 | 3300003759 | Ga0055525_1000033 | Ga0055525_1000033192 | 243 |
| 239 | 3300003792 | Ga0055540_1011166 | Ga0055540_10111665 | 243 |
| 240 | 3300003794 | Ga0055531_10000335 | Ga0055531_1000033522 | 243 |
| 241 | 3300003841 | Ga0055541_1000029 | Ga0055541_100002997 | 243 |
| 242 | 3300005327 | Ga0070658_10019434 | Ga0070658_100194347 | 243 |
| 243 | 3300005328 | Ga0070676_10006948 | Ga0070676_100069481 | 243 |
| 244 | 3300005328 | Ga0070676_10284427 | Ga0070676_102844272 | 243 |
| 245 | 3300005329 | Ga0070683_100063997 | Ga0070683_1000639973 | 243 |
| 246 | 3300005329 | Ga0070683_100297509 | Ga0070683_1002975091 | 243 |
| 247 | 3300005330 | Ga0070690_100105668 | Ga0070690_1001056681 | 243 |
| 248 | 3300005331 | Ga0070670_100004394 | Ga0070670_10000439413 | 243 |
| 249 | 3300005331 | Ga0070670_100031309 | Ga0070670_1000313091 | 243 |
| 250 | 3300005333 | Ga0070677_10042718 | Ga0070677_100427181 | 243 |
| 251 | 3300005335 | Ga0070666_10038023 | Ga0070666_100380234 | 243 |
| 252 | 3300005338 | Ga0068868_100001385 | Ga0068868_1000013857 | 243 |
| 253 | 3300005340 | Ga0070689_100003084 | Ga0070689_1000030847 | 243 |
| 254 | 3300005343 | Ga0070687_100038672 | Ga0070687_1000386724 | 243 |
| 255 | 3300005344 | Ga0070661_100028113 | Ga0070661_1000281132 | 243 |
| 256 | 3300005344 | Ga0070661_100099626 | Ga0070661_1000996261 | 243 |
| 257 | 3300005344 | Ga0070661_100231958 | Ga0070661_1002319582 | 243 |
| 258 | 3300005344 | Ga0070661_100300839 | Ga0070661_1003008392 | 243 |
| 259 | 3300005347 | Ga0070668_100032340 | Ga0070668_1000323402 | 243 |
| 260 | 3300005353 | Ga0070669_100160686 | Ga0070669_1001606862 | 243 |
| 261 | 3300005353 | Ga0070669_100356796 | Ga0070669_1003567962 | 243 |
| 262 | 3300005354 | Ga0070675_100002237 | Ga0070675_1000022377 | 243 |
| 263 | 3300005354 | Ga0070675_100072998 | Ga0070675_1000729982 | 243 |
| 264 | 3300005354 | Ga0070675_100111985 | Ga0070675_1001119853 | 243 |
| 265 | 3300005355 | Ga0070671_100007253 | Ga0070671_1000072535 | 243 |
| 266 | 3300005355 | Ga0070671_100007782 | Ga0070671_1000077824 | 243 |
| 267 | 3300005355 | Ga0070671_100039987 | Ga0070671_1000399875 | 243 |
| 268 | 3300005355 | Ga0070671_100156273 | Ga0070671_1001562733 | 243 |
| 269 | 3300005356 | Ga0070674_100287163 | Ga0070674_1002871632 | 243 |
| 270 | 3300005364 | Ga0070673_100000208 | Ga0070673_10000020814 | 243 |
| 271 | 3300005364 | Ga0070673_100304102 | Ga0070673_1003041022 | 243 |
| 272 | 3300005366 | Ga0070659_100046790 | Ga0070659_1000467903 | 243 |
| 273 | 3300005366 | Ga0070659_100058732 | Ga0070659_1000587325 | 243 |
| 274 | 3300005367 | Ga0070667_100001443 | Ga0070667_10000144321 | 243 |
| 275 | 3300005367 | Ga0070667_100028473 | Ga0070667_1000284735 | 243 |
| 276 | 3300005367 | Ga0070667_100051670 | Ga0070667_1000516702 | 243 |
| 277 | 3300005367 | Ga0070667_100077966 | Ga0070667_1000779663 | 243 |
| 278 | 3300005367 | Ga0070667_100548377 | Ga0070667_1005483772 | 243 |
| 279 | 3300005456 | Ga0070678_100001789 | Ga0070678_1000017896 | 243 |
| 280 | 3300005456 | Ga0070678_100042065 | Ga0070678_1000420652 | 243 |
| 281 | 3300005456 | Ga0070678_100220659 | Ga0070678_1002206593 | 243 |
