F463492
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 558 | 377 | 1116 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0009373|Ga0495672_0009373_4253_5023 |
| Length | 256 |
| Sequence | MPAFVLKAQVSASAAAELINVDAADDGDDAMMLHIPNVLTPEQVARCKDVMTKAAWVDGNVTAGHQSSKVKYNLQLPEESAEARELGDMVRGALARNPMFMSAVLPMQVFPPLFNRYDAGMTFGSHVDNAIRTHSHLPVRIRTDVSSTLFISSPEDYDGGELVVEDTYGSHSVKLPAGDLVIYPATSLHHVTPITRGSRIASFFWTQSMIRDVSHRTMLFDLDMSIIRLTQDAPNHPSLVSLTGLYHNLLRQWAEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 225 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 226 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 253 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 290 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 292 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 294 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 295 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 296 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 297 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 299 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 300 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 309 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 310 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 311 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 312 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 313 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 314 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 315 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 316 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 317 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 318 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 319 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 320 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 321 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 322 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 323 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 324 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 325 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 326 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 327 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 328 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 329 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 330 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 331 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 332 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 333 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 334 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 335 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 336 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 337 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 338 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 339 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 340 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 341 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 342 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 343 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 344 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 345 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 346 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 347 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 348 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 349 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 350 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 351 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 352 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 353 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 354 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 355 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 356 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 357 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 358 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 359 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 360 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 361 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 362 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 363 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 364 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 365 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 366 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 367 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 368 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 369 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 370 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 371 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 372 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 373 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 374 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 375 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 376 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 377 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.46 |
| Metatranscriptomes | 0 |
| Isolates | 12.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.63 |
| Nodule | 7.35 |
| Rhizoplane | 4.66 |
| Rhizosphere | 75.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495672_0009373 | 3300047320 | Bacteria | 7100 |
| 2 | JGI24032J14994_100495 | 3300001430 | Bacteria | 2061 |
| 3 | JGI24752J21851_1020232 | 3300001976 | Bacteria | 869 |
| 4 | JGI24746J21847_1000861 | 3300001977 | Bacteria | 4713 |
| 5 | JGI24747J21853_1002968 | 3300001978 | Bacteria | 1434 |
| 6 | JGI24739J22299_10066316 | 3300001989 | Bacteria | 1130 |
| 7 | JGI24737J22298_10002394 | 3300001990 | Bacteria | 6691 |
| 8 | JGI24750J21931_1000859 | 3300002070 | Bacteria | 4172 |
| 9 | JGI24738J21930_10001606 | 3300002075 | Bacteria | 6224 |
| 10 | JGI24749J21850_1000589 | 3300002076 | Bacteria | 5297 |
| 11 | JGI24035J26624_1001701 | 3300002126 | Bacteria | 2059 |
| 12 | JGI24034J26672_10001847 | 3300002239 | Bacteria | 2857 |
| 13 | JGI24742J22300_10000991 | 3300002244 | Bacteria | 4360 |
| 14 | JGI24751J29686_10029296 | 3300002459 | Bacteria | 1143 |
| 15 | JGI25406J46586_10000166 | 3300003203 | Bacteria | 29209 |
| 16 | JGI25165J46597_1004351 | 3300003214 | Bacteria | 3073 |
| 17 | JGI25160J50197_1000838 | 3300003354 | Bacteria | 16394 |
| 18 | JGI25405J52794_10031955 | 3300003911 | Bacteria | 1095 |
| 19 | Ga0065704_10255096 | 3300005289 | Bacteria | 979 |
| 20 | Ga0065712_10095860 | 3300005290 | Bacteria | 2201 |
| 21 | Ga0065712_10200012 | 3300005290 | Bacteria | 1112 |
| 22 | Ga0065715_10002503 | 3300005293 | Bacteria | 5046 |
| 23 | Ga0070676_10003946 | 3300005328 | Bacteria | 7787 |
| 24 | Ga0070676_10475929 | 3300005328 | Bacteria | 883 |
| 25 | Ga0070683_100003103 | 3300005329 | Bacteria | 13382 |
| 26 | Ga0070683_100245619 | 3300005329 | Bacteria | 1702 |
| 27 | Ga0070690_100001658 | 3300005330 | Bacteria | 11711 |
| 28 | Ga0070670_100005908 | 3300005331 | Bacteria | 10347 |
| 29 | Ga0070670_100144883 | 3300005331 | Bacteria | 2055 |
| 30 | Ga0070670_100684204 | 3300005331 | Bacteria | 921 |
| 31 | Ga0070677_10002586 | 3300005333 | Bacteria | 5795 |
| 32 | Ga0068869_100003321 | 3300005334 | Bacteria | 9826 |
| 33 | Ga0068869_100208065 | 3300005334 | Bacteria | 1545 |
| 34 | Ga0070666_10061316 | 3300005335 | Bacteria | 2546 |
| 35 | Ga0070666_10347005 | 3300005335 | Unclassified | 1061 |
| 36 | Ga0070680_100005234 | 3300005336 | Bacteria | 9816 |
| 37 | Ga0070680_100464158 | 3300005336 | Bacteria | 1082 |
| 38 | Ga0070682_100002520 | 3300005337 | Bacteria | 10107 |
| 39 | Ga0068868_100009819 | 3300005338 | Bacteria | 6907 |
| 40 | Ga0068868_100018015 | 3300005338 | Bacteria | 5271 |
| 41 | Ga0070660_100001332 | 3300005339 | Bacteria | 16783 |
| 42 | Ga0070689_100032582 | 3300005340 | Bacteria | 3965 |
| 43 | Ga0070691_10002586 | 3300005341 | Bacteria | 8070 |
| 44 | Ga0070687_100001160 | 3300005343 | Bacteria | 9117 |
| 45 | Ga0070661_100002370 | 3300005344 | Bacteria | 12928 |
| 46 | Ga0070692_10000841 | 3300005345 | Bacteria | 10313 |
| 47 | Ga0070668_100006877 | 3300005347 | Bacteria | 8430 |
| 48 | Ga0070669_100006963 | 3300005353 | Bacteria | 8123 |
| 49 | Ga0070669_100613903 | 3300005353 | Unclassified | 912 |
| 50 | Ga0070675_100039738 | 3300005354 | Bacteria | 3840 |
| 51 | Ga0070675_100077803 | 3300005354 | Bacteria | 2762 |
| 52 | Ga0070675_100670601 | 3300005354 | Bacteria | 943 |
| 53 | Ga0070671_100005218 | 3300005355 | Bacteria | 10352 |
| 54 | Ga0070671_100101128 | 3300005355 | Bacteria | 2419 |
| 55 | Ga0070674_100006788 | 3300005356 | Bacteria | 6705 |
| 56 | Ga0070673_100000418 | 3300005364 | Bacteria | 22446 |
| 57 | Ga0070673_100011419 | 3300005364 | Bacteria | 6058 |
| 58 | Ga0070688_100000906 | 3300005365 | Bacteria | 14793 |
| 59 | Ga0070688_100041837 | 3300005365 | Bacteria | 2815 |
| 60 | Ga0070659_100003550 | 3300005366 | Bacteria | 11108 |
| 61 | Ga0070659_100068041 | 3300005366 | Bacteria | 2824 |
| 62 | Ga0070659_100746125 | 3300005366 | Bacteria | 849 |
| 63 | Ga0070667_100007947 | 3300005367 | Bacteria | 8797 |
| 64 | Ga0070667_100069961 | 3300005367 | Bacteria | 2987 |
| 65 | Ga0070667_100138890 | 3300005367 | Bacteria | 2126 |
| 66 | Ga0070703_10009495 | 3300005406 | Bacteria | 2743 |
| 67 | Ga0070713_100000146 | 3300005436 | Bacteria | 46988 |
| 68 | Ga0070713_100083941 | 3300005436 | Bacteria | 2724 |
| 69 | Ga0070701_10000664 | 3300005438 | Bacteria | 12083 |
| 70 | Ga0070701_10178248 | 3300005438 | Bacteria | 1242 |
| 71 | Ga0070705_100003104 | 3300005440 | Bacteria | 8170 |
| 72 | Ga0070700_100010501 | 3300005441 | Bacteria | 5116 |
| 73 | Ga0070694_100002530 | 3300005444 | Bacteria | 10796 |
| 74 | Ga0070708_100020015 | 3300005445 | Bacteria | 5636 |
| 75 | Ga0070663_100002896 | 3300005455 | Bacteria | 9759 |
| 76 | Ga0070678_100005419 | 3300005456 | Bacteria | 7367 |
| 77 | Ga0070678_100057502 | 3300005456 | Bacteria | 2849 |
| 78 | Ga0070678_100163247 | 3300005456 | Bacteria | 1807 |
| 79 | Ga0070678_100378912 | 3300005456 | Bacteria | 1223 |
| 80 | Ga0070681_10008649 | 3300005458 | Bacteria | 9982 |
| 81 | Ga0070681_10483877 | 3300005458 | Bacteria | 1151 |
| 82 | Ga0068867_100003064 | 3300005459 | Bacteria | 11775 |
| 83 | Ga0068867_100253946 | 3300005459 | Bacteria | 1431 |
| 84 | Ga0070679_100018279 | 3300005530 | Bacteria | 6799 |
| 85 | Ga0070684_100001969 | 3300005535 | Bacteria | 15093 |
| 86 | Ga0070697_100571351 | 3300005536 | Bacteria | 992 |
| 87 | Ga0068853_100004522 | 3300005539 | Bacteria | 10792 |
| 88 | Ga0068853_100005756 | 3300005539 | Bacteria | 9758 |
| 89 | Ga0070672_100006625 | 3300005543 | Bacteria | 7801 |
| 90 | Ga0070672_100048783 | 3300005543 | Bacteria | 3292 |
| 91 | Ga0070672_100183213 | 3300005543 | Bacteria | 1746 |
| 92 | Ga0070686_100002237 | 3300005544 | Bacteria | 10673 |
| 93 | Ga0070686_100239631 | 3300005544 | Bacteria | 1320 |
| 94 | Ga0070695_100002841 | 3300005545 | Bacteria | 10066 |
| 95 | Ga0070696_100003720 | 3300005546 | Bacteria | 10178 |
| 96 | Ga0070696_100543017 | 3300005546 | Bacteria | 930 |
| 97 | Ga0070693_100001170 | 3300005547 | Bacteria | 11794 |
| 98 | Ga0070665_100027334 | 3300005548 | Bacteria | 5747 |
| 99 | Ga0070665_100031750 | 3300005548 | Bacteria | 5316 |
| 100 | Ga0070665_100600575 | 3300005548 | Unclassified | 1113 |
| 101 | Ga0068855_100010841 | 3300005563 | Bacteria | 11004 |
| 102 | Ga0070664_100039822 | 3300005564 | Bacteria | 3961 |
| 103 | Ga0070664_100965351 | 3300005564 | Unclassified | 800 |
| 104 | Ga0068857_100002282 | 3300005577 | Bacteria | 15594 |
| 105 | Ga0068854_100011480 | 3300005578 | Bacteria | 5770 |
| 106 | Ga0068854_100371757 | 3300005578 | Bacteria | 1176 |
| 107 | Ga0068856_100002597 | 3300005614 | Bacteria | 18595 |
| 108 | Ga0068856_100087023 | 3300005614 | Bacteria | 3105 |
| 109 | Ga0070702_100011694 | 3300005615 | Bacteria | 4373 |
| 110 | Ga0068852_100006066 | 3300005616 | Bacteria | 8706 |
| 111 | Ga0068852_100010433 | 3300005616 | Bacteria | 6944 |
| 112 | Ga0068852_100090962 | 3300005616 | Bacteria | 2730 |
| 113 | Ga0068852_100471115 | 3300005616 | Unclassified | 1246 |
| 114 | Ga0068852_100492648 | 3300005616 | Bacteria | 1219 |
| 115 | Ga0068859_100005044 | 3300005617 | Bacteria | 13403 |
| 116 | Ga0068859_100335169 | 3300005617 | Bacteria | 1607 |
| 117 | Ga0068864_100003691 | 3300005618 | Bacteria | 12643 |
| 118 | Ga0068864_100085589 | 3300005618 | Unclassified | 2772 |
| 119 | Ga0068866_10000899 | 3300005718 | Bacteria | 13114 |
| 120 | Ga0068851_10017089 | 3300005834 | Bacteria | 3481 |
| 121 | Ga0068870_10000555 | 3300005840 | Bacteria | 14125 |
| 122 | Ga0068863_100045734 | 3300005841 | Bacteria | 4154 |
| 123 | Ga0068863_100105926 | 3300005841 | Bacteria | 2675 |
| 124 | Ga0068858_100011919 | 3300005842 | Bacteria | 8194 |
| 125 | Ga0068858_100013722 | 3300005842 | Bacteria | 7647 |
| 126 | Ga0068858_100930323 | 3300005842 | Bacteria | 851 |
| 127 | Ga0068860_100016500 | 3300005843 | Bacteria | 7203 |
| 128 | Ga0068860_100269920 | 3300005843 | Bacteria | 1660 |
| 129 | Ga0068860_100283302 | 3300005843 | Bacteria | 1620 |
| 130 | Ga0068862_100003011 | 3300005844 | Bacteria | 14700 |
| 131 | Ga0068862_100500464 | 3300005844 | Bacteria | 1153 |
| 132 | Ga0081455_10000673 | 3300005937 | Bacteria | 44258 |
| 133 | Ga0081540_1113215 | 3300005983 | Bacteria | 1142 |
| 134 | Ga0081539_10000351 | 3300005985 | Bacteria | 101228 |
| 135 | Ga0081539_10000933 | 3300005985 | Bacteria | 54819 |
| 136 | Ga0070717_10430089 | 3300006028 | Unclassified | 1188 |
| 137 | Ga0075364_10006017 | 3300006051 | Bacteria | 7094 |
| 138 | Ga0075362_10003298 | 3300006177 | Bacteria | 5616 |
| 139 | Ga0075367_10184091 | 3300006178 | Bacteria | 1302 |
| 140 | Ga0075366_10126879 | 3300006195 | Bacteria | 1539 |
| 141 | Ga0097621_100012307 | 3300006237 | Bacteria | 6334 |
| 142 | Ga0097621_100098401 | 3300006237 | Bacteria | 2457 |
| 143 | Ga0097621_100101560 | 3300006237 | Bacteria | 2420 |
| 144 | Ga0097621_100139775 | 3300006237 | Bacteria | 2069 |
| 145 | Ga0075370_10013698 | 3300006353 | Bacteria | 4316 |
| 146 | Ga0075370_10041199 | 3300006353 | Bacteria | 2607 |
| 147 | Ga0068871_100040551 | 3300006358 | Unclassified | 3729 |
| 148 | Ga0068871_100103573 | 3300006358 | Bacteria | 2386 |
| 149 | Ga0075431_100056384 | 3300006847 | Bacteria | 4053 |
| 150 | Ga0075433_10005076 | 3300006852 | Bacteria | 10322 |
| 151 | Ga0075433_10197395 | 3300006852 | Bacteria | 1790 |
| 152 | Ga0075434_100014176 | 3300006871 | Bacteria | 7615 |
| 153 | Ga0075434_100145575 | 3300006871 | Bacteria | 2390 |
| 154 | Ga0068865_100026222 | 3300006881 | Bacteria | 3840 |
| 155 | Ga0097620_100005044 | 3300006931 | Bacteria | 13403 |
| 156 | Ga0097620_100335154 | 3300006931 | Bacteria | 1607 |
| 157 | Ga0075435_100013698 | 3300007076 | Bacteria | 6041 |
| 158 | Ga0075435_100524925 | 3300007076 | Bacteria | 1024 |
| 159 | Ga0105250_10039026 | 3300009092 | Bacteria | 1904 |
| 160 | Ga0105240_10004929 | 3300009093 | Bacteria | 20069 |
| 161 | Ga0105240_10046314 | 3300009093 | Bacteria | 5511 |
| 162 | Ga0105240_10067342 | 3300009093 | Bacteria | 4439 |
| 163 | Ga0111539_10021247 | 3300009094 | Bacteria | 7992 |
| 164 | Ga0111539_10033888 | 3300009094 | Bacteria | 6196 |
| 165 | Ga0111539_10156165 | 3300009094 | Bacteria | 2670 |
| 166 | Ga0111539_10318846 | 3300009094 | Bacteria | 1809 |
| 167 | Ga0111539_10713389 | 3300009094 | Bacteria | 1167 |
| 168 | Ga0105245_10006794 | 3300009098 | Bacteria | 10033 |
| 169 | Ga0105247_10265417 | 3300009101 | Bacteria | 1179 |
| 170 | Ga0105243_10007504 | 3300009148 | Bacteria | 8380 |
| 171 | Ga0105241_10002961 | 3300009174 | Bacteria | 12676 |
| 172 | Ga0105242_10004894 | 3300009176 | Bacteria | 10369 |
| 173 | Ga0105248_10000007 | 3300009177 | Bacteria | 471250 |
| 174 | Ga0105248_10001330 | 3300009177 | Bacteria | 27498 |
| 175 | Ga0105248_10005301 | 3300009177 | Bacteria | 14193 |
| 176 | Ga0105248_10005481 | 3300009177 | Bacteria | 13935 |
| 177 | Ga0105248_10296631 | 3300009177 | Unclassified | 1820 |
| 178 | Ga0105237_10134145 | 3300009545 | Bacteria | 2471 |
| 179 | Ga0105238_10085396 | 3300009551 | Bacteria | 3144 |
| 180 | Ga0105249_10038236 | 3300009553 | Bacteria | 4353 |
| 181 | Ga0105239_10025208 | 3300010375 | Bacteria | 6548 |
| 182 | Ga0105239_10040990 | 3300010375 | Bacteria | 5074 |
| 183 | Ga0105239_10109775 | 3300010375 | Bacteria | 3057 |
| 184 | Ga0105239_10182308 | 3300010375 | Unclassified | 2349 |
| 185 | Ga0105246_10006621 | 3300011119 | Bacteria | 7082 |
| 186 | Ga0105246_10025354 | 3300011119 | Bacteria | 3864 |
| 187 | Ga0157313_1004972 | 3300012503 | Bacteria | 940 |
| 188 | Ga0157373_10050278 | 3300013100 | Bacteria | 2969 |
| 189 | Ga0157371_10018413 | 3300013102 | Bacteria | 5164 |
| 190 | Ga0157374_10005394 | 3300013296 | Bacteria | 10745 |
| 191 | Ga0157374_10436085 | 3300013296 | Bacteria | 1310 |
| 192 | Ga0157374_10642287 | 3300013296 | Bacteria | 1073 |
| 193 | Ga0157378_10157019 | 3300013297 | Bacteria | 2124 |
| 194 | Ga0157378_10225036 | 3300013297 | Bacteria | 1785 |
| 195 | Ga0157372_10005559 | 3300013307 | Bacteria | 13400 |
| 196 | Ga0157372_10479459 | 3300013307 | Bacteria | 1450 |
| 197 | Ga0157375_10004143 | 3300013308 | Bacteria | 12581 |
| 198 | Ga0157375_10154705 | 3300013308 | Bacteria | 2431 |
| 199 | Ga0163163_10004364 | 3300014325 | Bacteria | 12051 |
| 200 | Ga0163163_10056553 | 3300014325 | Bacteria | 3877 |
| 201 | Ga0163163_10129414 | 3300014325 | Bacteria | 2564 |
| 202 | Ga0157380_10004080 | 3300014326 | Bacteria | 10082 |
| 203 | Ga0157377_10002281 | 3300014745 | Bacteria | 8431 |
| 204 | Ga0157379_10003623 | 3300014968 | Bacteria | 13109 |
| 205 | Ga0157379_10125007 | 3300014968 | Bacteria | 2314 |
| 206 | Ga0157379_10468430 | 3300014968 | Bacteria | 1165 |
| 207 | Ga0157376_10008998 | 3300014969 | Bacteria | 7232 |
| 208 | Ga0157376_10073653 | 3300014969 | Bacteria | 2909 |
| 209 | Ga0157376_10528568 | 3300014969 | Bacteria | 1164 |
| 210 | Ga0163161_10004907 | 3300017792 | Bacteria | 9309 |
| 211 | Ga0163161_10411567 | 3300017792 | Unclassified | 1086 |
| 212 | Ga0213876_10000525 | 3300021384 | Bacteria | 29265 |
| 213 | Ga0207666_1000084 | 3300025271 | Bacteria | 15613 |
| 214 | Ga0207673_1000790 | 3300025290 | Bacteria | 3412 |
| 215 | Ga0209758_1000158 | 3300025297 | Bacteria | 156129 |
| 216 | Ga0209758_1059823 | 3300025297 | Bacteria | 1265 |
| 217 | Ga0207697_10003123 | 3300025315 | Bacteria | 8279 |
| 218 | Ga0207697_10097105 | 3300025315 | Bacteria | 1253 |
| 219 | Ga0207653_10001329 | 3300025885 | Bacteria | 8032 |
| 220 | Ga0207682_10001421 | 3300025893 | Bacteria | 11062 |
| 221 | Ga0207642_10003465 | 3300025899 | Bacteria | 4981 |
| 222 | Ga0207710_10157002 | 3300025900 | Bacteria | 1106 |
| 223 | Ga0207688_10000346 | 3300025901 | Bacteria | 21494 |
| 224 | Ga0207688_10313151 | 3300025901 | Bacteria | 962 |
| 225 | Ga0207680_10183895 | 3300025903 | Bacteria | 1415 |
| 226 | Ga0207647_10015607 | 3300025904 | Bacteria | 5202 |
| 227 | Ga0207647_10071622 | 3300025904 | Bacteria | 2091 |
| 228 | Ga0207645_10002258 | 3300025907 | Bacteria | 15323 |
| 229 | Ga0207645_10014759 | 3300025907 | Bacteria | 5217 |
| 230 | Ga0207643_10000870 | 3300025908 | Bacteria | 18192 |
| 231 | Ga0207654_10128062 | 3300025911 | Bacteria | 1603 |
| 232 | Ga0207654_10176047 | 3300025911 | Bacteria | 1393 |
| 233 | Ga0207707_10009781 | 3300025912 | Bacteria | 8317 |
| 234 | Ga0207707_10381846 | 3300025912 | Bacteria | 1211 |
| 235 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 236 | Ga0207671_10064791 | 3300025914 | Bacteria | 2717 |
| 237 | Ga0207663_10053937 | 3300025916 | Bacteria | 2515 |
| 238 | Ga0207660_10004540 | 3300025917 | Bacteria | 9053 |
| 239 | Ga0207662_10000677 | 3300025918 | Bacteria | 15501 |
| 240 | Ga0207657_10002107 | 3300025919 | Bacteria | 21516 |
| 241 | Ga0207649_10106243 | 3300025920 | Bacteria | 1867 |
| 242 | Ga0207652_10074024 | 3300025921 | Bacteria | 2965 |
| 243 | Ga0207681_10033153 | 3300025923 | Bacteria | 3384 |
| 244 | Ga0207694_10069989 | 3300025924 | Bacteria | 2741 |
| 245 | Ga0207694_10255218 | 3300025924 | Bacteria | 1436 |
| 246 | Ga0207650_10088533 | 3300025925 | Bacteria | 2361 |
| 247 | Ga0207650_10310837 | 3300025925 | Bacteria | 1289 |
| 248 | Ga0207659_10040617 | 3300025926 | Bacteria | 3254 |
| 249 | Ga0207659_10100482 | 3300025926 | Bacteria | 2180 |
| 250 | Ga0207700_10000031 | 3300025928 | Bacteria | 130086 |
| 251 | Ga0207644_10049486 | 3300025931 | Bacteria | 3009 |
| 252 | Ga0207644_10057490 | 3300025931 | Bacteria | 2809 |
| 253 | Ga0207644_10407010 | 3300025931 | Bacteria | 1113 |
| 254 | Ga0207690_10005379 | 3300025932 | Bacteria | 7545 |
| 255 | Ga0207690_10324145 | 3300025932 | Bacteria | 1212 |
| 256 | Ga0207706_10005074 | 3300025933 | Bacteria | 12298 |
| 257 | Ga0207706_10121723 | 3300025933 | Bacteria | 2294 |
| 258 | Ga0207709_10019030 | 3300025935 | Bacteria | 3854 |
| 259 | Ga0207670_10008616 | 3300025936 | Bacteria | 5767 |
| 260 | Ga0207669_10019671 | 3300025937 | Bacteria | 3522 |
| 261 | Ga0207704_10048255 | 3300025938 | Bacteria | 2551 |
| 262 | Ga0207691_10003147 | 3300025940 | Bacteria | 16133 |
| 263 | Ga0207691_10024020 | 3300025940 | Bacteria | 5734 |
| 264 | Ga0207691_10039040 | 3300025940 | Unclassified | 4393 |
| 265 | Ga0207691_10087841 | 3300025940 | Bacteria | 2789 |
| 266 | Ga0207711_10000014 | 3300025941 | Bacteria | 506753 |
| 267 | Ga0207711_10000966 | 3300025941 | Bacteria | 27506 |
| 268 | Ga0207711_10034862 | 3300025941 | Bacteria | 4262 |
| 269 | Ga0207711_10074885 | 3300025941 | Bacteria | 2945 |
| 270 | Ga0207689_10002387 | 3300025942 | Bacteria | 17532 |
| 271 | Ga0207661_10323646 | 3300025944 | Bacteria | 1386 |
| 272 | Ga0207679_10001868 | 3300025945 | Bacteria | 13091 |
| 273 | Ga0207679_10912155 | 3300025945 | Bacteria | 804 |
| 274 | Ga0207667_10027970 | 3300025949 | Bacteria | 6128 |
| 275 | Ga0207651_10019584 | 3300025960 | Bacteria | 4060 |
| 276 | Ga0207712_10004060 | 3300025961 | Bacteria | 9243 |
| 277 | Ga0207668_10003969 | 3300025972 | Bacteria | 8715 |
| 278 | Ga0207668_10035585 | 3300025972 | Bacteria | 3317 |
| 279 | Ga0207668_10081280 | 3300025972 | Bacteria | 2350 |
| 280 | Ga0207668_10201876 | 3300025972 | Bacteria | 1584 |
| 281 | Ga0207640_10082710 | 3300025981 | Bacteria | 2199 |
| 282 | Ga0207658_10132543 | 3300025986 | Bacteria | 2004 |
| 283 | Ga0207658_10225286 | 3300025986 | Bacteria | 1579 |
| 284 | Ga0207703_10166246 | 3300026035 | Bacteria | 1936 |
| 285 | Ga0207703_10726576 | 3300026035 | Unclassified | 945 |
| 286 | Ga0207639_10006216 | 3300026041 | Bacteria | 8111 |
| 287 | Ga0207678_10002254 | 3300026067 | Bacteria | 17463 |
| 288 | Ga0207708_10001067 | 3300026075 | Bacteria | 20564 |
| 289 | Ga0207702_10079299 | 3300026078 | Bacteria | 2845 |
| 290 | Ga0207641_10115954 | 3300026088 | Bacteria | 2382 |
| 291 | Ga0207641_10637496 | 3300026088 | Unclassified | 1046 |
| 292 | Ga0207648_10004636 | 3300026089 | Bacteria | 14075 |
| 293 | Ga0207648_10058695 | 3300026089 | Bacteria | 3356 |
| 294 | Ga0207676_10029874 | 3300026095 | Bacteria | 4084 |
| 295 | Ga0207676_11117764 | 3300026095 | Unclassified | 779 |
| 296 | Ga0207674_10003170 | 3300026116 | Bacteria | 20247 |
| 297 | Ga0207675_100002589 | 3300026118 | Bacteria | 17916 |
| 298 | Ga0207675_100249448 | 3300026118 | Bacteria | 1718 |
| 299 | Ga0207683_10004673 | 3300026121 | Bacteria | 11803 |
| 300 | Ga0207683_10008075 | 3300026121 | Bacteria | 9000 |
| 301 | Ga0207698_10010196 | 3300026142 | Bacteria | 6023 |
| 302 | Ga0207698_10075194 | 3300026142 | Bacteria | 2698 |
| 303 | Ga0207698_10451480 | 3300026142 | Bacteria | 1241 |
| 304 | Ga0207698_11030949 | 3300026142 | Bacteria | 834 |
| 305 | Ga0207698_11270542 | 3300026142 | Bacteria | 751 |
| 306 | Ga0209974_10001225 | 3300027876 | Bacteria | 9184 |
| 307 | Ga0207428_10016866 | 3300027907 | Bacteria | 6276 |
| 308 | Ga0207428_10177910 | 3300027907 | Bacteria | 1608 |
| 309 | Ga0268266_10148199 | 3300028379 | Bacteria | 2112 |
| 310 | Ga0268266_10570928 | 3300028379 | Bacteria | 1085 |
| 311 | Ga0268265_10020216 | 3300028380 | Bacteria | 4644 |
| 312 | Ga0268264_10034054 | 3300028381 | Bacteria | 4188 |
| 313 | Ga0265338_10051178 | 3300028800 | Bacteria | 3722 |
| 314 | Ga0265320_10000962 | 3300031240 | Bacteria | 21416 |
| 315 | Ga0265325_10017251 | 3300031241 | Bacteria | 4014 |
| 316 | Ga0265329_10051811 | 3300031242 | Bacteria | 1306 |
| 317 | Ga0265340_10027710 | 3300031247 | Bacteria | 2854 |
| 318 | Ga0265339_10224589 | 3300031249 | Bacteria | 917 |
| 319 | Ga0265316_10023602 | 3300031344 | Bacteria | 5164 |
| 320 | Ga0265316_10462328 | 3300031344 | Bacteria | 909 |
| 321 | Ga0265313_10042458 | 3300031595 | Bacteria | 2233 |
| 322 | Ga0265313_10074418 | 3300031595 | Bacteria | 1557 |
| 323 | Ga0265313_10095587 | 3300031595 | Bacteria | 1326 |
| 324 | Ga0265314_10005842 | 3300031711 | Bacteria | 11019 |
| 325 | Ga0265314_10008207 | 3300031711 | Bacteria | 8975 |
| 326 | Ga0265342_10022418 | 3300031712 | Bacteria | 4014 |
| 327 | Ga0265342_10291269 | 3300031712 | Bacteria | 862 |
| 328 | Ga0307516_10141405 | 3300031730 | Bacteria | 2176 |
| 329 | Ga0307412_10222454 | 3300031911 | Bacteria | 1448 |
| 330 | Ga0307409_100053687 | 3300031995 | Bacteria | 3098 |
| 331 | Ga0307411_10142543 | 3300032005 | Bacteria | 1769 |
| 332 | Ga0307510_10332313 | 3300033180 | Unclassified | 974 |
| 333 | Ga0373930_0002599 | 3300034816 | Bacteria | 2806 |
| 334 | Ga0373948_0017011 | 3300034817 | Bacteria | 1351 |
| 335 | Ga0373938_0002301 | 3300034957 | Bacteria | 3072 |
| 336 | Ga0373928_0007251 | 3300035084 | Bacteria | 2137 |
| 337 | Ga0373929_0002125 | 3300035085 | Bacteria | 3686 |
| 338 | Ga0373929_0027123 | 3300035085 | Bacteria | 1201 |
| 339 | Ga0373949_0002842 | 3300035090 | Bacteria | 4296 |
| 340 | Ga0373951_0005920 | 3300035091 | Bacteria | 2822 |
| 341 | Ga0373951_0081226 | 3300035091 | Bacteria | 839 |
| 342 | Ga0373952_0002641 | 3300035092 | Bacteria | 3234 |
| 343 | Ga0373932_0004638 | 3300035112 | Bacteria | 3248 |
| 344 | Ga0373941_0003337 | 3300035115 | Bacteria | 3628 |
| 345 | Ga0373961_0064965 | 3300035241 | Bacteria | 1116 |
| 346 | Ga0373931_0002564 | 3300035691 | Bacteria | 8087 |
| 347 | Ga0373931_0030689 | 3300035691 | Bacteria | 2769 |
| 348 | Ga0373935_0164132 | 3300035692 | Bacteria | 1516 |
| 349 | Ga0373927_0021835 | 3300035695 | Bacteria | 4195 |
| 350 | Ga0373947_0035544 | 3300035725 | Bacteria | 2950 |
| 351 | Ga0373937_0174053 | 3300036401 | Bacteria | 2020 |
| 352 | Ga0436365_0616688 | 3300039437 | Bacteria | 20979 |
| 353 | Ga0439465_0021070 | 3300041413 | Bacteria | 2044 |
| 354 | Ga0451835_0318508 | 3300041492 | Bacteria | 767 |
| 355 | Ga0451853_1083161 | 3300041512 | Bacteria | 892 |
| 356 | Ga0495592_0426850 | 3300046454 | Bacteria | 835 |
| 357 | Ga0495590_0097587 | 3300046457 | Bacteria | 1043 |
| 358 | Ga0495638_0002040 | 3300046460 | Bacteria | 17189 |
| 359 | Ga0495638_0058463 | 3300046460 | Bacteria | 2389 |
| 360 | Ga0495585_0139729 | 3300046492 | Unclassified | 1269 |
| 361 | Ga0495643_0075703 | 3300046522 | Bacteria | 1761 |
| 362 | Ga0495621_0067124 | 3300046539 | Bacteria | 1314 |
| 363 | Ga0495645_0016195 | 3300046543 | Bacteria | 5316 |
| 364 | Ga0495658_0042758 | 3300046683 | Bacteria | 2531 |
| 365 | Ga0495581_0309343 | 3300047315 | Bacteria | 923 |
| 366 | Ga0496100_0003283 | 3300048903 | Bacteria | 8408 |
| 367 | Ga0496101_0067972 | 3300048904 | Bacteria | 2603 |
| 368 | Ga0496101_0650189 | 3300048904 | Bacteria | 833 |
| 369 | Ga0496102_0268137 | 3300048905 | Bacteria | 1609 |
| 370 | Ga0496102_0793614 | 3300048905 | Bacteria | 869 |
| 371 | Ga0496103_0023646 | 3300048906 | Bacteria | 3706 |
| 372 | Ga0496104_0034377 | 3300048907 | Bacteria | 4727 |
| 373 | Ga0496104_1052703 | 3300048907 | Bacteria | 717 |
| 374 | Ga0496105_0183143 | 3300048908 | Bacteria | 1714 |
| 375 | Ga0496106_0190710 | 3300048909 | Bacteria | 1629 |
| 376 | Ga0496107_0014216 | 3300048910 | Bacteria | 5573 |
| 377 | Ga0496108_0014556 | 3300048911 | Bacteria | 6422 |
| 378 | Ga0496108_0614781 | 3300048911 | Bacteria | 946 |
| 379 | Ga0496109_0004625 | 3300048912 | Bacteria | 11489 |
| 380 | Ga0496109_0006399 | 3300048912 | Bacteria | 9914 |
| 381 | Ga0496109_0251990 | 3300048912 | Bacteria | 1663 |
| 382 | Ga0496110_0757301 | 3300048913 | Bacteria | 874 |
| 383 | Ga0496111_0018298 | 3300048914 | Bacteria | 4852 |
| 384 | Ga0496112_0003199 | 3300048915 | Bacteria | 13476 |
| 385 | Ga0496112_0046060 | 3300048915 | Bacteria | 4276 |
| 386 | Ga0496113_0003250 | 3300048916 | Bacteria | 9693 |
| 387 | Ga0496114_0159114 | 3300048917 | Bacteria | 1963 |
| 388 | Ga0496114_0166241 | 3300048917 | Bacteria | 1920 |
| 389 | Ga0496115_0031788 | 3300048918 | Bacteria | 4161 |
| 390 | Ga0496115_0246117 | 3300048918 | Bacteria | 1473 |
| 391 | Ga0496115_0356563 | 3300048918 | Bacteria | 1192 |
| 392 | Ga0496121_0035175 | 3300048924 | Bacteria | 4494 |
| 393 | Ga0495682_0003617 | 3300049460 | Bacteria | 6819 |
| 394 | Ga0501031_0177457 | 3300049568 | Bacteria | 1392 |
| 395 | Ga0501031_0297028 | 3300049568 | Bacteria | 1047 |
| 396 | Ga0501032_0218060 | 3300049569 | Bacteria | 1242 |
| 397 | Ga0501033_0259303 | 3300049570 | Bacteria | 1231 |
| 398 | Ga0501034_0024805 | 3300049571 | Bacteria | 6102 |
| 399 | Ga0501034_0052553 | 3300049571 | Bacteria | 4104 |
| 400 | Ga0501034_0296524 | 3300049571 | Bacteria | 1554 |
| 401 | Ga0501036_0206015 | 3300049572 | Bacteria | 1653 |
| 402 | Ga0501036_0259397 | 3300049572 | Bacteria | 1456 |
| 403 | Ga0501037_0276328 | 3300049573 | Bacteria | 1171 |
| 404 | Ga0501037_0471458 | 3300049573 | Bacteria | 854 |
| 405 | Ga0501037_0597963 | 3300049573 | Bacteria | 741 |
| 406 | Ga0501038_0260733 | 3300049574 | Bacteria | 1370 |
| 407 | Ga0501042_0364194 | 3300049578 | Bacteria | 1046 |
| 408 | Ga0501043_0027142 | 3300049579 | Bacteria | 4495 |
| 409 | Ga0501043_0174465 | 3300049579 | Bacteria | 1676 |
| 410 | Ga0501043_0318580 | 3300049579 | Bacteria | 1186 |
| 411 | Ga0501043_0487680 | 3300049579 | Bacteria | 922 |
| 412 | Ga0501046_0412785 | 3300049580 | Bacteria | 974 |
| 413 | Ga0501047_0106369 | 3300049581 | Bacteria | 2686 |
| 414 | Ga0501047_0226026 | 3300049581 | Bacteria | 1726 |
| 415 | Ga0501047_0529643 | 3300049581 | Bacteria | 1003 |
| 416 | Ga0501047_0560837 | 3300049581 | Bacteria | 966 |
| 417 | Ga0501067_0187165 | 3300049583 | Bacteria | 1153 |
| 418 | Ga0501068_0001062 | 3300049584 | Bacteria | 14538 |
| 419 | Ga0501068_0224338 | 3300049584 | Bacteria | 1195 |
| 420 | Ga0501068_0394525 | 3300049584 | Bacteria | 892 |
| 421 | Ga0501069_0133059 | 3300049585 | Bacteria | 1425 |
| 422 | Ga0501070_0028297 | 3300049586 | Bacteria | 4700 |
| 423 | Ga0501070_0069871 | 3300049586 | Bacteria | 2908 |
| 424 | Ga0501071_0177552 | 3300049587 | Bacteria | 1595 |
| 425 | Ga0501071_0229924 | 3300049587 | Bacteria | 1397 |
| 426 | Ga0501072_0004447 | 3300049588 | Bacteria | 10647 |
| 427 | Ga0501072_0376828 | 3300049588 | Bacteria | 1126 |
| 428 | Ga0501073_0000322 | 3300049589 | Bacteria | 32029 |
| 429 | Ga0501073_0016917 | 3300049589 | Bacteria | 5282 |
| 430 | Ga0501074_0570864 | 3300049590 | Bacteria | 801 |
| 431 | Ga0501076_0416634 | 3300049592 | Bacteria | 1105 |
| 432 | Ga0501079_0224121 | 3300049741 | Bacteria | 1469 |
| 433 | Ga0501079_0274743 | 3300049741 | Bacteria | 1317 |
| 434 | Ga0501080_0008962 | 3300049742 | Bacteria | 9101 |
| 435 | Ga0501080_0013980 | 3300049742 | Bacteria | 7388 |
| 436 | Ga0501083_0008613 | 3300049744 | Bacteria | 7197 |
| 437 | Ga0501083_0027665 | 3300049744 | Bacteria | 3911 |
| 438 | Ga0501083_0037689 | 3300049744 | Bacteria | 3291 |
| 439 | Ga0501083_0037695 | 3300049744 | Bacteria | 3291 |
| 440 | Ga0501083_0157316 | 3300049744 | Bacteria | 1487 |
| 441 | Ga0501083_0543215 | 3300049744 | Bacteria | 756 |
| 442 | Ga0501035_0313365 | 3300049822 | Bacteria | 1320 |
| 443 | Ga0501035_0536633 | 3300049822 | Bacteria | 959 |
| 444 | Ga0501035_0671691 | 3300049822 | Bacteria | 838 |
| 445 | Ga0501044_0030154 | 3300049823 | Bacteria | 5717 |
| 446 | Ga0501044_0145919 | 3300049823 | Bacteria | 2352 |
| 447 | Ga0501044_0190189 | 3300049823 | Bacteria | 2016 |
| 448 | Ga0501044_0243012 | 3300049823 | Bacteria | 1743 |
| 449 | nmdc:mga00v17_77907_c1 | 3300050491 | Bacteria | 2065 |
| 450 | nmdc:mga0yw44_60147_c1 | 3300050492 | Bacteria | 2326 |
| 451 | nmdc:mga0k408_106949_c1 | 3300050493 | Bacteria | 1652 |
| 452 | nmdc:mga06z11_126455_c1 | 3300050494 | Bacteria | 1431 |
| 453 | nmdc:mga06z11_172172_c1 | 3300050494 | Bacteria | 1244 |
| 454 | nmdc:mga07m45_182075_c1 | 3300050496 | Bacteria | 1222 |
| 455 | nmdc:mga07m45_38285_c1 | 3300050496 | Bacteria | 2675 |
| 456 | nmdc:mga06r32_52084_c1 | 3300050510 | Bacteria | 3919 |
| 457 | nmdc:mga08y16_196080_c1 | 3300050511 | Bacteria | 2093 |
| 458 | nmdc:mga08y16_242789_c1 | 3300050511 | Bacteria | 1862 |
| 459 | nmdc:mga08y16_89246_c1 | 3300050511 | Bacteria | 3213 |
| 460 | nmdc:mga0n895_15886_c1 | 3300050512 | Bacteria | 6886 |
| 461 | nmdc:mga0n895_21640_c1 | 3300050512 | Bacteria | 6018 |
| 462 | nmdc:mga0rr50_27982_c1 | 3300050513 | Bacteria | 3956 |
| 463 | nmdc:mga0a205_13046_c1 | 3300050515 | Bacteria | 7716 |
| 464 | Ga0500643_009483 | 3300053087 | Bacteria | 3716 |
| 465 | Ga0500644_0001818 | 3300053088 | Bacteria | 5514 |
| 466 | Ga0500651_0000483 | 3300053093 | Bacteria | 20822 |
| 467 | Ga0500566_0036755 | 3300053094 | Bacteria | 2840 |
| 468 | Ga0500641_0001124 | 3300053096 | Bacteria | 9502 |
| 469 | Ga0500650_0058026 | 3300053098 | Bacteria | 1805 |
| 470 | Ga0500562_024481 | 3300053108 | Bacteria | 1579 |
| 471 | Ga0500595_000029 | 3300053119 | Bacteria | 122318 |
| 472 | Ga0500595_032961 | 3300053119 | Bacteria | 1723 |
| 473 | Ga0500642_0157288 | 3300053130 | Bacteria | 1066 |
| 474 | Ga0500652_000029 | 3300053131 | Bacteria | 91212 |
| 475 | Ga0500652_074950 | 3300053131 | Bacteria | 1405 |
| 476 | Ga0500655_007365 | 3300053133 | Bacteria | 1981 |
| 477 | Ga0500655_016365 | 3300053133 | Bacteria | 1365 |
| 478 | Ga0500658_0069932 | 3300053134 | Bacteria | 1479 |
| 479 | Ga0500577_0091119 | 3300053142 | Bacteria | 1232 |
| 480 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 481 | Ga0500619_015196 | 3300053154 | Bacteria | 2088 |
| 482 | Ga0500636_0005930 | 3300053177 | Bacteria | 7001 |
| 483 | Ga0500645_000290 | 3300053730 | Bacteria | 36019 |
| 484 | Ga0501084_0000626 | 3300054114 | Bacteria | 26962 |
| 485 | Ga0501084_0087364 | 3300054114 | Bacteria | 2618 |
| 486 | Ga0501082_0042674 | 3300060353 | Bacteria | 3910 |
| 487 | Ga0501082_0154777 | 3300060353 | Bacteria | 1992 |
| 488 | Ga0501082_0196750 | 3300060353 | Bacteria | 1754 |
| 489 | 2508691887 | 2508501042 | Bacteria | 8719808 |
| 490 | 2511397426 | 2511231028 | Bacteria | 8046582 |
| 491 | 2513592583 | 2513237087 | Bacteria | 5817514 |
| 492 | 2513622421 | 2513237092 | Bacteria | 8341956 |
| 493 | 2513645529 | 2513237095 | Bacteria | 8976980 |
| 494 | 2513855538 | 2513237137 | Bacteria | 9558895 |
| 495 | 2513873063 | 2513237139 | Bacteria | 8737671 |
| 496 | 2514015637 | 2513237161 | Bacteria | 8871253 |
| 497 | 2515627205 | 2515154112 | Bacteria | 8294334 |
| 498 | 2517102748 | 2517093001 | Bacteria | 9002274 |
| 499 | 2617347074 | 2617270735 | Bacteria | 9163226 |
| 500 | 2644290097 | 2643221651 | Bacteria | 4798932 |
| 501 | 2793062674 | 2791355196 | Bacteria | 7323613 |
| 502 | 2805915038 | 2802429603 | Bacteria | 8777136 |
| 503 | 2818238576 | 2816332527 | Bacteria | 8933356 |
| 504 | 2824602437 | 2824600985 | Bacteria | 8488197 |
| 505 | 2824610448 | 2824609381 | Bacteria | 8672835 |
| 506 | 2824657400 | 2824653114 | Bacteria | 8493680 |
| 507 | 2824671963 | 2824671348 | Bacteria | 8369588 |
| 508 | 2824688562 | 2824687955 | Bacteria | 8360029 |
| 509 | 2824699872 | 2824696289 | Bacteria | 8335049 |
| 510 | 2824714292 | 2824704595 | Bacteria | 9667483 |
| 511 | 2824754276 | 2824753945 | Bacteria | 9787441 |
| 512 | 2824767775 | 2824763712 | Bacteria | 9792355 |
| 513 | 2824775329 | 2824773399 | Bacteria | 8360218 |
| 514 | 2838123428 | 2838122688 | Bacteria | 8803140 |
| 515 | 2841947799 | 2841941048 | Bacteria | 8688029 |
| 516 | 2841949530 | 2841949485 | Bacteria | 8680857 |
| 517 | 2841971963 | 2841966195 | Bacteria | 8673214 |
| 518 | 2841983748 | 2841983080 | Bacteria | 8395090 |
| 519 | 2842046949 | 2842045827 | Bacteria | 8006841 |
| 520 | 2847936518 | 2847930680 | Bacteria | 9342022 |
| 521 | 2847946865 | 2847939898 | Bacteria | 8606328 |
| 522 | 2849079032 | 2849076700 | Bacteria | 7039503 |
| 523 | 2874619451 | 2874612657 | Bacteria | 8252029 |
| 524 | 2874621151 | 2874620515 | Bacteria | 8290088 |
| 525 | 2879083221 | 2879083081 | Bacteria | 8587928 |
| 526 | 2881368555 | 2881364244 | Bacteria | 7710352 |
| 527 | 2881672600 | 2881665667 | Bacteria | 8175609 |
| 528 | 2885414153 | 2885409591 | Bacteria | 9235467 |
| 529 | 2888384394 | 2888378607 | Bacteria | 9652610 |
| 530 | 2888393524 | 2888388044 | Bacteria | 7304136 |
| 531 | 2888424823 | 2888419890 | Bacteria | 7857137 |
| 532 | 2904673373 | 2904666416 | Bacteria | 8226587 |
| 533 | 2904714999 | 2904711408 | Bacteria | 9771557 |
| 534 | 2906639273 | 2906635258 | Bacteria | 8601019 |
| 535 | 2906646620 | 2906643746 | Bacteria | 8722424 |
| 536 | 2906662472 | 2906660503 | Bacteria | 8595048 |
| 537 | 2908742363 | 2908739725 | Bacteria | 8628932 |
| 538 | 2935650976 | 2935648319 | Bacteria | 8801166 |
| 539 | 2935659157 | 2935656913 | Bacteria | 8965014 |
| 540 | 2935771766 | 2935769743 | Bacteria | 7878163 |
| 541 | 2935987428 | 2935984226 | Bacteria | 8302647 |
| 542 | 2936013572 | 2936011229 | Bacteria | 8801034 |
| 543 | 2936022301 | 2936019824 | Bacteria | 8804134 |
| 544 | 2936030747 | 2936028420 | Bacteria | 8965941 |
| 545 | 2936048560 | 2936046547 | Bacteria | 8903709 |
| 546 | 2936058774 | 2936055302 | Bacteria | 8785755 |
| 547 | 3005510610 | 3005506211 | Bacteria | 6943378 |
| 548 | 8006931546 | 8006926726 | Bacteria | 6749210 |
| 549 | 8016529325 | 8016522445 | Bacteria | 8156687 |
| 550 | 8016534540 | 8016530956 | Bacteria | 8155261 |
| 551 | 8016547757 | 8016539877 | Bacteria | 8155419 |
| 552 | 8016554378 | 8016548790 | Bacteria | 8155074 |
| 553 | 8016562746 | 8016557553 | Bacteria | 8154380 |
| 554 | 8016572881 | 8016566248 | Bacteria | 8158151 |
| 555 | 8016577040 | 8016575299 | Bacteria | 8154085 |
| 556 | 8016600530 | 8016595262 | Bacteria | 8149947 |
| 557 | 8019534301 | 8019530166 | Bacteria | 8155624 |
| 558 | 8019628500 | 8019619141 | Bacteria | 9218857 |
| 559 | Ga0495672_0009373 | |||
| 560 | JGI24032J14994_100495 | |||
| 561 | JGI24752J21851_1020232 | |||
| 562 | JGI24746J21847_1000861 | |||
| 563 | JGI24747J21853_1002968 | |||
| 564 | JGI24739J22299_10066316 | |||
| 565 | JGI24737J22298_10002394 | |||
| 566 | JGI24750J21931_1000859 | |||
| 567 | JGI24738J21930_10001606 | |||
| 568 | JGI24749J21850_1000589 | |||
| 569 | JGI24035J26624_1001701 | |||
| 570 | JGI24034J26672_10001847 | |||
| 571 | JGI24742J22300_10000991 | |||
| 572 | JGI24751J29686_10029296 | |||
| 573 | JGI25406J46586_10000166 | |||
| 574 | JGI25165J46597_1004351 | |||
| 575 | JGI25160J50197_1000838 | |||
| 576 | JGI25405J52794_10031955 | |||
| 577 | Ga0065704_10255096 | |||
| 578 | Ga0065712_10095860 | |||
| 579 | Ga0065712_10200012 | |||
| 580 | Ga0065715_10002503 | |||
| 581 | Ga0070676_10003946 | |||
| 582 | Ga0070676_10475929 | |||
| 583 | Ga0070683_100003103 | |||
| 584 | Ga0070683_100245619 | |||
| 585 | Ga0070690_100001658 | |||
| 586 | Ga0070670_100005908 | |||
| 587 | Ga0070670_100144883 | |||
| 588 | Ga0070670_100684204 | |||
| 589 | Ga0070677_10002586 | |||
| 590 | Ga0068869_100003321 | |||
| 591 | Ga0068869_100208065 | |||
| 592 | Ga0070666_10061316 | |||
| 593 | Ga0070666_10347005 | |||
| 594 | Ga0070680_100005234 | |||
| 595 | Ga0070680_100464158 | |||
| 596 | Ga0070682_100002520 | |||
| 597 | Ga0068868_100009819 | |||
| 598 | Ga0068868_100018015 | |||
| 599 | Ga0070660_100001332 | |||
| 600 | Ga0070689_100032582 | |||
| 601 | Ga0070691_10002586 | |||
| 602 | Ga0070687_100001160 | |||
| 603 | Ga0070661_100002370 | |||
| 604 | Ga0070692_10000841 | |||
| 605 | Ga0070668_100006877 | |||
| 606 | Ga0070669_100006963 | |||
| 607 | Ga0070669_100613903 | |||
| 608 | Ga0070675_100039738 | |||
| 609 | Ga0070675_100077803 | |||
| 610 | Ga0070675_100670601 | |||
| 611 | Ga0070671_100005218 | |||
| 612 | Ga0070671_100101128 | |||
| 613 | Ga0070674_100006788 | |||
| 614 | Ga0070673_100000418 | |||
| 615 | Ga0070673_100011419 | |||
| 616 | Ga0070688_100000906 | |||
| 617 | Ga0070688_100041837 | |||
| 618 | Ga0070659_100003550 | |||
| 619 | Ga0070659_100068041 | |||
| 620 | Ga0070659_100746125 | |||
| 621 | Ga0070667_100007947 | |||
| 622 | Ga0070667_100069961 | |||
| 623 | Ga0070667_100138890 | |||
| 624 | Ga0070703_10009495 | |||
| 625 | Ga0070713_100000146 | |||
| 626 | Ga0070713_100083941 | |||
| 627 | Ga0070701_10000664 | |||
| 628 | Ga0070701_10178248 | |||
| 629 | Ga0070705_100003104 | |||
| 630 | Ga0070700_100010501 | |||
| 631 | Ga0070694_100002530 | |||
| 632 | Ga0070708_100020015 | |||
| 633 | Ga0070663_100002896 | |||
| 634 | Ga0070678_100005419 | |||
| 635 | Ga0070678_100057502 | |||
| 636 | Ga0070678_100163247 | |||
| 637 | Ga0070678_100378912 | |||
| 638 | Ga0070681_10008649 | |||
| 639 | Ga0070681_10483877 | |||
| 640 | Ga0068867_100003064 | |||
| 641 | Ga0068867_100253946 | |||
| 642 | Ga0070679_100018279 | |||
| 643 | Ga0070684_100001969 | |||
| 644 | Ga0070697_100571351 | |||
| 645 | Ga0068853_100004522 | |||
| 646 | Ga0068853_100005756 | |||
| 647 | Ga0070672_100006625 | |||
| 648 | Ga0070672_100048783 | |||
| 649 | Ga0070672_100183213 | |||
| 650 | Ga0070686_100002237 | |||
| 651 | Ga0070686_100239631 | |||
| 652 | Ga0070695_100002841 | |||
| 653 | Ga0070696_100003720 | |||
| 654 | Ga0070696_100543017 | |||
| 655 | Ga0070693_100001170 | |||
| 656 | Ga0070665_100027334 | |||
| 657 | Ga0070665_100031750 | |||
| 658 | Ga0070665_100600575 | |||
| 659 | Ga0068855_100010841 | |||
| 660 | Ga0070664_100039822 | |||
| 661 | Ga0070664_100965351 | |||
| 662 | Ga0068857_100002282 | |||
| 663 | Ga0068854_100011480 | |||
| 664 | Ga0068854_100371757 | |||
| 665 | Ga0068856_100002597 | |||
| 666 | Ga0068856_100087023 | |||
| 667 | Ga0070702_100011694 | |||
| 668 | Ga0068852_100006066 | |||
| 669 | Ga0068852_100010433 | |||
| 670 | Ga0068852_100090962 | |||
| 671 | Ga0068852_100471115 | |||
| 672 | Ga0068852_100492648 | |||
| 673 | Ga0068859_100005044 | |||
| 674 | Ga0068859_100335169 | |||
| 675 | Ga0068864_100003691 | |||
| 676 | Ga0068864_100085589 | |||
| 677 | Ga0068866_10000899 | |||
| 678 | Ga0068851_10017089 | |||
| 679 | Ga0068870_10000555 | |||
| 680 | Ga0068863_100045734 | |||
| 681 | Ga0068863_100105926 | |||
| 682 | Ga0068858_100011919 | |||
| 683 | Ga0068858_100013722 | |||
| 684 | Ga0068858_100930323 | |||
| 685 | Ga0068860_100016500 | |||
| 686 | Ga0068860_100269920 | |||
| 687 | Ga0068860_100283302 | |||
| 688 | Ga0068862_100003011 | |||
| 689 | Ga0068862_100500464 | |||
| 690 | Ga0081455_10000673 | |||
| 691 | Ga0081540_1113215 | |||
| 692 | Ga0081539_10000351 | |||
| 693 | Ga0081539_10000933 | |||
| 694 | Ga0070717_10430089 | |||
| 695 | Ga0075364_10006017 | |||
| 696 | Ga0075362_10003298 | |||
| 697 | Ga0075367_10184091 | |||
| 698 | Ga0075366_10126879 | |||
| 699 | Ga0097621_100012307 | |||
| 700 | Ga0097621_100098401 | |||
| 701 | Ga0097621_100101560 | |||
| 702 | Ga0097621_100139775 | |||
| 703 | Ga0075370_10013698 | |||
| 704 | Ga0075370_10041199 | |||
| 705 | Ga0068871_100040551 | |||
| 706 | Ga0068871_100103573 | |||
| 707 | Ga0075431_100056384 | |||
| 708 | Ga0075433_10005076 | |||
| 709 | Ga0075433_10197395 | |||
| 710 | Ga0075434_100014176 | |||
| 711 | Ga0075434_100145575 | |||
| 712 | Ga0068865_100026222 | |||
| 713 | Ga0097620_100005044 | |||
| 714 | Ga0097620_100335154 | |||
| 715 | Ga0075435_100013698 | |||
| 716 | Ga0075435_100524925 | |||
| 717 | Ga0105250_10039026 | |||
| 718 | Ga0105240_10004929 | |||
| 719 | Ga0105240_10046314 | |||
| 720 | Ga0105240_10067342 | |||
| 721 | Ga0111539_10021247 | |||
| 722 | Ga0111539_10033888 | |||
| 723 | Ga0111539_10156165 | |||
| 724 | Ga0111539_10318846 | |||
| 725 | Ga0111539_10713389 | |||
| 726 | Ga0105245_10006794 | |||
| 727 | Ga0105247_10265417 | |||
| 728 | Ga0105243_10007504 | |||
| 729 | Ga0105241_10002961 | |||
| 730 | Ga0105242_10004894 | |||
| 731 | Ga0105248_10000007 | |||
| 732 | Ga0105248_10001330 | |||
| 733 | Ga0105248_10005301 | |||
| 734 | Ga0105248_10005481 | |||
| 735 | Ga0105248_10296631 | |||
| 736 | Ga0105237_10134145 | |||
| 737 | Ga0105238_10085396 | |||
| 738 | Ga0105249_10038236 | |||
| 739 | Ga0105239_10025208 | |||
| 740 | Ga0105239_10040990 | |||
| 741 | Ga0105239_10109775 | |||
| 742 | Ga0105239_10182308 | |||
| 743 | Ga0105246_10006621 | |||
| 744 | Ga0105246_10025354 | |||
| 745 | Ga0157313_1004972 | |||
| 746 | Ga0157373_10050278 | |||
| 747 | Ga0157371_10018413 | |||
| 748 | Ga0157374_10005394 | |||
| 749 | Ga0157374_10436085 | |||
| 750 | Ga0157374_10642287 | |||
| 751 | Ga0157378_10157019 | |||
| 752 | Ga0157378_10225036 | |||
| 753 | Ga0157372_10005559 | |||
| 754 | Ga0157372_10479459 | |||
| 755 | Ga0157375_10004143 | |||
| 756 | Ga0157375_10154705 | |||
| 757 | Ga0163163_10004364 | |||
| 758 | Ga0163163_10056553 | |||
| 759 | Ga0163163_10129414 | |||
| 760 | Ga0157380_10004080 | |||
| 761 | Ga0157377_10002281 | |||
| 762 | Ga0157379_10003623 | |||
| 763 | Ga0157379_10125007 | |||
| 764 | Ga0157379_10468430 | |||
| 765 | Ga0157376_10008998 | |||
| 766 | Ga0157376_10073653 | |||
| 767 | Ga0157376_10528568 | |||
| 768 | Ga0163161_10004907 | |||
| 769 | Ga0163161_10411567 | |||
| 770 | Ga0213876_10000525 | |||
| 771 | Ga0207666_1000084 | |||
| 772 | Ga0207673_1000790 | |||
| 773 | Ga0209758_1000158 | |||
| 774 | Ga0209758_1059823 | |||
| 775 | Ga0207697_10003123 | |||
| 776 | Ga0207697_10097105 | |||
| 777 | Ga0207653_10001329 | |||
| 778 | Ga0207682_10001421 | |||
| 779 | Ga0207642_10003465 | |||
| 780 | Ga0207710_10157002 | |||
| 781 | Ga0207688_10000346 | |||
| 782 | Ga0207688_10313151 | |||
| 783 | Ga0207680_10183895 | |||
| 784 | Ga0207647_10015607 | |||
| 785 | Ga0207647_10071622 | |||
| 786 | Ga0207645_10002258 | |||
| 787 | Ga0207645_10014759 | |||
| 788 | Ga0207643_10000870 | |||
| 789 | Ga0207654_10128062 | |||
| 790 | Ga0207654_10176047 | |||
| 791 | Ga0207707_10009781 | |||
| 792 | Ga0207707_10381846 | |||
| 793 | Ga0207695_10000018 | |||
| 794 | Ga0207671_10064791 | |||
| 795 | Ga0207663_10053937 | |||
| 796 | Ga0207660_10004540 | |||
| 797 | Ga0207662_10000677 | |||
| 798 | Ga0207657_10002107 | |||
| 799 | Ga0207649_10106243 | |||
| 800 | Ga0207652_10074024 | |||
| 801 | Ga0207681_10033153 | |||
| 802 | Ga0207694_10069989 | |||
| 803 | Ga0207694_10255218 | |||
| 804 | Ga0207650_10088533 | |||
| 805 | Ga0207650_10310837 | |||
| 806 | Ga0207659_10040617 | |||
| 807 | Ga0207659_10100482 | |||
| 808 | Ga0207700_10000031 | |||
| 809 | Ga0207644_10049486 | |||
| 810 | Ga0207644_10057490 | |||
| 811 | Ga0207644_10407010 | |||
| 812 | Ga0207690_10005379 | |||
| 813 | Ga0207690_10324145 | |||
| 814 | Ga0207706_10005074 | |||
| 815 | Ga0207706_10121723 | |||
| 816 | Ga0207709_10019030 | |||
| 817 | Ga0207670_10008616 | |||
| 818 | Ga0207669_10019671 | |||
| 819 | Ga0207704_10048255 | |||
| 820 | Ga0207691_10003147 | |||
| 821 | Ga0207691_10024020 | |||
| 822 | Ga0207691_10039040 | |||
| 823 | Ga0207691_10087841 | |||
| 824 | Ga0207711_10000014 | |||
| 825 | Ga0207711_10000966 | |||
| 826 | Ga0207711_10034862 | |||
| 827 | Ga0207711_10074885 | |||
| 828 | Ga0207689_10002387 | |||
| 829 | Ga0207661_10323646 | |||
| 830 | Ga0207679_10001868 | |||
| 831 | Ga0207679_10912155 | |||
| 832 | Ga0207667_10027970 | |||
| 833 | Ga0207651_10019584 | |||
| 834 | Ga0207712_10004060 | |||
| 835 | Ga0207668_10003969 | |||
| 836 | Ga0207668_10035585 | |||
| 837 | Ga0207668_10081280 | |||
| 838 | Ga0207668_10201876 | |||
| 839 | Ga0207640_10082710 | |||
| 840 | Ga0207658_10132543 | |||
| 841 | Ga0207658_10225286 | |||
| 842 | Ga0207703_10166246 | |||
| 843 | Ga0207703_10726576 | |||
| 844 | Ga0207639_10006216 | |||
| 845 | Ga0207678_10002254 | |||
| 846 | Ga0207708_10001067 | |||
| 847 | Ga0207702_10079299 | |||
| 848 | Ga0207641_10115954 | |||
| 849 | Ga0207641_10637496 | |||
| 850 | Ga0207648_10004636 | |||
| 851 | Ga0207648_10058695 | |||
| 852 | Ga0207676_10029874 | |||
| 853 | Ga0207676_11117764 | |||
| 854 | Ga0207674_10003170 | |||
| 855 | Ga0207675_100002589 | |||
| 856 | Ga0207675_100249448 | |||
| 857 | Ga0207683_10004673 | |||
| 858 | Ga0207683_10008075 | |||
| 859 | Ga0207698_10010196 | |||
| 860 | Ga0207698_10075194 | |||
| 861 | Ga0207698_10451480 | |||
| 862 | Ga0207698_11030949 | |||
| 863 | Ga0207698_11270542 | |||
| 864 | Ga0209974_10001225 | |||
| 865 | Ga0207428_10016866 | |||
| 866 | Ga0207428_10177910 | |||
| 867 | Ga0268266_10148199 | |||
| 868 | Ga0268266_10570928 | |||
| 869 | Ga0268265_10020216 | |||
| 870 | Ga0268264_10034054 | |||
| 871 | Ga0265338_10051178 | |||
| 872 | Ga0265320_10000962 | |||
| 873 | Ga0265325_10017251 | |||
| 874 | Ga0265329_10051811 | |||
| 875 | Ga0265340_10027710 | |||
| 876 | Ga0265339_10224589 | |||
| 877 | Ga0265316_10023602 | |||
| 878 | Ga0265316_10462328 | |||
| 879 | Ga0265313_10042458 | |||
| 880 | Ga0265313_10074418 | |||
| 881 | Ga0265313_10095587 | |||
| 882 | Ga0265314_10005842 | |||
| 883 | Ga0265314_10008207 | |||
| 884 | Ga0265342_10022418 | |||
| 885 | Ga0265342_10291269 | |||
| 886 | Ga0307516_10141405 | |||
| 887 | Ga0307412_10222454 | |||
| 888 | Ga0307409_100053687 | |||
| 889 | Ga0307411_10142543 | |||
| 890 | Ga0307510_10332313 | |||
| 891 | Ga0373930_0002599 | |||
| 892 | Ga0373948_0017011 | |||
| 893 | Ga0373938_0002301 | |||
| 894 | Ga0373928_0007251 | |||
| 895 | Ga0373929_0002125 | |||
| 896 | Ga0373929_0027123 | |||
| 897 | Ga0373949_0002842 | |||
| 898 | Ga0373951_0005920 | |||
| 899 | Ga0373951_0081226 | |||
| 900 | Ga0373952_0002641 | |||
| 901 | Ga0373932_0004638 | |||
| 902 | Ga0373941_0003337 | |||
| 903 | Ga0373961_0064965 | |||
| 904 | Ga0373931_0002564 | |||
| 905 | Ga0373931_0030689 | |||
| 906 | Ga0373935_0164132 | |||
| 907 | Ga0373927_0021835 | |||
| 908 | Ga0373947_0035544 | |||
| 909 | Ga0373937_0174053 | |||
| 910 | Ga0436365_0616688 | |||
| 911 | Ga0439465_0021070 | |||
| 912 | Ga0451835_0318508 | |||
| 913 | Ga0451853_1083161 | |||
| 914 | Ga0495592_0426850 | |||
| 915 | Ga0495590_0097587 | |||
| 916 | Ga0495638_0002040 | |||
| 917 | Ga0495638_0058463 | |||
| 918 | Ga0495585_0139729 | |||
| 919 | Ga0495643_0075703 | |||
| 920 | Ga0495621_0067124 | |||
| 921 | Ga0495645_0016195 | |||
| 922 | Ga0495658_0042758 | |||
| 923 | Ga0495581_0309343 | |||
| 924 | Ga0496100_0003283 | |||
| 925 | Ga0496101_0067972 | |||
| 926 | Ga0496101_0650189 | |||
| 927 | Ga0496102_0268137 | |||
| 928 | Ga0496102_0793614 | |||
| 929 | Ga0496103_0023646 | |||
| 930 | Ga0496104_0034377 | |||
| 931 | Ga0496104_1052703 | |||
| 932 | Ga0496105_0183143 | |||
| 933 | Ga0496106_0190710 | |||
| 934 | Ga0496107_0014216 | |||
| 935 | Ga0496108_0014556 | |||
| 936 | Ga0496108_0614781 | |||
| 937 | Ga0496109_0004625 | |||
| 938 | Ga0496109_0006399 | |||
| 939 | Ga0496109_0251990 | |||
| 940 | Ga0496110_0757301 | |||
| 941 | Ga0496111_0018298 | |||
| 942 | Ga0496112_0003199 | |||
| 943 | Ga0496112_0046060 | |||
| 944 | Ga0496113_0003250 | |||
| 945 | Ga0496114_0159114 | |||
| 946 | Ga0496114_0166241 | |||
| 947 | Ga0496115_0031788 | |||
| 948 | Ga0496115_0246117 | |||
| 949 | Ga0496115_0356563 | |||
| 950 | Ga0496121_0035175 | |||
| 951 | Ga0495682_0003617 | |||
| 952 | Ga0501031_0177457 | |||
| 953 | Ga0501031_0297028 | |||
| 954 | Ga0501032_0218060 | |||
| 955 | Ga0501033_0259303 | |||
| 956 | Ga0501034_0024805 | |||
| 957 | Ga0501034_0052553 | |||
| 958 | Ga0501034_0296524 | |||
| 959 | Ga0501036_0206015 | |||
| 960 | Ga0501036_0259397 | |||
| 961 | Ga0501037_0276328 | |||
| 962 | Ga0501037_0471458 | |||
| 963 | Ga0501037_0597963 | |||
| 964 | Ga0501038_0260733 | |||
| 965 | Ga0501042_0364194 | |||
| 966 | Ga0501043_0027142 | |||
| 967 | Ga0501043_0174465 | |||
| 968 | Ga0501043_0318580 | |||
| 969 | Ga0501043_0487680 | |||
| 970 | Ga0501046_0412785 | |||
| 971 | Ga0501047_0106369 | |||
| 972 | Ga0501047_0226026 | |||
| 973 | Ga0501047_0529643 | |||
| 974 | Ga0501047_0560837 | |||
| 975 | Ga0501067_0187165 | |||
| 976 | Ga0501068_0001062 | |||
| 977 | Ga0501068_0224338 | |||
| 978 | Ga0501068_0394525 | |||
| 979 | Ga0501069_0133059 | |||
| 980 | Ga0501070_0028297 | |||
| 981 | Ga0501070_0069871 | |||
| 982 | Ga0501071_0177552 | |||
| 983 | Ga0501071_0229924 | |||
| 984 | Ga0501072_0004447 | |||
| 985 | Ga0501072_0376828 | |||
| 986 | Ga0501073_0000322 | |||
| 987 | Ga0501073_0016917 | |||
| 988 | Ga0501074_0570864 | |||
| 989 | Ga0501076_0416634 | |||
| 990 | Ga0501079_0224121 | |||
| 991 | Ga0501079_0274743 | |||
| 992 | Ga0501080_0008962 | |||
| 993 | Ga0501080_0013980 | |||
| 994 | Ga0501083_0008613 | |||
| 995 | Ga0501083_0027665 | |||
| 996 | Ga0501083_0037689 | |||
| 997 | Ga0501083_0037695 | |||
| 998 | Ga0501083_0157316 | |||
| 999 | Ga0501083_0543215 | |||
| 1000 | Ga0501035_0313365 | |||
| 1001 | Ga0501035_0536633 | |||
| 1002 | Ga0501035_0671691 | |||
| 1003 | Ga0501044_0030154 | |||
| 1004 | Ga0501044_0145919 | |||
| 1005 | Ga0501044_0190189 | |||
| 1006 | Ga0501044_0243012 | |||
| 1007 | nmdc:mga00v17_77907_c1 | |||
| 1008 | nmdc:mga0yw44_60147_c1 | |||
| 1009 | nmdc:mga0k408_106949_c1 | |||
| 1010 | nmdc:mga06z11_126455_c1 | |||
| 1011 | nmdc:mga06z11_172172_c1 | |||
| 1012 | nmdc:mga07m45_182075_c1 | |||
| 1013 | nmdc:mga07m45_38285_c1 | |||
| 1014 | nmdc:mga06r32_52084_c1 | |||
| 1015 | nmdc:mga08y16_196080_c1 | |||
| 1016 | nmdc:mga08y16_242789_c1 | |||
| 1017 | nmdc:mga08y16_89246_c1 | |||
| 1018 | nmdc:mga0n895_15886_c1 | |||
| 1019 | nmdc:mga0n895_21640_c1 | |||
| 1020 | nmdc:mga0rr50_27982_c1 | |||
| 1021 | nmdc:mga0a205_13046_c1 | |||
| 1022 | Ga0500643_009483 | |||
| 1023 | Ga0500644_0001818 | |||
| 1024 | Ga0500651_0000483 | |||
| 1025 | Ga0500566_0036755 | |||
| 1026 | Ga0500641_0001124 | |||
| 1027 | Ga0500650_0058026 | |||
| 1028 | Ga0500562_024481 | |||
| 1029 | Ga0500595_000029 | |||
| 1030 | Ga0500595_032961 | |||
| 1031 | Ga0500642_0157288 | |||
| 1032 | Ga0500652_000029 | |||
| 1033 | Ga0500652_074950 | |||
| 1034 | Ga0500655_007365 | |||
| 1035 | Ga0500655_016365 | |||
| 1036 | Ga0500658_0069932 | |||
| 1037 | Ga0500577_0091119 | |||
| 1038 | Ga0500616_0000006 | |||
| 1039 | Ga0500619_015196 | |||
| 1040 | Ga0500636_0005930 | |||
| 1041 | Ga0500645_000290 | |||
| 1042 | Ga0501084_0000626 | |||
| 1043 | Ga0501084_0087364 | |||
| 1044 | Ga0501082_0042674 | |||
| 1045 | Ga0501082_0154777 | |||
| 1046 | Ga0501082_0196750 | |||
| 1047 | 2508691887 | |||
| 1048 | 2511397426 | |||
| 1049 | 2513592583 | |||
| 1050 | 2513622421 | |||
| 1051 | 2513645529 | |||
| 1052 | 2513855538 | |||
| 1053 | 2513873063 | |||
| 1054 | 2514015637 | |||
| 1055 | 2515627205 | |||
| 1056 | 2517102748 | |||
| 1057 | 2617347074 | |||
| 1058 | 2644290097 | |||
| 1059 | 2793062674 | |||
| 1060 | 2805915038 | |||
| 1061 | 2818238576 | |||
| 1062 | 2824602437 | |||
| 1063 | 2824610448 | |||
| 1064 | 2824657400 | |||
| 1065 | 2824671963 | |||
| 1066 | 2824688562 | |||
| 1067 | 2824699872 | |||
| 1068 | 2824714292 | |||
| 1069 | 2824754276 | |||
| 1070 | 2824767775 | |||
| 1071 | 2824775329 | |||
| 1072 | 2838123428 | |||
| 1073 | 2841947799 | |||
| 1074 | 2841949530 | |||
| 1075 | 2841971963 | |||
| 1076 | 2841983748 | |||
| 1077 | 2842046949 | |||
| 1078 | 2847936518 | |||
| 1079 | 2847946865 | |||
| 1080 | 2849079032 | |||
| 1081 | 2874619451 | |||
| 1082 | 2874621151 | |||
| 1083 | 2879083221 | |||
| 1084 | 2881368555 | |||
| 1085 | 2881672600 | |||
| 1086 | 2885414153 | |||
| 1087 | 2888384394 | |||
| 1088 | 2888393524 | |||
| 1089 | 2888424823 | |||
| 1090 | 2904673373 | |||
| 1091 | 2904714999 | |||
| 1092 | 2906639273 | |||
| 1093 | 2906646620 | |||
| 1094 | 2906662472 | |||
| 1095 | 2908742363 | |||
| 1096 | 2935650976 | |||
| 1097 | 2935659157 | |||
| 1098 | 2935771766 | |||
| 1099 | 2935987428 | |||
| 1100 | 2936013572 | |||
| 1101 | 2936022301 | |||
| 1102 | 2936030747 | |||
| 1103 | 2936048560 | |||
| 1104 | 2936058774 | |||
| 1105 | 3005510610 | |||
| 1106 | 8006931546 | |||
| 1107 | 8016529325 | |||
| 1108 | 8016534540 | |||
| 1109 | 8016547757 | |||
| 1110 | 8016554378 | |||
| 1111 | 8016562746 | |||
| 1112 | 8016572881 | |||
| 1113 | 8016577040 | |||
| 1114 | 8016600530 | |||
| 1115 | 8019534301 | |||
| 1116 | 8019628500 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dkq-assembly1.cif.gz_B-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9755 | 2 | 226 |
| 3dkq-assembly1.cif.gz_C-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9595 | 1 | 226 |
| 3dkq-assembly1.cif.gz_A-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9526 | 1 | 226 |
| 3dkq-assembly1.cif.gz_A-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9404 | 1 | 226 |
| 3dkq-assembly1.cif.gz_B-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9387 | 2 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dkqC01 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.9592 | 2 | 178 | 2.60.120.620 |
| 3dkqA02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9525 | 180 | 226 | 4.10.860.20 |
| 3dkqC02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9492 | 180 | 226 | 4.10.860.20 |
| af_A0A2R8QTR6_26_127_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.9385 | 183 | 220 | 1.20.1280.290 |
| 3dkqA02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9333 | 180 | 226 | 4.10.860.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377TSW3-F1-model_v4 | Iron-uptake factor PiuC (EC 1.14.11.-) | 0.9946 | 111 | 189 |
GO:0006879
GO:0006974 GO:0016706 |
| AF-A0A1H8NHS7-F1-model_v4 | PKHD-type hydroxylase | 0.9925 | 1 | 199 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-A0A399IX52-F1-model_v4 | Fe2+-dependent dioxygenase | 0.992 | 1 | 226 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-A0A2X3F8N6-F1-model_v4 | Iron-uptake factor PiuC (EC 1.14.11.-) | 0.9908 | 111 | 176 |
GO:0006879
GO:0006974 GO:0016706 |
| AF-G6XFC2-F1-model_v4 | Putative hydroxylase | 0.9905 | 1 | 226 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |