F463499

General Info

Members Datasets Scaffolds Average Seq Length
558 339 1116 215

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0049475|Ga0501074_0049475_399_1055
Length 218
Sequence VSRPGEQLLRVQNFMLTTDGYGTGEGPSLERPFGHLDPAELASWAGATASWPNRADPGGTRGLDDYFTRDFSHDIGVEIMGSGKFGPPGWHEDPAWQGWWGDEPPFHTPVLVLTRHVRPSITLSDTTFHFVDAEPVEALRQAKDAAGGKDVRLGGGVSVVRSFLEADLVDTMHVAVAPVSAGGRGGKLWDSPDELLDRFHLEVVPSPSGITHHIFWRR

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
79 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
80 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
113 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
114 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
118 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
252 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
259 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
260 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
261 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
262 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
263 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
264 2643221548 Streptomyces sp. Root55 Isolate Unclassified
265 2643221578 Streptomyces sp. Root63 Isolate Unclassified
266 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
267 2643221670 Streptomyces sp. Root431 Isolate Unclassified
268 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
269 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
270 2643221679 Angustibacter sp. Root456 Isolate Unclassified
271 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
272 2643221692 Nocardia sp. Root136 Isolate Unclassified
273 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
274 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
275 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
276 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
277 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
278 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
279 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
280 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
281 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
282 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
283 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
284 2808606448 Streptomyces sp. 193411 Isolate Unclassified
285 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
286 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
287 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
288 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
289 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
290 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
291 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
292 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
293 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
294 2867428634 Streptomyces sp. RP5T Isolate Unclassified
295 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
296 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
297 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
298 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
299 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
300 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
301 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
302 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
303 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
304 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
305 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
306 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
307 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
308 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
309 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
310 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
311 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
312 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
313 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
314 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
315 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
316 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
317 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
318 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
319 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
320 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
321 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
322 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
323 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
324 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
325 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
326 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
327 8002784119 Frankia sp. AgB1.9 Isolate Nodule
328 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
329 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
330 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
331 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
332 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
333 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
334 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
335 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
336 8054920844 Frankia tisae Agncl-8 Isolate Nodule
337 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
338 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
339 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.59
Metatranscriptomes 0.36
Isolates 15.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 7.89
Nodule 0.9
Rhizoplane 6.63
Rhizosphere 73.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0049475 3300049590 Bacteria 3035
2 JGI24034J26672_10017258 3300002239 Bacteria 1116
3 rootH1_10074083 3300003316 Bacteria 1736
4 rootH2_10053788 3300003320 Bacteria 4998
5 rootL2_10043628 3300003322 Bacteria 1107
6 rootH1_10106340 3300003323 Bacteria 1438
7 JGI25160J50197_1027640 3300003354 Bacteria 1539
8 Ga0006562J51391_1062637 3300003578 Bacteria 1830
9 Ga0070668_100588106 3300005347 Bacteria 972
10 Ga0070671_100000977 3300005355 Bacteria 20963
11 Ga0070671_100086632 3300005355 Bacteria 2621
12 Ga0070667_100078813 3300005367 Bacteria 2815
13 Ga0070711_100554426 3300005439 Bacteria 954
14 Ga0070706_100097385 3300005467 Bacteria 2732
15 Ga0070698_100050895 3300005471 Bacteria 4220
16 Ga0070684_100934660 3300005535 Bacteria 813
17 Ga0070686_100113400 3300005544 Bacteria 1851
18 Ga0070665_100092094 3300005548 Bacteria 3036
19 Ga0070665_100673170 3300005548 Bacteria 1048
20 Ga0070665_100675617 3300005548 Bacteria 1046
21 Ga0068864_100379088 3300005618 Bacteria 1340
22 Ga0068864_100612132 3300005618 Bacteria 1058
23 Ga0068863_100002336 3300005841 Bacteria 18844
24 Ga0068863_100169632 3300005841 Bacteria 2093
25 Ga0068858_100661886 3300005842 Bacteria 1015
26 Ga0068860_100252541 3300005843 Bacteria 1718
27 Ga0068862_100001101 3300005844 Bacteria 25645
28 Ga0068862_100711111 3300005844 Bacteria 974
29 Ga0081455_10073688 3300005937 Bacteria 2822
30 Ga0075365_10011291 3300006038 Bacteria 5246
31 Ga0075365_10119155 3300006038 Bacteria 1819
32 Ga0075368_10009006 3300006042 Bacteria 3581
33 Ga0075368_10035210 3300006042 Bacteria 1953
34 Ga0075368_10089979 3300006042 Bacteria 1255
35 Ga0075363_100003846 3300006048 Bacteria 6473
36 Ga0075363_100007494 3300006048 Bacteria 5023
37 Ga0075364_10000849 3300006051 Bacteria 16097
38 Ga0075364_10042089 3300006051 Bacteria 2967
39 Ga0075364_10315730 3300006051 Bacteria 1064
40 Ga0075362_10009082 3300006177 Bacteria 3829
41 Ga0075367_10065174 3300006178 Bacteria 2181
42 Ga0075369_10008100 3300006186 Bacteria 4031
43 Ga0075369_10013387 3300006186 Bacteria 3256
44 Ga0075366_10151332 3300006195 Bacteria 1405
45 Ga0075370_10189034 3300006353 Bacteria 1213
46 Ga0075430_100117270 3300006846 Bacteria 2219
47 Ga0097620_100000044 3300006931 Bacteria 144391
48 Ga0075435_100973025 3300007076 Bacteria 741
49 Ga0105250_10034352 3300009092 Bacteria 2035
50 Ga0105250_10135670 3300009092 Bacteria 1018
51 Ga0105245_10019505 3300009098 Bacteria 5941
52 Ga0105245_10857071 3300009098 Bacteria 949
53 Ga0105247_10031072 3300009101 Bacteria 3240
54 Ga0105243_10000750 3300009148 Bacteria 31118
55 Ga0105243_10566844 3300009148 Bacteria 1088
56 Ga0105242_11330710 3300009176 Bacteria 743
57 Ga0105248_10239575 3300009177 Bacteria 2042
58 Ga0105248_10880598 3300009177 Bacteria 1011
59 Ga0105249_10003809 3300009553 Bacteria 13021
60 Ga0105249_10007789 3300009553 Bacteria 9333
61 Ga0105249_10641426 3300009553 Bacteria 1119
62 Ga0105239_10326097 3300010375 Bacteria 1732
63 Ga0105239_11000410 3300010375 Bacteria 961
64 Ga0105246_10490932 3300011119 Bacteria 1041
65 Ga0157369_10777689 3300013105 Bacteria 984
66 Ga0163162_10511978 3300013306 Bacteria 1330
67 Ga0157375_10575770 3300013308 Bacteria 1286
68 Ga0157375_10803871 3300013308 Bacteria 1089
69 Ga0163163_10021894 3300014325 Bacteria 6041
70 Ga0157380_10550716 3300014326 Bacteria 1131
71 Ga0157380_10588136 3300014326 Bacteria 1099
72 Ga0157379_10059877 3300014968 Bacteria 3405
73 Ga0157379_10241363 3300014968 Bacteria 1639
74 Ga0182007_10000820 3300015262 Bacteria 17338
75 Ga0183367_1004 3300015688 Bacteria 716880
76 Ga0213873_10092445 3300021358 Bacteria 861
77 Ga0213876_10022886 3300021384 Bacteria 3301
78 Ga0213875_10005320 3300021388 Bacteria 6923
79 Ga0213875_10011596 3300021388 Bacteria 4380
80 Ga0209758_1012033 3300025297 Bacteria 4909
81 Ga0207426_1001852 3300025302 Bacteria 15531
82 Ga0207642_10354007 3300025899 Bacteria 867
83 Ga0207684_10272654 3300025910 Bacteria 1460
84 Ga0207663_10488708 3300025916 Bacteria 955
85 Ga0207694_10456195 3300025924 Bacteria 1067
86 Ga0207687_10122487 3300025927 Bacteria 1947
87 Ga0207687_10336090 3300025927 Bacteria 1227
88 Ga0207644_10000835 3300025931 Bacteria 19555
89 Ga0207644_10749264 3300025931 Bacteria 816
90 Ga0207686_10286469 3300025934 Bacteria 1218
91 Ga0207709_10001151 3300025935 Bacteria 19257
92 Ga0207670_10783290 3300025936 Bacteria 794
93 Ga0207711_10315213 3300025941 Bacteria 1444
94 Ga0207712_10031034 3300025961 Bacteria 3596
95 Ga0207712_10079714 3300025961 Bacteria 2379
96 Ga0207668_10287574 3300025972 Bacteria 1351
97 Ga0207703_10184902 3300026035 Bacteria 1841
98 Ga0207703_10558660 3300026035 Bacteria 1080
99 Ga0207641_10003507 3300026088 Bacteria 13886
100 Ga0207641_10244651 3300026088 Bacteria 1673
101 Ga0207676_10307053 3300026095 Bacteria 1451
102 Ga0207675_100862520 3300026118 Bacteria 921
103 Ga0209813_10085617 3300027866 Bacteria 1049
104 Ga0209813_10160413 3300027866 Bacteria 811
105 Ga0268266_10062249 3300028379 Bacteria 3220
106 Ga0268265_10000205 3300028380 Bacteria 68729
107 Ga0268264_10075109 3300028381 Bacteria 2873
108 Ga0316177_1078076 3300030731 Bacteria 2304
109 Ga0314311_1183463 3300030733 Bacteria 2900
110 Ga0316180_1114495 3300030736 Bacteria 1373
111 Ga0265327_10013716 3300031251 Bacteria 5361
112 Ga0307509_10111814 3300031507 Bacteria 2733
113 Ga0307509_10144905 3300031507 Bacteria 2303
114 Ga0307408_100199833 3300031548 Bacteria 1617
115 Ga0307408_100767347 3300031548 Bacteria 872
116 Ga0307514_10162596 3300031649 Bacteria 1475
117 Ga0265314_10072367 3300031711 Bacteria 2303
118 Ga0316576_10169855 3300031727 Bacteria 1646
119 Ga0307516_10021923 3300031730 Bacteria 6563
120 Ga0307405_10107696 3300031731 Bacteria 1882
121 Ga0307410_10012126 3300031852 Bacteria 4966
122 Ga0307410_10172314 3300031852 Bacteria 1632
123 Ga0307410_10187966 3300031852 Bacteria 1569
124 Ga0307410_10386480 3300031852 Bacteria 1127
125 Ga0307406_10027987 3300031901 Bacteria 3402
126 Ga0307406_10468812 3300031901 Bacteria 1014
127 Ga0307406_10729932 3300031901 Bacteria 830
128 Ga0307406_10887214 3300031901 Bacteria 758
129 Ga0307407_10567272 3300031903 Bacteria 841
130 Ga0307409_100008711 3300031995 Bacteria 6180
131 Ga0307409_100692446 3300031995 Bacteria 1017
132 Ga0307416_100747255 3300032002 Bacteria 1070
133 Ga0307414_10346294 3300032004 Bacteria 1274
134 Ga0307507_10152726 3300033179 Bacteria 1731
135 Ga0373944_0119861 3300035089 Bacteria 906
136 Ga0373936_0230297 3300035113 Bacteria 824
137 Ga0373947_0077679 3300035725 Bacteria 2048
138 Ga0395898_0000804 3300037466 Bacteria 52956
139 Ga0395898_0160102 3300037466 Bacteria 2153
140 Ga0436364_0103177 3300037853 Bacteria 67977
141 Ga0436364_1000426 3300037853 Bacteria 33245
142 Ga0395901_0917122 3300038443 Bacteria 857
143 Ga0436365_0380684 3300039437 Bacteria 2891
144 Ga0436365_0926350 3300039437 Bacteria 810
145 Ga0436360_1196039 3300039438 Bacteria 3299
146 Ga0436362_0729387 3300039453 Bacteria 1554
147 Ga0436362_0777322 3300039453 Bacteria 9511
148 Ga0439436_0003333 3300041404 Bacteria 4872
149 Ga0439436_0008617 3300041404 Bacteria 3135
150 Ga0439439_0031775 3300041406 Bacteria 1346
151 Ga0439461_0003552 3300041410 Bacteria 2568
152 Ga0439466_0035115 3300041411 Bacteria 1696
153 Ga0439465_0003133 3300041413 Bacteria 5399
154 Ga0439465_0022572 3300041413 Bacteria 1977
155 Ga0451841_1195414 3300041498 Bacteria 1057
156 Ga0451853_4084173 3300041512 Bacteria 1139
157 Ga0439431_0000401 3300041997 Bacteria 9161
158 Ga0439433_0007032 3300041999 Bacteria 2429
159 Ga0439442_015914 3300042002 Bacteria 1550
160 Ga0439445_0006000 3300042004 Bacteria 2783
161 Ga0439445_0034740 3300042004 Bacteria 1322
162 Ga0439449_0000109 3300042007 Bacteria 26857
163 Ga0439449_0009889 3300042007 Bacteria 3606
164 Ga0439449_0019723 3300042007 Bacteria 2527
165 Ga0439457_000294 3300042014 Bacteria 13807
166 Ga0439457_000938 3300042014 Bacteria 8756
167 Ga0439462_0000129 3300042015 Bacteria 11957
168 Ga0439462_0002037 3300042015 Bacteria 4635
169 Ga0439434_0001224 3300042435 Bacteria 7394
170 Ga0466969_0064144 3300044656 Bacteria 1779
171 Ga0466972_0002980 3300044658 Bacteria 8379
172 Ga0466972_0006871 3300044658 Bacteria 5711
173 Ga0466972_0024808 3300044658 Bacteria 2975
174 Ga0466972_0039295 3300044658 Bacteria 2309
175 Ga0466965_0001514 3300044683 Bacteria 9421
176 Ga0466965_0002399 3300044683 Bacteria 7948
177 Ga0466965_0025537 3300044683 Bacteria 2859
178 Ga0466965_0044134 3300044683 Bacteria 2202
179 Ga0466965_0161679 3300044683 Bacteria 1174
180 Ga0466966_0032726 3300044684 Bacteria 3367
181 Ga0466966_0062149 3300044684 Bacteria 2355
182 Ga0466961_0003600 3300044693 Bacteria 9666
183 Ga0466961_0067637 3300044693 Bacteria 2269
184 Ga0466961_0083416 3300044693 Bacteria 2021
185 Ga0466963_0008454 3300044694 Bacteria 6167
186 Ga0466963_0178399 3300044694 Bacteria 1482
187 Ga0466963_0208162 3300044694 Bacteria 1368
188 Ga0466964_0003045 3300044706 Bacteria 6084
189 Ga0466964_0018576 3300044706 Bacteria 2669
190 Ga0466964_0274413 3300044706 Bacteria 840
191 Ga0466971_0000592 3300044719 Bacteria 14355
192 Ga0466971_0105748 3300044719 Bacteria 1296
193 Ga0466971_0311323 3300044719 Bacteria 757
194 Ga0466968_0000740 3300044735 Bacteria 11310
195 Ga0466968_0201591 3300044735 Bacteria 932
196 Ga0466970_0001101 3300044765 Bacteria 13083
197 Ga0466970_0004857 3300044765 Bacteria 6635
198 Ga0466970_0005433 3300044765 Bacteria 6323
199 Ga0466970_0030354 3300044765 Bacteria 2850
200 Ga0466970_0252582 3300044765 Bacteria 988
201 Ga0466957_0065851 3300044842 Bacteria 2232
202 Ga0466957_0170766 3300044842 Bacteria 1416
203 Ga0466960_0000211 3300044901 Bacteria 20062
204 Ga0466960_0001994 3300044901 Bacteria 7573
205 Ga0466960_0046631 3300044901 Bacteria 2075
206 Ga0466960_0090671 3300044901 Bacteria 1557
207 Ga0466960_0162857 3300044901 Bacteria 1199
208 Ga0466960_0200447 3300044901 Bacteria 1090
209 Ga0466960_0393608 3300044901 Bacteria 797
210 Ga0466959_0016218 3300045049 Bacteria 5439
211 Ga0466959_0034141 3300045049 Bacteria 3764
212 Ga0466959_0223484 3300045049 Bacteria 1305
213 Ga0466958_0003654 3300045836 Bacteria 8030
214 Ga0466958_0037421 3300045836 Bacteria 2907
215 Ga0466958_0478388 3300045836 Bacteria 807
216 Ga0466967_0017271 3300045976 Bacteria 5722
217 Ga0466967_0109662 3300045976 Bacteria 2534
218 Ga0466967_0892094 3300045976 Bacteria 884
219 Ga0466967_1076754 3300045976 Bacteria 801
220 Ga0495592_0077915 3300046454 Bacteria 2401
221 Ga0495592_0225759 3300046454 Bacteria 1249
222 Ga0495603_0002322 3300046455 Bacteria 11164
223 Ga0495603_0019438 3300046455 Bacteria 4110
224 Ga0495603_0038104 3300046455 Bacteria 2883
225 Ga0495629_0002081 3300046459 Bacteria 15520
226 Ga0495638_0202120 3300046460 Bacteria 1121
227 Ga0495638_0204256 3300046460 Bacteria 1113
228 Ga0495651_0106461 3300046462 Bacteria 2078
229 Ga0495653_0111818 3300046463 Bacteria 1961
230 Ga0495662_0000547 3300046476 Bacteria 17232
231 Ga0495585_0013239 3300046492 Bacteria 4832
232 Ga0495585_0015891 3300046492 Bacteria 4368
233 Ga0495585_0028621 3300046492 Bacteria 3177
234 Ga0495594_0002842 3300046499 Bacteria 9002
235 Ga0495594_0009130 3300046499 Bacteria 5118
236 Ga0495594_0078508 3300046499 Bacteria 1842
237 Ga0495594_0292609 3300046499 Bacteria 928
238 Ga0495583_0151532 3300046506 Bacteria 961
239 Ga0495608_0009100 3300046511 Bacteria 6942
240 Ga0495608_0133987 3300046511 Bacteria 1584
241 Ga0495618_0018061 3300046514 Bacteria 4329
242 Ga0495618_0102918 3300046514 Bacteria 1828
243 Ga0495620_0013702 3300046515 Bacteria 4145
244 Ga0495628_0003272 3300046516 Bacteria 14506
245 Ga0495628_0004772 3300046516 Bacteria 11946
246 Ga0495628_0009608 3300046516 Bacteria 8252
247 Ga0495630_0034365 3300046517 Bacteria 3786
248 Ga0495631_0107065 3300046518 Bacteria 1202
249 Ga0495648_0011675 3300046524 Bacteria 6596
250 Ga0495648_0155259 3300046524 Bacteria 1189
251 Ga0495666_0004007 3300046526 Bacteria 7445
252 Ga0495666_0063679 3300046526 Bacteria 1760
253 Ga0495652_0001657 3300046529 Bacteria 24202
254 Ga0495654_0042419 3300046530 Bacteria 2259
255 Ga0495640_0002082 3300046533 Bacteria 15936
256 Ga0495640_0040188 3300046533 Bacteria 3276
257 Ga0495640_0183313 3300046533 Bacteria 1333
258 Ga0495586_0004211 3300046535 Bacteria 7706
259 Ga0495586_0285764 3300046535 Bacteria 944
260 Ga0495586_0306556 3300046535 Bacteria 910
261 Ga0495587_0006071 3300046536 Bacteria 7880
262 Ga0495587_0071459 3300046536 Bacteria 2018
263 Ga0495645_0025308 3300046543 Bacteria 4306
264 Ga0495645_0126268 3300046543 Bacteria 1797
265 Ga0495645_0167564 3300046543 Bacteria 1514
266 Ga0495622_0001327 3300046557 Bacteria 12666
267 Ga0495667_0007329 3300046559 Bacteria 7481
268 Ga0495667_0112976 3300046559 Bacteria 1755
269 Ga0495668_0022079 3300046616 Bacteria 3641
270 Ga0495668_0022327 3300046616 Bacteria 3618
271 Ga0495668_0483775 3300046616 Bacteria 682
272 Ga0495634_0048813 3300046642 Bacteria 2848
273 Ga0495634_0060553 3300046642 Bacteria 2518
274 Ga0495634_0139408 3300046642 Bacteria 1541
275 Ga0495611_0013640 3300046648 Bacteria 3462
276 Ga0495611_0194719 3300046648 Bacteria 946
277 Ga0495635_0007290 3300046663 Bacteria 7726
278 Ga0495588_0013525 3300046674 Bacteria 3890
279 Ga0495588_0069685 3300046674 Bacteria 1828
280 Ga0495657_0009359 3300046675 Bacteria 7431
281 Ga0495599_0027395 3300046678 Bacteria 3572
282 Ga0495623_0041863 3300046679 Bacteria 2919
283 Ga0495623_0194047 3300046679 Bacteria 1171
284 Ga0495646_0001219 3300046680 Bacteria 15076
285 Ga0495646_0098114 3300046680 Bacteria 1683
286 Ga0495613_0001604 3300046689 Bacteria 17173
287 Ga0495613_0047613 3300046689 Bacteria 3167
288 Ga0495613_0093607 3300046689 Bacteria 2175
289 Ga0495624_0052502 3300046690 Bacteria 2576
290 Ga0495624_0228874 3300046690 Bacteria 1126
291 Ga0495624_0331998 3300046690 Bacteria 915
292 Ga0495589_0022590 3300046794 Bacteria 3209
293 Ga0495600_0221964 3300046809 Bacteria 1208
294 Ga0495600_0370010 3300046809 Bacteria 895
295 Ga0495581_0207623 3300047315 Bacteria 1146
296 Ga0495604_0040314 3300047317 Bacteria 3667
297 Ga0495674_0109895 3300047319 Bacteria 2338
298 Ga0495672_0013120 3300047320 Bacteria 5731
299 Ga0495676_0002322 3300047321 Bacteria 16872
300 Ga0495676_0024673 3300047321 Bacteria 5200
301 Ga0495676_0025920 3300047321 Bacteria 5053
302 Ga0495676_0039139 3300047321 Bacteria 3930
303 Ga0495680_0022675 3300047322 Bacteria 5231
304 Ga0495683_0023102 3300047323 Bacteria 3197
305 Ga0495687_010335 3300047443 Bacteria 5125
306 Ga0495675_0013724 3300047444 Bacteria 5120
307 Ga0495675_0127096 3300047444 Bacteria 1586
308 Ga0495675_0294790 3300047444 Bacteria 964
309 Ga0495677_0235676 3300047445 Bacteria 714
310 Ga0495673_0002452 3300047469 Bacteria 13057
311 Ga0495684_0034436 3300047471 Bacteria 3885
312 Ga0495686_0209016 3300047472 Bacteria 1116
313 Ga0495593_0054589 3300047673 Bacteria 2105
314 Ga0495602_0005980 3300048088 Bacteria 12776
315 Ga0495602_0252806 3300048088 Bacteria 1312
316 Ga0496100_0038566 3300048903 Bacteria 3028
317 Ga0496101_0025252 3300048904 Bacteria 4121
318 Ga0496101_0480319 3300048904 Bacteria 981
319 Ga0496102_0000590 3300048905 Bacteria 38332
320 Ga0496102_0104015 3300048905 Bacteria 2641
321 Ga0496102_0154458 3300048905 Bacteria 2157
322 Ga0496102_0232061 3300048905 Bacteria 1740
323 Ga0496103_0079792 3300048906 Bacteria 2057
324 Ga0496104_0490451 3300048907 Bacteria 1140
325 Ga0496104_0495339 3300048907 Bacteria 1133
326 Ga0496105_0022926 3300048908 Bacteria 5062
327 Ga0496105_0055119 3300048908 Bacteria 3283
328 Ga0496106_0000747 3300048909 Bacteria 23467
329 Ga0496106_0043235 3300048909 Bacteria 3380
330 Ga0496106_0212102 3300048909 Bacteria 1543
331 Ga0496108_0015708 3300048911 Bacteria 6176
332 Ga0496108_0124761 3300048911 Bacteria 2210
333 Ga0496108_0619928 3300048911 Bacteria 942
334 Ga0496108_0624370 3300048911 Bacteria 938
335 Ga0496109_0009070 3300048912 Bacteria 8472
336 Ga0496109_0018281 3300048912 Bacteria 6156
337 Ga0496109_0288446 3300048912 Bacteria 1547
338 Ga0496109_0547912 3300048912 Bacteria 1091
339 Ga0496110_0013951 3300048913 Bacteria 6658
340 Ga0496110_0017095 3300048913 Bacteria 6064
341 Ga0496110_0097497 3300048913 Bacteria 2634
342 Ga0496110_0408425 3300048913 Bacteria 1238
343 Ga0496111_0066284 3300048914 Bacteria 2622
344 Ga0496111_0155111 3300048914 Bacteria 1699
345 Ga0496111_0206415 3300048914 Bacteria 1460
346 Ga0496112_0041345 3300048915 Bacteria 4510
347 Ga0496112_0277697 3300048915 Bacteria 1623
348 Ga0496113_0397505 3300048916 Bacteria 1106
349 Ga0496114_0136760 3300048917 Bacteria 2119
350 Ga0496114_0176818 3300048917 Bacteria 1863
351 Ga0496115_0022882 3300048918 Bacteria 4848
352 Ga0496122_0019211 3300048925 Bacteria 6254
353 Ga0496123_0081978 3300048926 Bacteria 1957
354 Ga0496125_0042008 3300048928 Bacteria 3901
355 Ga0496126_0000037 3300048929 Bacteria 353425
356 Ga0496126_0020724 3300048929 Bacteria 6438
357 Ga0501321_015613 3300049537 Bacteria 896
358 Ga0501032_0000689 3300049569 Bacteria 27464
359 Ga0501032_0119194 3300049569 Bacteria 1745
360 Ga0501033_0018191 3300049570 Bacteria 5310
361 Ga0501033_0109880 3300049570 Bacteria 2007
362 Ga0501034_0003410 3300049571 Bacteria 18139
363 Ga0501034_0007309 3300049571 Bacteria 11771
364 Ga0501034_0019166 3300049571 Bacteria 7005
365 Ga0501034_0024703 3300049571 Bacteria 6112
366 Ga0501034_0035561 3300049571 Bacteria 5049
367 Ga0501034_0120583 3300049571 Bacteria 2609
368 Ga0501034_0130730 3300049571 Bacteria 2494
369 Ga0501036_0000486 3300049572 Bacteria 28397
370 Ga0501036_0002369 3300049572 Bacteria 14736
371 Ga0501036_0075313 3300049572 Bacteria 2855
372 Ga0501036_0079713 3300049572 Bacteria 2769
373 Ga0501036_0538942 3300049572 Bacteria 970
374 Ga0501037_0000239 3300049573 Bacteria 47096
375 Ga0501037_0006239 3300049573 Bacteria 8719
376 Ga0501037_0012641 3300049573 Bacteria 6220
377 Ga0501037_0630647 3300049573 Bacteria 718
378 Ga0501038_0003441 3300049574 Bacteria 14762
379 Ga0501038_0018884 3300049574 Bacteria 6224
380 Ga0501038_0136804 3300049574 Bacteria 2006
381 Ga0501039_0002630 3300049575 Bacteria 13411
382 Ga0501039_0465964 3300049575 Bacteria 992
383 Ga0501039_0516415 3300049575 Bacteria 938
384 Ga0501039_0545872 3300049575 Bacteria 909
385 Ga0501040_0030738 3300049576 Bacteria 3628
386 Ga0501041_0010231 3300049577 Bacteria 5528
387 Ga0501042_0340855 3300049578 Bacteria 1084
388 Ga0501042_0409057 3300049578 Bacteria 983
389 Ga0501043_0004194 3300049579 Bacteria 11766
390 Ga0501043_0014850 3300049579 Bacteria 6096
391 Ga0501043_0016735 3300049579 Bacteria 5746
392 Ga0501043_0063589 3300049579 Bacteria 2898
393 Ga0501046_0025372 3300049580 Bacteria 4851
394 Ga0501046_0072691 3300049580 Bacteria 2670
395 Ga0501047_0016832 3300049581 Bacteria 6985
396 Ga0501047_0052308 3300049581 Bacteria 3947
397 Ga0501047_0500959 3300049581 Bacteria 1041
398 Ga0501067_0013599 3300049583 Bacteria 4506
399 Ga0501068_0001322 3300049584 Bacteria 13148
400 Ga0501068_0205828 3300049584 Bacteria 1249
401 Ga0501070_0009655 3300049586 Bacteria 8157
402 Ga0501070_0439912 3300049586 Bacteria 1052
403 Ga0501071_0008128 3300049587 Bacteria 6919
404 Ga0501071_0125734 3300049587 Bacteria 1903
405 Ga0501071_0169307 3300049587 Bacteria 1635
406 Ga0501071_0288475 3300049587 Bacteria 1243
407 Ga0501072_0022272 3300049588 Bacteria 4915
408 Ga0501073_0005451 3300049589 Bacteria 9534
409 Ga0501073_0031623 3300049589 Bacteria 3776
410 Ga0501073_0045475 3300049589 Bacteria 3091
411 Ga0501074_0031987 3300049590 Bacteria 3813
412 Ga0501074_0635245 3300049590 Bacteria 754
413 Ga0501075_0264874 3300049591 Bacteria 1310
414 Ga0501076_0207157 3300049592 Bacteria 1602
415 Ga0501076_0587721 3300049592 Bacteria 918
416 Ga0501076_0799519 3300049592 Bacteria 778
417 Ga0501261_024606 3300049690 Bacteria 882
418 Ga0501079_0035300 3300049741 Bacteria 3848
419 Ga0501080_0140646 3300049742 Bacteria 2231
420 Ga0501035_0000769 3300049822 Bacteria 34454
421 Ga0501035_0048967 3300049822 Bacteria 3788
422 Ga0501035_0098939 3300049822 Bacteria 2561
423 Ga0501035_0312904 3300049822 Bacteria 1321
424 Ga0501044_0007706 3300049823 Bacteria 11841
425 Ga0501044_0008295 3300049823 Bacteria 11389
426 Ga0501044_0010533 3300049823 Bacteria 10035
427 Ga0501044_0056692 3300049823 Bacteria 4023
428 Ga0501044_0422764 3300049823 Bacteria 1242
429 Ga0501044_0609343 3300049823 Bacteria 984
430 Ga0501045_0032416 3300049824 Bacteria 3786
431 nmdc:mga03n38_100381_c1 3300050490 Bacteria 1395
432 nmdc:mga03n38_130226_c1 3300050490 Bacteria 1246
433 nmdc:mga03n38_39051_c1 3300050490 Bacteria 2057
434 nmdc:mga00v17_177320_c1 3300050491 Bacteria 1375
435 nmdc:mga00v17_24911_c1 3300050491 Bacteria 3473
436 nmdc:mga00v17_625354_c1 3300050491 Bacteria 693
437 nmdc:mga0yw44_181579_c1 3300050492 Bacteria 1385
438 nmdc:mga0yw44_43993_c1 3300050492 Bacteria 2669
439 nmdc:mga0yw44_5969_c1 3300050492 Bacteria 5829
440 nmdc:mga0yw44_79388_c1 3300050492 Bacteria 2053
441 nmdc:mga06z11_14046_c1 3300050494 Bacteria 3535
442 nmdc:mga06z11_73613_c1 3300050494 Bacteria 1814
443 nmdc:mga04h51_100110_c1 3300050495 Bacteria 1055
444 nmdc:mga04h51_9492_c1 3300050495 Bacteria 2640
445 nmdc:mga07m45_17973_c1 3300050496 Bacteria 3807
446 nmdc:mga05p37_496825_c1 3300050507 Bacteria 1401
447 nmdc:mga0qj67_103798_c1 3300050509 Bacteria 2293
448 nmdc:mga06r32_649452_c1 3300050510 Bacteria 1023
449 nmdc:mga08y16_111255_c1 3300050511 Bacteria 2851
450 nmdc:mga0sz30_10444_c1 3300050516 Bacteria 3561
451 nmdc:mga0sz30_313355_c1 3300050516 Bacteria 700
452 nmdc:mga0sz30_37501_c1 3300050516 Bacteria 2029
453 Ga0495601_0000461 3300053077 Bacteria 21375
454 Ga0495601_0067635 3300053077 Bacteria 2276
455 Ga0495601_0174196 3300053077 Bacteria 1406
456 Ga0495612_0007194 3300053078 Bacteria 4552
457 Ga0495612_0228739 3300053078 Bacteria 824
458 Ga0495619_0002136 3300053085 Bacteria 13111
459 Ga0495619_0011923 3300053085 Bacteria 5474
460 Ga0495619_0177616 3300053085 Bacteria 1473
461 Ga0495619_0218742 3300053085 Bacteria 1319
462 Ga0500556_0001763 3300053104 Bacteria 8098
463 Ga0500560_106804 3300053107 Bacteria 938
464 Ga0500593_000181 3300053117 Bacteria 25642
465 Ga0500616_0000171 3300053153 Bacteria 108118
466 Ga0500616_0003998 3300053153 Bacteria 10756
467 Ga0501084_0016947 3300054114 Bacteria 6055
468 Ga0501084_0407026 3300054114 Bacteria 1150
469 Ga0501082_0094632 3300060353 Bacteria 2581
470 Ga0466962_0005612 3300061719 Bacteria 6026
471 Ga0466962_0047042 3300061719 Bacteria 2061
472 Ga0530510_0014960 3300061734 Bacteria 5478
473 Ga0530510_0299456 3300061734 Bacteria 1203
474 Ga0530510_0490288 3300061734 Bacteria 931
475 2515855005 2515154155 Bacteria 7985436
476 2547405822 2547132111 Bacteria 8013147
477 2547409960 2547132111 Bacteria 8013147
478 2566992074 2565956761 Bacteria 6601618
479 2585301023 2582581312 Bacteria 7308206
480 2585309452 2582581313 Bacteria 10042643
481 2616904815 2616644941 Bacteria 8510691
482 2643764203 2643221548 Bacteria 8053412
483 2643900334 2643221578 Bacteria 9213798
484 2643943683 2643221587 Bacteria 7586415
485 2644388299 2643221670 Bacteria 6497041
486 2644405442 2643221673 Bacteria 9196637
487 2644434058 2643221677 Bacteria 7584031
488 2644444211 2643221679 Bacteria 3839507
489 2644460461 2643221682 Bacteria 6743283
490 2644513313 2643221692 Bacteria 7282860
491 2644634044 2643221715 Bacteria 6671032
492 2686534403 2684623035 Bacteria 8032739
493 2689996540 2687453743 Bacteria 8361025
494 2738891089 2738541308 Bacteria 7020677
495 2739205013 2738543005 Bacteria 5278128
496 2739236322 2738543011 Bacteria 5731169
497 2785344568 2784746763 Bacteria 9783172
498 2793978549 2791355406 Bacteria 11364898
499 2808846307 2808606359 Bacteria 9866990
500 2808871966 2808606365 Bacteria 4301966
501 2808914098 2808606375 Bacteria 9466072
502 2809232193 2808606448 Bacteria 8656184
503 2812358816 2811994879 Bacteria 9313447
504 2842137436 2842134933 Bacteria 5847019
505 2852641898 2852635781 Bacteria 8251373
506 2862185753 2862178590 Bacteria 8583590
507 2862290362 2862281513 Bacteria 9621493
508 2862508822 2862507626 Bacteria 9425308
509 2862705697 2862705112 Bacteria 6563286
510 2866553402 2866552031 Bacteria 5824618
511 2866614163 2866612099 Bacteria 7543886
512 2867428903 2867428634 Bacteria 9590268
513 2870787586 2870782633 Bacteria 9624083
514 2875395743 2875391855 Bacteria 7600475
515 2889304212 2889300758 Bacteria 5690814
516 2895889695 2895880812 Bacteria 11255272
517 2902813045 2902810491 Bacteria 6794147
518 2904538523 2904535858 Bacteria 6308016
519 2912715138 2912715099 Bacteria 9460473
520 2912721367 2912715099 Bacteria 9460473
521 2912760930 2912757875 Bacteria 7940295
522 2918506791 2918501144 Bacteria 8668083
523 2919475656 2919468124 Bacteria 9133025
524 2929218295 2929212328 Bacteria 7708288
525 2935394230 2935390628 Bacteria 7043367
526 2939585626 2939582691 Bacteria 7088898
527 2939745394 2939743619 Bacteria 5762299
528 2946049328 2946045630 Bacteria 8527308
529 2946067056 2946064051 Bacteria 8957905
530 2946073750 2946072368 Bacteria 8999607
531 2947230185 2947224130 Bacteria 9938529
532 2954719715 2954711539 Bacteria 10867210
533 2954729750 2954721474 Bacteria 10456478
534 2954732029 2954731030 Bacteria 10243860
535 2954748656 2954740390 Bacteria 10229294
536 2954750998 2954749733 Bacteria 10366972
537 2954767773 2954759201 Bacteria 9358192
538 2966605291 2966598605 Bacteria 7676064
539 2974316738 2974315732 Bacteria 4602776
540 2984524919 2984523437 Bacteria 4508481
541 3006327361 3006321560 Bacteria 8247479
542 3006396812 3006393351 Bacteria 6615579
543 3006429806 3006425503 Bacteria 6491253
544 3006491228 3006486233 Bacteria 8157040
545 3006496110 3006493962 Bacteria 8825450
546 8002789451 8002784119 Bacteria 9788632
547 8008490849 8008485437 Bacteria 7198341
548 8023629681 8023623736 Bacteria 8593882
549 8025527758 8025524527 Bacteria 7197316
550 8047903193 8047893842 Bacteria 11723082
551 8048365779 8048356638 Bacteria 11044339
552 8048379368 8048369669 Bacteria 11666822
553 8048388475 8048379754 Bacteria 11877923
554 8048407935 8048406513 Bacteria 8936924
555 8054927319 8054920844 Bacteria 7068637
556 8055162145 8055157932 Bacteria 6429399
557 8056060804 8056060235 Bacteria 7259403
558 8056448260 8056447290 Bacteria 7680491
559 Ga0501074_0049475
560 JGI24034J26672_10017258
561 rootH1_10074083
562 rootH2_10053788
563 rootL2_10043628
564 rootH1_10106340
565 JGI25160J50197_1027640
566 Ga0006562J51391_1062637
567 Ga0070668_100588106
568 Ga0070671_100000977
569 Ga0070671_100086632
570 Ga0070667_100078813
571 Ga0070711_100554426
572 Ga0070706_100097385
573 Ga0070698_100050895
574 Ga0070684_100934660
575 Ga0070686_100113400
576 Ga0070665_100092094
577 Ga0070665_100673170
578 Ga0070665_100675617
579 Ga0068864_100379088
580 Ga0068864_100612132
581 Ga0068863_100002336
582 Ga0068863_100169632
583 Ga0068858_100661886
584 Ga0068860_100252541
585 Ga0068862_100001101
586 Ga0068862_100711111
587 Ga0081455_10073688
588 Ga0075365_10011291
589 Ga0075365_10119155
590 Ga0075368_10009006
591 Ga0075368_10035210
592 Ga0075368_10089979
593 Ga0075363_100003846
594 Ga0075363_100007494
595 Ga0075364_10000849
596 Ga0075364_10042089
597 Ga0075364_10315730
598 Ga0075362_10009082
599 Ga0075367_10065174
600 Ga0075369_10008100
601 Ga0075369_10013387
602 Ga0075366_10151332
603 Ga0075370_10189034
604 Ga0075430_100117270
605 Ga0097620_100000044
606 Ga0075435_100973025
607 Ga0105250_10034352
608 Ga0105250_10135670
609 Ga0105245_10019505
610 Ga0105245_10857071
611 Ga0105247_10031072
612 Ga0105243_10000750
613 Ga0105243_10566844
614 Ga0105242_11330710
615 Ga0105248_10239575
616 Ga0105248_10880598
617 Ga0105249_10003809
618 Ga0105249_10007789
619 Ga0105249_10641426
620 Ga0105239_10326097
621 Ga0105239_11000410
622 Ga0105246_10490932
623 Ga0157369_10777689
624 Ga0163162_10511978
625 Ga0157375_10575770
626 Ga0157375_10803871
627 Ga0163163_10021894
628 Ga0157380_10550716
629 Ga0157380_10588136
630 Ga0157379_10059877
631 Ga0157379_10241363
632 Ga0182007_10000820
633 Ga0183367_1004
634 Ga0213873_10092445
635 Ga0213876_10022886
636 Ga0213875_10005320
637 Ga0213875_10011596
638 Ga0209758_1012033
639 Ga0207426_1001852
640 Ga0207642_10354007
641 Ga0207684_10272654
642 Ga0207663_10488708
643 Ga0207694_10456195
644 Ga0207687_10122487
645 Ga0207687_10336090
646 Ga0207644_10000835
647 Ga0207644_10749264
648 Ga0207686_10286469
649 Ga0207709_10001151
650 Ga0207670_10783290
651 Ga0207711_10315213
652 Ga0207712_10031034
653 Ga0207712_10079714
654 Ga0207668_10287574
655 Ga0207703_10184902
656 Ga0207703_10558660
657 Ga0207641_10003507
658 Ga0207641_10244651
659 Ga0207676_10307053
660 Ga0207675_100862520
661 Ga0209813_10085617
662 Ga0209813_10160413
663 Ga0268266_10062249
664 Ga0268265_10000205
665 Ga0268264_10075109
666 Ga0316177_1078076
667 Ga0314311_1183463
668 Ga0316180_1114495
669 Ga0265327_10013716
670 Ga0307509_10111814
671 Ga0307509_10144905
672 Ga0307408_100199833
673 Ga0307408_100767347
674 Ga0307514_10162596
675 Ga0265314_10072367
676 Ga0316576_10169855
677 Ga0307516_10021923
678 Ga0307405_10107696
679 Ga0307410_10012126
680 Ga0307410_10172314
681 Ga0307410_10187966
682 Ga0307410_10386480
683 Ga0307406_10027987
684 Ga0307406_10468812
685 Ga0307406_10729932
686 Ga0307406_10887214
687 Ga0307407_10567272
688 Ga0307409_100008711
689 Ga0307409_100692446
690 Ga0307416_100747255
691 Ga0307414_10346294
692 Ga0307507_10152726
693 Ga0373944_0119861
694 Ga0373936_0230297
695 Ga0373947_0077679
696 Ga0395898_0000804
697 Ga0395898_0160102
698 Ga0436364_0103177
699 Ga0436364_1000426
700 Ga0395901_0917122
701 Ga0436365_0380684
702 Ga0436365_0926350
703 Ga0436360_1196039
704 Ga0436362_0729387
705 Ga0436362_0777322
706 Ga0439436_0003333
707 Ga0439436_0008617
708 Ga0439439_0031775
709 Ga0439461_0003552
710 Ga0439466_0035115
711 Ga0439465_0003133
712 Ga0439465_0022572
713 Ga0451841_1195414
714 Ga0451853_4084173
715 Ga0439431_0000401
716 Ga0439433_0007032
717 Ga0439442_015914
718 Ga0439445_0006000
719 Ga0439445_0034740
720 Ga0439449_0000109
721 Ga0439449_0009889
722 Ga0439449_0019723
723 Ga0439457_000294
724 Ga0439457_000938
725 Ga0439462_0000129
726 Ga0439462_0002037
727 Ga0439434_0001224
728 Ga0466969_0064144
729 Ga0466972_0002980
730 Ga0466972_0006871
731 Ga0466972_0024808
732 Ga0466972_0039295
733 Ga0466965_0001514
734 Ga0466965_0002399
735 Ga0466965_0025537
736 Ga0466965_0044134
737 Ga0466965_0161679
738 Ga0466966_0032726
739 Ga0466966_0062149
740 Ga0466961_0003600
741 Ga0466961_0067637
742 Ga0466961_0083416
743 Ga0466963_0008454
744 Ga0466963_0178399
745 Ga0466963_0208162
746 Ga0466964_0003045
747 Ga0466964_0018576
748 Ga0466964_0274413
749 Ga0466971_0000592
750 Ga0466971_0105748
751 Ga0466971_0311323
752 Ga0466968_0000740
753 Ga0466968_0201591
754 Ga0466970_0001101
755 Ga0466970_0004857
756 Ga0466970_0005433
757 Ga0466970_0030354
758 Ga0466970_0252582
759 Ga0466957_0065851
760 Ga0466957_0170766
761 Ga0466960_0000211
762 Ga0466960_0001994
763 Ga0466960_0046631
764 Ga0466960_0090671
765 Ga0466960_0162857
766 Ga0466960_0200447
767 Ga0466960_0393608
768 Ga0466959_0016218
769 Ga0466959_0034141
770 Ga0466959_0223484
771 Ga0466958_0003654
772 Ga0466958_0037421
773 Ga0466958_0478388
774 Ga0466967_0017271
775 Ga0466967_0109662
776 Ga0466967_0892094
777 Ga0466967_1076754
778 Ga0495592_0077915
779 Ga0495592_0225759
780 Ga0495603_0002322
781 Ga0495603_0019438
782 Ga0495603_0038104
783 Ga0495629_0002081
784 Ga0495638_0202120
785 Ga0495638_0204256
786 Ga0495651_0106461
787 Ga0495653_0111818
788 Ga0495662_0000547
789 Ga0495585_0013239
790 Ga0495585_0015891
791 Ga0495585_0028621
792 Ga0495594_0002842
793 Ga0495594_0009130
794 Ga0495594_0078508
795 Ga0495594_0292609
796 Ga0495583_0151532
797 Ga0495608_0009100
798 Ga0495608_0133987
799 Ga0495618_0018061
800 Ga0495618_0102918
801 Ga0495620_0013702
802 Ga0495628_0003272
803 Ga0495628_0004772
804 Ga0495628_0009608
805 Ga0495630_0034365
806 Ga0495631_0107065
807 Ga0495648_0011675
808 Ga0495648_0155259
809 Ga0495666_0004007
810 Ga0495666_0063679
811 Ga0495652_0001657
812 Ga0495654_0042419
813 Ga0495640_0002082
814 Ga0495640_0040188
815 Ga0495640_0183313
816 Ga0495586_0004211
817 Ga0495586_0285764
818 Ga0495586_0306556
819 Ga0495587_0006071
820 Ga0495587_0071459
821 Ga0495645_0025308
822 Ga0495645_0126268
823 Ga0495645_0167564
824 Ga0495622_0001327
825 Ga0495667_0007329
826 Ga0495667_0112976
827 Ga0495668_0022079
828 Ga0495668_0022327
829 Ga0495668_0483775
830 Ga0495634_0048813
831 Ga0495634_0060553
832 Ga0495634_0139408
833 Ga0495611_0013640
834 Ga0495611_0194719
835 Ga0495635_0007290
836 Ga0495588_0013525
837 Ga0495588_0069685
838 Ga0495657_0009359
839 Ga0495599_0027395
840 Ga0495623_0041863
841 Ga0495623_0194047
842 Ga0495646_0001219
843 Ga0495646_0098114
844 Ga0495613_0001604
845 Ga0495613_0047613
846 Ga0495613_0093607
847 Ga0495624_0052502
848 Ga0495624_0228874
849 Ga0495624_0331998
850 Ga0495589_0022590
851 Ga0495600_0221964
852 Ga0495600_0370010
853 Ga0495581_0207623
854 Ga0495604_0040314
855 Ga0495674_0109895
856 Ga0495672_0013120
857 Ga0495676_0002322
858 Ga0495676_0024673
859 Ga0495676_0025920
860 Ga0495676_0039139
861 Ga0495680_0022675
862 Ga0495683_0023102
863 Ga0495687_010335
864 Ga0495675_0013724
865 Ga0495675_0127096
866 Ga0495675_0294790
867 Ga0495677_0235676
868 Ga0495673_0002452
869 Ga0495684_0034436
870 Ga0495686_0209016
871 Ga0495593_0054589
872 Ga0495602_0005980
873 Ga0495602_0252806
874 Ga0496100_0038566
875 Ga0496101_0025252
876 Ga0496101_0480319
877 Ga0496102_0000590
878 Ga0496102_0104015
879 Ga0496102_0154458
880 Ga0496102_0232061
881 Ga0496103_0079792
882 Ga0496104_0490451
883 Ga0496104_0495339
884 Ga0496105_0022926
885 Ga0496105_0055119
886 Ga0496106_0000747
887 Ga0496106_0043235
888 Ga0496106_0212102
889 Ga0496108_0015708
890 Ga0496108_0124761
891 Ga0496108_0619928
892 Ga0496108_0624370
893 Ga0496109_0009070
894 Ga0496109_0018281
895 Ga0496109_0288446
896 Ga0496109_0547912
897 Ga0496110_0013951
898 Ga0496110_0017095
899 Ga0496110_0097497
900 Ga0496110_0408425
901 Ga0496111_0066284
902 Ga0496111_0155111
903 Ga0496111_0206415
904 Ga0496112_0041345
905 Ga0496112_0277697
906 Ga0496113_0397505
907 Ga0496114_0136760
908 Ga0496114_0176818
909 Ga0496115_0022882
910 Ga0496122_0019211
911 Ga0496123_0081978
912 Ga0496125_0042008
913 Ga0496126_0000037
914 Ga0496126_0020724
915 Ga0501321_015613
916 Ga0501032_0000689
917 Ga0501032_0119194
918 Ga0501033_0018191
919 Ga0501033_0109880
920 Ga0501034_0003410
921 Ga0501034_0007309
922 Ga0501034_0019166
923 Ga0501034_0024703
924 Ga0501034_0035561
925 Ga0501034_0120583
926 Ga0501034_0130730
927 Ga0501036_0000486
928 Ga0501036_0002369
929 Ga0501036_0075313
930 Ga0501036_0079713
931 Ga0501036_0538942
932 Ga0501037_0000239
933 Ga0501037_0006239
934 Ga0501037_0012641
935 Ga0501037_0630647
936 Ga0501038_0003441
937 Ga0501038_0018884
938 Ga0501038_0136804
939 Ga0501039_0002630
940 Ga0501039_0465964
941 Ga0501039_0516415
942 Ga0501039_0545872
943 Ga0501040_0030738
944 Ga0501041_0010231
945 Ga0501042_0340855
946 Ga0501042_0409057
947 Ga0501043_0004194
948 Ga0501043_0014850
949 Ga0501043_0016735
950 Ga0501043_0063589
951 Ga0501046_0025372
952 Ga0501046_0072691
953 Ga0501047_0016832
954 Ga0501047_0052308
955 Ga0501047_0500959
956 Ga0501067_0013599
957 Ga0501068_0001322
958 Ga0501068_0205828
959 Ga0501070_0009655
960 Ga0501070_0439912
961 Ga0501071_0008128
962 Ga0501071_0125734
963 Ga0501071_0169307
964 Ga0501071_0288475
965 Ga0501072_0022272
966 Ga0501073_0005451
967 Ga0501073_0031623
968 Ga0501073_0045475
969 Ga0501074_0031987
970 Ga0501074_0635245
971 Ga0501075_0264874
972 Ga0501076_0207157
973 Ga0501076_0587721
974 Ga0501076_0799519
975 Ga0501261_024606
976 Ga0501079_0035300
977 Ga0501080_0140646
978 Ga0501035_0000769
979 Ga0501035_0048967
980 Ga0501035_0098939
981 Ga0501035_0312904
982 Ga0501044_0007706
983 Ga0501044_0008295
984 Ga0501044_0010533
985 Ga0501044_0056692
986 Ga0501044_0422764
987 Ga0501044_0609343
988 Ga0501045_0032416
989 nmdc:mga03n38_100381_c1
990 nmdc:mga03n38_130226_c1
991 nmdc:mga03n38_39051_c1
992 nmdc:mga00v17_177320_c1
993 nmdc:mga00v17_24911_c1
994 nmdc:mga00v17_625354_c1
995 nmdc:mga0yw44_181579_c1
996 nmdc:mga0yw44_43993_c1
997 nmdc:mga0yw44_5969_c1
998 nmdc:mga0yw44_79388_c1
999 nmdc:mga06z11_14046_c1
1000 nmdc:mga06z11_73613_c1
1001 nmdc:mga04h51_100110_c1
1002 nmdc:mga04h51_9492_c1
1003 nmdc:mga07m45_17973_c1
1004 nmdc:mga05p37_496825_c1
1005 nmdc:mga0qj67_103798_c1
1006 nmdc:mga06r32_649452_c1
1007 nmdc:mga08y16_111255_c1
1008 nmdc:mga0sz30_10444_c1
1009 nmdc:mga0sz30_313355_c1
1010 nmdc:mga0sz30_37501_c1
1011 Ga0495601_0000461
1012 Ga0495601_0067635
1013 Ga0495601_0174196
1014 Ga0495612_0007194
1015 Ga0495612_0228739
1016 Ga0495619_0002136
1017 Ga0495619_0011923
1018 Ga0495619_0177616
1019 Ga0495619_0218742
1020 Ga0500556_0001763
1021 Ga0500560_106804
1022 Ga0500593_000181
1023 Ga0500616_0000171
1024 Ga0500616_0003998
1025 Ga0501084_0016947
1026 Ga0501084_0407026
1027 Ga0501082_0094632
1028 Ga0466962_0005612
1029 Ga0466962_0047042
1030 Ga0530510_0014960
1031 Ga0530510_0299456
1032 Ga0530510_0490288
1033 2515855005
1034 2547405822
1035 2547409960
1036 2566992074
1037 2585301023
1038 2585309452
1039 2616904815
1040 2643764203
1041 2643900334
1042 2643943683
1043 2644388299
1044 2644405442
1045 2644434058
1046 2644444211
1047 2644460461
1048 2644513313
1049 2644634044
1050 2686534403
1051 2689996540
1052 2738891089
1053 2739205013
1054 2739236322
1055 2785344568
1056 2793978549
1057 2808846307
1058 2808871966
1059 2808914098
1060 2809232193
1061 2812358816
1062 2842137436
1063 2852641898
1064 2862185753
1065 2862290362
1066 2862508822
1067 2862705697
1068 2866553402
1069 2866614163
1070 2867428903
1071 2870787586
1072 2875395743
1073 2889304212
1074 2895889695
1075 2902813045
1076 2904538523
1077 2912715138
1078 2912721367
1079 2912760930
1080 2918506791
1081 2919475656
1082 2929218295
1083 2935394230
1084 2939585626
1085 2939745394
1086 2946049328
1087 2946067056
1088 2946073750
1089 2947230185
1090 2954719715
1091 2954729750
1092 2954732029
1093 2954748656
1094 2954750998
1095 2954767773
1096 2966605291
1097 2974316738
1098 2984524919
1099 3006327361
1100 3006396812
1101 3006429806
1102 3006491228
1103 3006496110
1104 8002789451
1105 8008490849
1106 8023629681
1107 8025527758
1108 8047903193
1109 8048365779
1110 8048379368
1111 8048388475
1112 8048407935
1113 8054927319
1114 8055162145
1115 8056060804
1116 8056448260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

88

206

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.7939 2 214
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.7834 2 214
5xcc-assembly2.cif.gz_B x-ray structure of clostridium perfringens pili protein cppa 0.729 192 213
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7259 2 214
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7228 2 214
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8035 3 214 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7784 3 214 3.40.430.10
af_K7VBN7_519_611_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7734 196 214 3.30.70.260
af_I1N552_1_226_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7408 196 213 3.30.420.40
3hz7A00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.74 168 212 3.30.110.40
ID Description Score Start End GO Terms
AF-A0A1X0BBT3-F1-model_v4 Deaminase 1 1 214 GO:0008703
GO:0009231
AF-A0A6G3VUI2-F1-model_v4 deleted 0.997 75 167
AF-I7G9J7-F1-model_v4 DNA-binding protein 0.9952 1 214 GO:0003677
GO:0008703
GO:0009231
AF-A0A6G9YCB5-F1-model_v4 Deaminase 0.9947 1 214
AF-A0A6G8G3Z3-F1-model_v4 Deaminase 0.9947 12 214 GO:0008703
GO:0009231

Map