| 282 | 3300005457 | Ga0070662_100095082 | Ga0070662_1000950821 | 243 |
| 283 | 3300005459 | Ga0068867_100022691 | Ga0068867_1000226914 | 243 |
| 284 | 3300005459 | Ga0068867_100030684 | Ga0068867_1000306844 | 243 |
| 285 | 3300005459 | Ga0068867_100139498 | Ga0068867_1001394983 | 243 |
| 286 | 3300005459 | Ga0068867_100177921 | Ga0068867_1001779212 | 243 |
| 287 | 3300005466 | Ga0070685_10123730 | Ga0070685_101237302 | 243 |
| 288 | 3300005530 | Ga0070679_100035171 | Ga0070679_1000351711 | 243 |
| 289 | 3300005535 | Ga0070684_100004382 | Ga0070684_1000043829 | 243 |
| 290 | 3300005535 | Ga0070684_100110198 | Ga0070684_1001101984 | 243 |
| 291 | 3300005539 | Ga0068853_100091842 | Ga0068853_1000918423 | 243 |
| 292 | 3300005539 | Ga0068853_100219463 | Ga0068853_1002194633 | 243 |
| 293 | 3300005543 | Ga0070672_100004392 | Ga0070672_1000043928 | 243 |
| 294 | 3300005543 | Ga0070672_100015337 | Ga0070672_1000153376 | 243 |
| 295 | 3300005543 | Ga0070672_100036554 | Ga0070672_1000365543 | 243 |
| 296 | 3300005543 | Ga0070672_100074470 | Ga0070672_1000744704 | 243 |
| 297 | 3300005543 | Ga0070672_100152265 | Ga0070672_1001522653 | 243 |
| 298 | 3300005547 | Ga0070693_100119656 | Ga0070693_1001196561 | 243 |
| 299 | 3300005548 | Ga0070665_100008015 | Ga0070665_1000080158 | 243 |
| 300 | 3300005548 | Ga0070665_100208744 | Ga0070665_1002087443 | 243 |
| 301 | 3300005548 | Ga0070665_100281548 | Ga0070665_1002815482 | 243 |
| 302 | 3300005564 | Ga0070664_100094229 | Ga0070664_1000942292 | 243 |
| 303 | 3300005577 | Ga0068857_100072028 | Ga0068857_1000720282 | 243 |
| 304 | 3300005578 | Ga0068854_100015002 | Ga0068854_1000150024 | 243 |
| 305 | 3300005578 | Ga0068854_100023928 | Ga0068854_1000239285 | 243 |
| 306 | 3300005614 | Ga0068856_100009207 | Ga0068856_1000092078 | 243 |
| 307 | 3300005616 | Ga0068852_100029414 | Ga0068852_1000294145 | 243 |
| 308 | 3300005616 | Ga0068852_100072431 | Ga0068852_1000724314 | 243 |
| 309 | 3300005616 | Ga0068852_100372871 | Ga0068852_1003728711 | 243 |
| 310 | 3300005616 | Ga0068852_100488571 | Ga0068852_1004885712 | 243 |
| 311 | 3300005617 | Ga0068859_100001157 | Ga0068859_10000115725 | 243 |
| 312 | 3300005617 | Ga0068859_100407259 | Ga0068859_1004072591 | 243 |
| 313 | 3300005618 | Ga0068864_100000432 | Ga0068864_10000043214 | 243 |
| 314 | 3300005618 | Ga0068864_100009444 | Ga0068864_1000094443 | 243 |
| 315 | 3300005618 | Ga0068864_100011831 | Ga0068864_1000118318 | 243 |
| 316 | 3300005618 | Ga0068864_100176567 | Ga0068864_1001765673 | 243 |
| 317 | 3300005719 | Ga0068861_100011766 | Ga0068861_1000117663 | 243 |
| 318 | 3300005834 | Ga0068851_10049712 | Ga0068851_100497124 | 243 |
| 319 | 3300005834 | Ga0068851_10079137 | Ga0068851_100791372 | 243 |
| 320 | 3300005841 | Ga0068863_100027731 | Ga0068863_1000277314 | 243 |
| 321 | 3300005841 | Ga0068863_100113712 | Ga0068863_1001137122 | 243 |
| 322 | 3300005842 | Ga0068858_100000549 | Ga0068858_10000054910 | 243 |
| 323 | 3300005842 | Ga0068858_100002508 | Ga0068858_1000025089 | 243 |
| 324 | 3300005843 | Ga0068860_100003936 | Ga0068860_10000393610 | 243 |
| 325 | 3300005844 | Ga0068862_100105522 | Ga0068862_1001055224 | 243 |
| 326 | 3300006237 | Ga0097621_100008406 | Ga0097621_1000084066 | 243 |
| 327 | 3300006237 | Ga0097621_100009597 | Ga0097621_1000095979 | 243 |
| 328 | 3300006237 | Ga0097621_100144796 | Ga0097621_1001447963 | 243 |
| 329 | 3300006358 | Ga0068871_100016873 | Ga0068871_1000168734 | 243 |
| 330 | 3300006358 | Ga0068871_100030632 | Ga0068871_1000306324 | 243 |
| 331 | 3300006358 | Ga0068871_100057469 | Ga0068871_1000574692 | 243 |
| 332 | 3300006881 | Ga0068865_100034337 | Ga0068865_1000343375 | 243 |
| 333 | 3300006881 | Ga0068865_100215130 | Ga0068865_1002151302 | 243 |
| 334 | 3300006881 | Ga0068865_100493437 | Ga0068865_1004934371 | 243 |
| 335 | 3300006931 | Ga0097620_100001157 | Ga0097620_10000115725 | 243 |
| 336 | 3300006931 | Ga0097620_100407242 | Ga0097620_1004072422 | 243 |
| 337 | 3300009094 | Ga0111539_10755944 | Ga0111539_107559441 | 243 |
| 338 | 3300009098 | Ga0105245_10175746 | Ga0105245_101757463 | 243 |
| 339 | 3300009101 | Ga0105247_10226814 | Ga0105247_102268141 | 243 |
| 340 | 3300009148 | Ga0105243_10146760 | Ga0105243_101467603 | 243 |
| 341 | 3300009176 | Ga0105242_10112890 | Ga0105242_101128903 | 243 |
| 342 | 3300009176 | Ga0105242_10255215 | Ga0105242_102552151 | 243 |
| 343 | 3300009177 | Ga0105248_10000698 | Ga0105248_1000069830 | 243 |
| 344 | 3300009177 | Ga0105248_10016947 | Ga0105248_1001694710 | 243 |
| 345 | 3300009177 | Ga0105248_10026399 | Ga0105248_100263993 | 243 |
| 346 | 3300009177 | Ga0105248_10031309 | Ga0105248_100313096 | 243 |
| 347 | 3300009177 | Ga0105248_10438334 | Ga0105248_104383342 | 243 |
| 348 | 3300009551 | Ga0105238_10014746 | Ga0105238_100147463 | 243 |
| 349 | 3300009553 | Ga0105249_10152658 | Ga0105249_101526583 | 243 |
| 350 | 3300013102 | Ga0157371_10204576 | Ga0157371_102045763 | 243 |
| 351 | 3300013104 | Ga0157370_10036973 | Ga0157370_100369733 | 243 |
| 352 | 3300013105 | Ga0157369_10128772 | Ga0157369_101287723 | 243 |
| 353 | 3300013296 | Ga0157374_10118105 | Ga0157374_101181053 | 243 |
| 354 | 3300013296 | Ga0157374_10121915 | Ga0157374_101219153 | 243 |
| 355 | 3300013296 | Ga0157374_10292886 | Ga0157374_102928863 | 243 |
| 356 | 3300013297 | Ga0157378_10615805 | Ga0157378_106158051 | 243 |
| 357 | 3300013306 | Ga0163162_10002262 | Ga0163162_1000226211 | 243 |
| 358 | 3300013306 | Ga0163162_10137354 | Ga0163162_101373542 | 243 |
| 359 | 3300013306 | Ga0163162_10262341 | Ga0163162_102623413 | 243 |
| 360 | 3300013307 | Ga0157372_10011573 | Ga0157372_100115732 | 243 |
| 361 | 3300013308 | Ga0157375_10006005 | Ga0157375_100060057 | 243 |
| 362 | 3300013308 | Ga0157375_10147915 | Ga0157375_101479154 | 243 |
| 363 | 3300013308 | Ga0157375_10185609 | Ga0157375_101856092 | 243 |
| 364 | 3300013308 | Ga0157375_10187261 | Ga0157375_101872612 | 243 |
| 365 | 3300014325 | Ga0163163_10003225 | Ga0163163_1000322513 | 243 |
| 366 | 3300014325 | Ga0163163_10180720 | Ga0163163_101807203 | 243 |
| 367 | 3300014326 | Ga0157380_10004233 | Ga0157380_1000423311 | 243 |
| 368 | 3300014326 | Ga0157380_10205266 | Ga0157380_102052663 | 243 |
| 369 | 3300014745 | Ga0157377_10249070 | Ga0157377_102490702 | 243 |
| 370 | 3300014968 | Ga0157379_10002944 | Ga0157379_100029449 | 243 |
| 371 | 3300014969 | Ga0157376_10009366 | Ga0157376_100093667 | 243 |
| 372 | 3300015262 | Ga0182007_10001352 | Ga0182007_1000135217 | 243 |
| 373 | 3300021361 | Ga0213872_10069294 | Ga0213872_100692942 | 243 |
| 374 | 3300025224 | Ga0209784_100033 | Ga0209784_100033191 | 243 |
| 375 | 3300025225 | Ga0209566_100037 | Ga0209566_100037191 | 243 |
| 376 | 3300025226 | Ga0209674_100055 | Ga0209674_100055191 | 243 |
| 377 | 3300025230 | Ga0209563_100056 | Ga0209563_100056191 | 243 |
| 378 | 3300025253 | Ga0209677_100034 | Ga0209677_100034191 | 243 |
| 379 | 3300025256 | Ga0209759_1000085 | Ga0209759_1000085133 | 243 |
| 380 | 3300025273 | Ga0209673_1015460 | Ga0209673_10154604 | 243 |
| 381 | 3300025292 | Ga0209676_1007163 | Ga0209676_10071636 | 243 |
| 382 | 3300025298 | Ga0209050_1002492 | Ga0209050_100249217 | 243 |
| 383 | 3300025303 | Ga0209051_1000406 | Ga0209051_100040646 | 243 |
| 384 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012512 | 243 |
| 385 | 3300025315 | Ga0207697_10021644 | Ga0207697_100216443 | 243 |
| 386 | 3300025321 | Ga0207656_10015358 | Ga0207656_100153583 | 243 |
| 387 | 3300025893 | Ga0207682_10002757 | Ga0207682_100027578 | 243 |
| 388 | 3300025893 | Ga0207682_10027124 | Ga0207682_100271243 | 243 |
| 389 | 3300025893 | Ga0207682_10047669 | Ga0207682_100476693 | 243 |
| 390 | 3300025899 | Ga0207642_10155595 | Ga0207642_101555951 | 243 |
| 391 | 3300025899 | Ga0207642_10256240 | Ga0207642_102562401 | 243 |
| 392 | 3300025901 | Ga0207688_10109961 | Ga0207688_101099612 | 243 |
| 393 | 3300025903 | Ga0207680_10044296 | Ga0207680_100442963 | 243 |
| 394 | 3300025903 | Ga0207680_10064677 | Ga0207680_100646771 | 243 |
| 395 | 3300025903 | Ga0207680_10192416 | Ga0207680_101924161 | 243 |
| 396 | 3300025907 | Ga0207645_10149246 | Ga0207645_101492462 | 243 |
| 397 | 3300025913 | Ga0207695_10356719 | Ga0207695_103567192 | 243 |
| 398 | 3300025917 | Ga0207660_10081127 | Ga0207660_100811272 | 243 |
| 399 | 3300025918 | Ga0207662_10114837 | Ga0207662_101148372 | 243 |
| 400 | 3300025919 | Ga0207657_10009270 | Ga0207657_100092703 | 243 |
| 401 | 3300025920 | Ga0207649_10104243 | Ga0207649_101042433 | 243 |
| 402 | 3300025920 | Ga0207649_10161323 | Ga0207649_101613232 | 243 |
| 403 | 3300025920 | Ga0207649_10218270 | Ga0207649_102182702 | 243 |
| 404 | 3300025920 | Ga0207649_10342222 | Ga0207649_103422221 | 243 |
| 405 | 3300025921 | Ga0207652_10006621 | Ga0207652_100066212 | 243 |
| 406 | 3300025924 | Ga0207694_10437154 | Ga0207694_104371542 | 243 |
| 407 | 3300025925 | Ga0207650_10001927 | Ga0207650_1000192718 | 243 |
| 408 | 3300025925 | Ga0207650_10004463 | Ga0207650_100044636 | 243 |
| 409 | 3300025925 | Ga0207650_10167057 | Ga0207650_101670573 | 243 |
| 410 | 3300025926 | Ga0207659_10000613 | Ga0207659_1000061319 | 243 |
| 411 | 3300025926 | Ga0207659_10006804 | Ga0207659_100068047 | 243 |
| 412 | 3300025927 | Ga0207687_10224758 | Ga0207687_102247582 | 243 |
| 413 | 3300025931 | Ga0207644_10001441 | Ga0207644_100014418 | 243 |
| 414 | 3300025931 | Ga0207644_10256093 | Ga0207644_102560931 | 243 |
| 415 | 3300025931 | Ga0207644_10395575 | Ga0207644_103955751 | 243 |
| 416 | 3300025932 | Ga0207690_10037500 | Ga0207690_100375005 | 243 |
| 417 | 3300025933 | Ga0207706_10070983 | Ga0207706_100709834 | 243 |
| 418 | 3300025934 | Ga0207686_10007697 | Ga0207686_100076973 | 243 |
| 419 | 3300025935 | Ga0207709_10218256 | Ga0207709_102182562 | 243 |
| 420 | 3300025937 | Ga0207669_10089803 | Ga0207669_100898032 | 243 |
| 421 | 3300025938 | Ga0207704_10422108 | Ga0207704_104221081 | 243 |
| 422 | 3300025940 | Ga0207691_10009449 | Ga0207691_100094499 | 243 |
| 423 | 3300025940 | Ga0207691_10017950 | Ga0207691_100179507 | 243 |
| 424 | 3300025940 | Ga0207691_10033902 | Ga0207691_100339022 | 243 |
| 425 | 3300025940 | Ga0207691_10036793 | Ga0207691_100367934 | 243 |
| 426 | 3300025940 | Ga0207691_10045914 | Ga0207691_100459144 | 243 |
| 427 | 3300025940 | Ga0207691_10179535 | Ga0207691_101795352 | 243 |
| 428 | 3300025940 | Ga0207691_10605636 | Ga0207691_106056361 | 243 |
| 429 | 3300025941 | Ga0207711_10021652 | Ga0207711_100216522 | 243 |
| 430 | 3300025941 | Ga0207711_10235702 | Ga0207711_102357022 | 243 |
| 431 | 3300025942 | Ga0207689_10114186 | Ga0207689_101141861 | 243 |
| 432 | 3300025944 | Ga0207661_10140324 | Ga0207661_101403243 | 243 |
| 433 | 3300025945 | Ga0207679_10052675 | Ga0207679_100526754 | 243 |
| 434 | 3300025945 | Ga0207679_10067811 | Ga0207679_100678113 | 243 |
| 435 | 3300025945 | Ga0207679_10495270 | Ga0207679_104952702 | 243 |
| 436 | 3300025949 | Ga0207667_10399417 | Ga0207667_103994172 | 243 |
| 437 | 3300025960 | Ga0207651_10016755 | Ga0207651_100167552 | 243 |
| 438 | 3300025961 | Ga0207712_10062405 | Ga0207712_100624053 | 243 |
| 439 | 3300025972 | Ga0207668_10775860 | Ga0207668_107758601 | 243 |
| 440 | 3300025981 | Ga0207640_10031947 | Ga0207640_100319475 | 243 |
| 441 | 3300025981 | Ga0207640_10094930 | Ga0207640_100949302 | 243 |
| 442 | 3300025981 | Ga0207640_10104194 | Ga0207640_101041943 | 243 |
| 443 | 3300025986 | Ga0207658_10020131 | Ga0207658_100201314 | 243 |
| 444 | 3300025986 | Ga0207658_10052288 | Ga0207658_100522882 | 243 |
| 445 | 3300025986 | Ga0207658_10078940 | Ga0207658_100789403 | 243 |
| 446 | 3300025986 | Ga0207658_10171845 | Ga0207658_101718452 | 243 |
| 447 | 3300026023 | Ga0207677_10005023 | Ga0207677_100050234 | 243 |
| 448 | 3300026035 | Ga0207703_10004113 | Ga0207703_100041137 | 243 |
| 449 | 3300026035 | Ga0207703_10004562 | Ga0207703_100045625 | 243 |
| 450 | 3300026041 | Ga0207639_10016858 | Ga0207639_100168584 | 243 |
| 451 | 3300026041 | Ga0207639_10097035 | Ga0207639_100970352 | 243 |
| 452 | 3300026041 | Ga0207639_10099327 | Ga0207639_100993275 | 243 |
| 453 | 3300026075 | Ga0207708_10466257 | Ga0207708_104662571 | 243 |
| 454 | 3300026088 | Ga0207641_10019319 | Ga0207641_100193198 | 243 |
| 455 | 3300026088 | Ga0207641_10022727 | Ga0207641_100227273 | 243 |
| 456 | 3300026089 | Ga0207648_10003265 | Ga0207648_1000326511 | 243 |
| 457 | 3300026089 | Ga0207648_10066499 | Ga0207648_100664992 | 243 |
| 458 | 3300026089 | Ga0207648_10157255 | Ga0207648_101572553 | 243 |
| 459 | 3300026095 | Ga0207676_10026552 | Ga0207676_100265525 | 243 |
| 460 | 3300026095 | Ga0207676_10139127 | Ga0207676_101391273 | 243 |
| 461 | 3300026118 | Ga0207675_100101122 | Ga0207675_1001011222 | 243 |
| 462 | 3300026118 | Ga0207675_100404460 | Ga0207675_1004044601 | 243 |
| 463 | 3300026118 | Ga0207675_100587362 | Ga0207675_1005873621 | 243 |
| 464 | 3300026121 | Ga0207683_10000445 | Ga0207683_1000044522 | 243 |
| 465 | 3300026121 | Ga0207683_10004867 | Ga0207683_100048676 | 243 |
| 466 | 3300026121 | Ga0207683_10028982 | Ga0207683_100289825 | 243 |
| 467 | 3300026121 | Ga0207683_10038099 | Ga0207683_100380994 | 243 |
| 468 | 3300026121 | Ga0207683_10111363 | Ga0207683_101113631 | 243 |
| 469 | 3300026142 | Ga0207698_10045721 | Ga0207698_100457212 | 243 |
| 470 | 3300026142 | Ga0207698_10145524 | Ga0207698_101455242 | 243 |
| 471 | 3300026142 | Ga0207698_10208566 | Ga0207698_102085663 | 243 |
| 472 | 3300026142 | Ga0207698_10223599 | Ga0207698_102235991 | 243 |
| 473 | 3300026142 | Ga0207698_10225474 | Ga0207698_102254743 | 243 |
| 474 | 3300027907 | Ga0207428_10026770 | Ga0207428_100267705 | 243 |
| 475 | 3300028379 | Ga0268266_10071852 | Ga0268266_100718521 | 243 |
| 476 | 3300028379 | Ga0268266_10138278 | Ga0268266_101382782 | 243 |
| 477 | 3300028379 | Ga0268266_10658572 | Ga0268266_106585722 | 243 |
| 478 | 3300028381 | Ga0268264_10011062 | Ga0268264_100110625 | 243 |
| 479 | 3300028381 | Ga0268264_10715738 | Ga0268264_107157382 | 243 |
| 480 | 3300031730 | Ga0307516_10147395 | Ga0307516_101473952 | 243 |
| 481 | 3300031731 | Ga0307405_10000985 | Ga0307405_1000098510 | 243 |
| 482 | 3300031852 | Ga0307410_10041726 | Ga0307410_100417264 | 243 |
| 483 | 3300031901 | Ga0307406_10136771 | Ga0307406_101367712 | 243 |
| 484 | 3300031901 | Ga0307406_10232028 | Ga0307406_102320281 | 243 |
| 485 | 3300031911 | Ga0307412_10000270 | Ga0307412_100002701 | 243 |
| 486 | 3300032002 | Ga0307416_100250526 | Ga0307416_1002505262 | 243 |
| 487 | 3300032002 | Ga0307416_100382439 | Ga0307416_1003824392 | 243 |
| 488 | 3300032005 | Ga0307411_10188189 | Ga0307411_101881893 | 243 |
| 489 | 3300032126 | Ga0307415_100043558 | Ga0307415_1000435582 | 243 |
| 490 | 3300036401 | Ga0373937_0951305 | Ga0373937_0951305_41_772 | 243 |
| 491 | 3300041486 | Ga0451807_0127149 | Ga0451807_0127149_146_892 | 243 |
| 492 | 3300044668 | Ga0466980_0320303 | Ga0466980_0320303_118_882 | 243 |
| 493 | 3300045049 | Ga0466959_0010943 | Ga0466959_0010943_601_1365 | 243 |
| 494 | 3300046459 | Ga0495629_0000097 | Ga0495629_0000097_24954_25700 | 243 |
| 495 | 3300046460 | Ga0495638_0023425 | Ga0495638_0023425_3251_3985 | 243 |
| 496 | 3300046462 | Ga0495651_0053412 | Ga0495651_0053412_1134_1880 | 243 |
| 497 | 3300046463 | Ga0495653_0000492 | Ga0495653_0000492_12546_13292 | 243 |
| 498 | 3300046472 | Ga0495580_0016480 | Ga0495580_0016480_4071_4817 | 243 |
| 499 | 3300046511 | Ga0495608_0013471 | Ga0495608_0013471_1352_2098 | 243 |
| 500 | 3300046512 | Ga0495610_0025864 | Ga0495610_0025864_1467_2201 | 243 |
| 501 | 3300046516 | Ga0495628_0012727 | Ga0495628_0012727_206_952 | 243 |
| 502 | 3300046516 | Ga0495628_0070195 | Ga0495628_0070195_168_914 | 243 |
| 503 | 3300046524 | Ga0495648_0125269 | Ga0495648_0125269_401_1147 | 243 |
| 504 | 3300046529 | Ga0495652_0025575 | Ga0495652_0025575_2630_3376 | 243 |
| 505 | 3300046531 | Ga0495665_0045421 | Ga0495665_0045421_333_1082 | 243 |
| 506 | 3300046537 | Ga0495598_0019164 | Ga0495598_0019164_617_1363 | 243 |
| 507 | 3300046679 | Ga0495623_0002148 | Ga0495623_0002148_5051_5824 | 243 |
| 508 | 3300046679 | Ga0495623_0004122 | Ga0495623_0004122_818_1564 | 243 |
| 509 | 3300046680 | Ga0495646_0012250 | Ga0495646_0012250_1246_1992 | 243 |
| 510 | 3300046681 | Ga0495647_0063980 | Ga0495647_0063980_221_967 | 243 |
| 511 | 3300046683 | Ga0495658_0376679 | Ga0495658_0376679_72_839 | 243 |
| 512 | 3300046689 | Ga0495613_0013480 | Ga0495613_0013480_5310_6056 | 243 |
| 513 | 3300046690 | Ga0495624_0003071 | Ga0495624_0003071_4071_4817 | 243 |
| 514 | 3300046690 | Ga0495624_0057483 | Ga0495624_0057483_1342_2091 | 243 |
| 515 | 3300046694 | Ga0495649_0143761 | Ga0495649_0143761_276_1025 | 243 |
| 516 | 3300047317 | Ga0495604_0000652 | Ga0495604_0000652_13178_13951 | 243 |
| 517 | 3300047318 | Ga0495636_0155742 | Ga0495636_0155742_56_790 | 243 |
| 518 | 3300047319 | Ga0495674_0018134 | Ga0495674_0018134_5076_5825 | 243 |
| 519 | 3300047319 | Ga0495674_0024704 | Ga0495674_0024704_4043_4789 | 243 |
| 520 | 3300047321 | Ga0495676_0039607 | Ga0495676_0039607_2021_2767 | 243 |
| 521 | 3300047322 | Ga0495680_0007557 | Ga0495680_0007557_5159_5932 | 243 |
| 522 | 3300047444 | Ga0495675_0199475 | Ga0495675_0199475_430_1203 | 243 |
| 523 | 3300047673 | Ga0495593_0005339 | Ga0495593_0005339_6147_6893 | 243 |
| 524 | 3300048088 | Ga0495602_0031604 | Ga0495602_0031604_3680_4453 | 243 |
| 525 | 3300048088 | Ga0495602_0050048 | Ga0495602_0050048_927_1673 | 243 |
| 526 | 3300048088 | Ga0495602_0052361 | Ga0495602_0052361_423_1172 | 243 |
| 527 | 3300048089 | Ga0495614_0057743 | Ga0495614_0057743_399_1148 | 243 |
| 528 | 3300048904 | Ga0496101_0186403 | Ga0496101_0186403_733_1467 | 243 |
| 529 | 3300048907 | Ga0496104_0026891 | Ga0496104_0026891_605_1339 | 243 |
| 530 | 3300048908 | Ga0496105_0028317 | Ga0496105_0028317_922_1656 | 243 |
| 531 | 3300048911 | Ga0496108_0315426 | Ga0496108_0315426_154_909 | 243 |
| 532 | 3300048913 | Ga0496110_0554392 | Ga0496110_0554392_150_890 | 243 |
| 533 | 3300048917 | Ga0496114_0309552 | Ga0496114_0309552_270_1004 | 243 |
| 534 | 3300048919 | Ga0496116_0049936 | Ga0496116_0049936_1814_2554 | 243 |
| 535 | 3300048920 | Ga0496117_0105676 | Ga0496117_0105676_306_1055 | 243 |
| 536 | 3300048921 | Ga0496118_0121396 | Ga0496118_0121396_764_1513 | 243 |
| 537 | 3300048921 | Ga0496118_0165585 | Ga0496118_0165585_268_1023 | 243 |
| 538 | 3300048923 | Ga0496120_0043328 | Ga0496120_0043328_149_889 | 243 |
| 539 | 3300048924 | Ga0496121_0010185 | Ga0496121_0010185_211_951 | 243 |
| 540 | 3300048924 | Ga0496121_0024346 | Ga0496121_0024346_4050_4799 | 243 |
| 541 | 3300048924 | Ga0496121_0224226 | Ga0496121_0224226_537_1277 | 243 |
| 542 | 3300048925 | Ga0496122_0036642 | Ga0496122_0036642_327_1067 | 243 |
| 543 | 3300048926 | Ga0496123_0001524 | Ga0496123_0001524_350_1090 | 243 |
| 544 | 3300048926 | Ga0496123_0097718 | Ga0496123_0097718_810_1550 | 243 |
| 545 | 3300048927 | Ga0496124_0148175 | Ga0496124_0148175_333_1073 | 243 |
| 546 | 3300048927 | Ga0496124_0220984 | Ga0496124_0220984_228_968 | 243 |
| 547 | 3300048928 | Ga0496125_0000259 | Ga0496125_0000259_108229_108969 | 243 |
| 548 | 3300048928 | Ga0496125_0038754 | Ga0496125_0038754_3246_3986 | 243 |
| 549 | 3300049460 | Ga0495682_0041071 | Ga0495682_0041071_304_1053 | 243 |
| 550 | 3300053077 | Ga0495601_0080332 | Ga0495601_0080332_464_1210 | 243 |
| 551 | 3300053088 | Ga0500644_0026805 | Ga0500644_0026805_327_1064 | 243 |
| 552 | 3300053093 | Ga0500651_0038196 | Ga0500651_0038196_314_1048 | 243 |
| 553 | 3300053136 | Ga0500559_0000407 | Ga0500559_0000407_2484_3218 | 243 |
| 554 | 3300053145 | Ga0500586_030430 | Ga0500586_030430_752_1489 | 243 |
| 555 | 3300053156 | Ga0500622_0002189 | Ga0500622_0002189_8910_9644 | 243 |
| 556 | 3300053739 | Ga0500587_002215 | Ga0500587_002215_247_981 | 243 |
| 557 | iso_pu_bacteria | 2510917013 | 2511088849 | 243 |
| 558 | iso_pu_bacteria | 2515154189 | 2516024380 | 243 |
| 559 | iso_pu_bacteria | 642555113 | 642621667 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ocr-assembly1.cif.gz_A | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.9162 | 12 | 242 |
| 3ocr-assembly2.cif.gz_B | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.916 | 12 | 242 |
| 6btg-assembly1.cif.gz_A | crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis | 0.8723 | 15 | 224 |
| 3ocr-assembly1.cif.gz_A | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.8696 | 12 | 242 |
| 3ocr-assembly2.cif.gz_B | crystal structure of aldolase ii superfamily protein from pseudomonas syringae | 0.8691 | 12 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ocrB00 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9146 | 12 | 242 | 3.40.225.10 |
| af_Q9U9K0_112_366_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9027 | 7 | 243 | 3.40.225.10 |
| af_Q20952_347_604_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.9017 | 8 | 242 | 3.40.225.10 |
| af_F1QW07_135_388_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.8986 | 12 | 216 | 3.40.225.10 |
| af_Q7LKY2_67_324_3.40.225.10 | Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain | 0.8964 | 12 | 243 | 3.40.225.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Z0BQ36-F1-model_v4 | Aldolase | 0.9898 | 9 | 243 |
GO:0005856
GO:0051015 |
| AF-A0A3N7CBP8-F1-model_v4 | Aldolase | 0.9883 | 10 | 243 |
GO:0005856
GO:0051015 |
| AF-I3UF68-F1-model_v4 | Class II aldolase/adducin N-terminal domain-containing protein | 0.988 | 10 | 243 |
GO:0005856
GO:0051015 |
| AF-A0A5E4Z1N0-F1-model_v4 | Decarboxylase NovR (EC 4.1.-.-) | 0.983 | 91 | 243 |
GO:0005856
GO:0016829 GO:0051015 |
| AF-A0A317H672-F1-model_v4 | Class II aldolase/adducin N-terminal domain-containing protein | 0.9796 | 16 | 243 |
GO:0005856
GO:0051015 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar