F463492

General Info

Members Datasets Scaffolds Average Seq Length
558 377 1116 226

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0009373|Ga0495672_0009373_4253_5023
Length 256
Sequence MPAFVLKAQVSASAAAELINVDAADDGDDAMMLHIPNVLTPEQVARCKDVMTKAAWVDGNVTAGHQSSKVKYNLQLPEESAEARELGDMVRGALARNPMFMSAVLPMQVFPPLFNRYDAGMTFGSHVDNAIRTHSHLPVRIRTDVSSTLFISSPEDYDGGELVVEDTYGSHSVKLPAGDLVIYPATSLHHVTPITRGSRIASFFWTQSMIRDVSHRTMLFDLDMSIIRLTQDAPNHPSLVSLTGLYHNLLRQWAEL

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
290 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
294 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
295 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
304 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
309 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
310 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
311 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
312 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
313 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
314 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
315 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
316 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
317 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
318 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
319 2643221651 Afipia sp. Root123D2 Isolate Unclassified
320 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
321 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
322 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
323 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
324 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
325 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
326 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
327 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
328 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
329 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
330 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
331 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
332 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
333 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
334 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
335 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
336 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
337 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
338 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
339 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
340 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
341 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
342 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
343 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
344 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
345 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
346 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
347 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
348 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
349 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
350 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
351 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
352 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
353 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
354 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
355 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
356 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
357 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
358 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
359 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
360 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
361 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
362 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
363 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
364 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
365 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
366 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
367 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
368 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
369 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
370 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
371 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
372 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
373 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
374 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
375 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
376 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
377 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.46
Metatranscriptomes 0
Isolates 12.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 7.35
Rhizoplane 4.66
Rhizosphere 75.09
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0009373 3300047320 Bacteria 7100
2 JGI24032J14994_100495 3300001430 Bacteria 2061
3 JGI24752J21851_1020232 3300001976 Bacteria 869
4 JGI24746J21847_1000861 3300001977 Bacteria 4713
5 JGI24747J21853_1002968 3300001978 Bacteria 1434
6 JGI24739J22299_10066316 3300001989 Bacteria 1130
7 JGI24737J22298_10002394 3300001990 Bacteria 6691
8 JGI24750J21931_1000859 3300002070 Bacteria 4172
9 JGI24738J21930_10001606 3300002075 Bacteria 6224
10 JGI24749J21850_1000589 3300002076 Bacteria 5297
11 JGI24035J26624_1001701 3300002126 Bacteria 2059
12 JGI24034J26672_10001847 3300002239 Bacteria 2857
13 JGI24742J22300_10000991 3300002244 Bacteria 4360
14 JGI24751J29686_10029296 3300002459 Bacteria 1143
15 JGI25406J46586_10000166 3300003203 Bacteria 29209
16 JGI25165J46597_1004351 3300003214 Bacteria 3073
17 JGI25160J50197_1000838 3300003354 Bacteria 16394
18 JGI25405J52794_10031955 3300003911 Bacteria 1095
19 Ga0065704_10255096 3300005289 Bacteria 979
20 Ga0065712_10095860 3300005290 Bacteria 2201
21 Ga0065712_10200012 3300005290 Bacteria 1112
22 Ga0065715_10002503 3300005293 Bacteria 5046
23 Ga0070676_10003946 3300005328 Bacteria 7787
24 Ga0070676_10475929 3300005328 Bacteria 883
25 Ga0070683_100003103 3300005329 Bacteria 13382
26 Ga0070683_100245619 3300005329 Bacteria 1702
27 Ga0070690_100001658 3300005330 Bacteria 11711
28 Ga0070670_100005908 3300005331 Bacteria 10347
29 Ga0070670_100144883 3300005331 Bacteria 2055
30 Ga0070670_100684204 3300005331 Bacteria 921
31 Ga0070677_10002586 3300005333 Bacteria 5795
32 Ga0068869_100003321 3300005334 Bacteria 9826
33 Ga0068869_100208065 3300005334 Bacteria 1545
34 Ga0070666_10061316 3300005335 Bacteria 2546
35 Ga0070666_10347005 3300005335 Unclassified 1061
36 Ga0070680_100005234 3300005336 Bacteria 9816
37 Ga0070680_100464158 3300005336 Bacteria 1082
38 Ga0070682_100002520 3300005337 Bacteria 10107
39 Ga0068868_100009819 3300005338 Bacteria 6907
40 Ga0068868_100018015 3300005338 Bacteria 5271
41 Ga0070660_100001332 3300005339 Bacteria 16783
42 Ga0070689_100032582 3300005340 Bacteria 3965
43 Ga0070691_10002586 3300005341 Bacteria 8070
44 Ga0070687_100001160 3300005343 Bacteria 9117
45 Ga0070661_100002370 3300005344 Bacteria 12928
46 Ga0070692_10000841 3300005345 Bacteria 10313
47 Ga0070668_100006877 3300005347 Bacteria 8430
48 Ga0070669_100006963 3300005353 Bacteria 8123
49 Ga0070669_100613903 3300005353 Unclassified 912
50 Ga0070675_100039738 3300005354 Bacteria 3840
51 Ga0070675_100077803 3300005354 Bacteria 2762
52 Ga0070675_100670601 3300005354 Bacteria 943
53 Ga0070671_100005218 3300005355 Bacteria 10352
54 Ga0070671_100101128 3300005355 Bacteria 2419
55 Ga0070674_100006788 3300005356 Bacteria 6705
56 Ga0070673_100000418 3300005364 Bacteria 22446
57 Ga0070673_100011419 3300005364 Bacteria 6058
58 Ga0070688_100000906 3300005365 Bacteria 14793
59 Ga0070688_100041837 3300005365 Bacteria 2815
60 Ga0070659_100003550 3300005366 Bacteria 11108
61 Ga0070659_100068041 3300005366 Bacteria 2824
62 Ga0070659_100746125 3300005366 Bacteria 849
63 Ga0070667_100007947 3300005367 Bacteria 8797
64 Ga0070667_100069961 3300005367 Bacteria 2987
65 Ga0070667_100138890 3300005367 Bacteria 2126
66 Ga0070703_10009495 3300005406 Bacteria 2743
67 Ga0070713_100000146 3300005436 Bacteria 46988
68 Ga0070713_100083941 3300005436 Bacteria 2724
69 Ga0070701_10000664 3300005438 Bacteria 12083
70 Ga0070701_10178248 3300005438 Bacteria 1242
71 Ga0070705_100003104 3300005440 Bacteria 8170
72 Ga0070700_100010501 3300005441 Bacteria 5116
73 Ga0070694_100002530 3300005444 Bacteria 10796
74 Ga0070708_100020015 3300005445 Bacteria 5636
75 Ga0070663_100002896 3300005455 Bacteria 9759
76 Ga0070678_100005419 3300005456 Bacteria 7367
77 Ga0070678_100057502 3300005456 Bacteria 2849
78 Ga0070678_100163247 3300005456 Bacteria 1807
79 Ga0070678_100378912 3300005456 Bacteria 1223
80 Ga0070681_10008649 3300005458 Bacteria 9982
81 Ga0070681_10483877 3300005458 Bacteria 1151
82 Ga0068867_100003064 3300005459 Bacteria 11775
83 Ga0068867_100253946 3300005459 Bacteria 1431
84 Ga0070679_100018279 3300005530 Bacteria 6799
85 Ga0070684_100001969 3300005535 Bacteria 15093
86 Ga0070697_100571351 3300005536 Bacteria 992
87 Ga0068853_100004522 3300005539 Bacteria 10792
88 Ga0068853_100005756 3300005539 Bacteria 9758
89 Ga0070672_100006625 3300005543 Bacteria 7801
90 Ga0070672_100048783 3300005543 Bacteria 3292
91 Ga0070672_100183213 3300005543 Bacteria 1746
92 Ga0070686_100002237 3300005544 Bacteria 10673
93 Ga0070686_100239631 3300005544 Bacteria 1320
94 Ga0070695_100002841 3300005545 Bacteria 10066
95 Ga0070696_100003720 3300005546 Bacteria 10178
96 Ga0070696_100543017 3300005546 Bacteria 930
97 Ga0070693_100001170 3300005547 Bacteria 11794
98 Ga0070665_100027334 3300005548 Bacteria 5747
99 Ga0070665_100031750 3300005548 Bacteria 5316
100 Ga0070665_100600575 3300005548 Unclassified 1113
101 Ga0068855_100010841 3300005563 Bacteria 11004
102 Ga0070664_100039822 3300005564 Bacteria 3961
103 Ga0070664_100965351 3300005564 Unclassified 800
104 Ga0068857_100002282 3300005577 Bacteria 15594
105 Ga0068854_100011480 3300005578 Bacteria 5770
106 Ga0068854_100371757 3300005578 Bacteria 1176
107 Ga0068856_100002597 3300005614 Bacteria 18595
108 Ga0068856_100087023 3300005614 Bacteria 3105
109 Ga0070702_100011694 3300005615 Bacteria 4373
110 Ga0068852_100006066 3300005616 Bacteria 8706
111 Ga0068852_100010433 3300005616 Bacteria 6944
112 Ga0068852_100090962 3300005616 Bacteria 2730
113 Ga0068852_100471115 3300005616 Unclassified 1246
114 Ga0068852_100492648 3300005616 Bacteria 1219
115 Ga0068859_100005044 3300005617 Bacteria 13403
116 Ga0068859_100335169 3300005617 Bacteria 1607
117 Ga0068864_100003691 3300005618 Bacteria 12643
118 Ga0068864_100085589 3300005618 Unclassified 2772
119 Ga0068866_10000899 3300005718 Bacteria 13114
120 Ga0068851_10017089 3300005834 Bacteria 3481
121 Ga0068870_10000555 3300005840 Bacteria 14125
122 Ga0068863_100045734 3300005841 Bacteria 4154
123 Ga0068863_100105926 3300005841 Bacteria 2675
124 Ga0068858_100011919 3300005842 Bacteria 8194
125 Ga0068858_100013722 3300005842 Bacteria 7647
126 Ga0068858_100930323 3300005842 Bacteria 851
127 Ga0068860_100016500 3300005843 Bacteria 7203
128 Ga0068860_100269920 3300005843 Bacteria 1660
129 Ga0068860_100283302 3300005843 Bacteria 1620
130 Ga0068862_100003011 3300005844 Bacteria 14700
131 Ga0068862_100500464 3300005844 Bacteria 1153
132 Ga0081455_10000673 3300005937 Bacteria 44258
133 Ga0081540_1113215 3300005983 Bacteria 1142
134 Ga0081539_10000351 3300005985 Bacteria 101228
135 Ga0081539_10000933 3300005985 Bacteria 54819
136 Ga0070717_10430089 3300006028 Unclassified 1188
137 Ga0075364_10006017 3300006051 Bacteria 7094
138 Ga0075362_10003298 3300006177 Bacteria 5616
139 Ga0075367_10184091 3300006178 Bacteria 1302
140 Ga0075366_10126879 3300006195 Bacteria 1539
141 Ga0097621_100012307 3300006237 Bacteria 6334
142 Ga0097621_100098401 3300006237 Bacteria 2457
143 Ga0097621_100101560 3300006237 Bacteria 2420
144 Ga0097621_100139775 3300006237 Bacteria 2069
145 Ga0075370_10013698 3300006353 Bacteria 4316
146 Ga0075370_10041199 3300006353 Bacteria 2607
147 Ga0068871_100040551 3300006358 Unclassified 3729
148 Ga0068871_100103573 3300006358 Bacteria 2386
149 Ga0075431_100056384 3300006847 Bacteria 4053
150 Ga0075433_10005076 3300006852 Bacteria 10322
151 Ga0075433_10197395 3300006852 Bacteria 1790
152 Ga0075434_100014176 3300006871 Bacteria 7615
153 Ga0075434_100145575 3300006871 Bacteria 2390
154 Ga0068865_100026222 3300006881 Bacteria 3840
155 Ga0097620_100005044 3300006931 Bacteria 13403
156 Ga0097620_100335154 3300006931 Bacteria 1607
157 Ga0075435_100013698 3300007076 Bacteria 6041
158 Ga0075435_100524925 3300007076 Bacteria 1024
159 Ga0105250_10039026 3300009092 Bacteria 1904
160 Ga0105240_10004929 3300009093 Bacteria 20069
161 Ga0105240_10046314 3300009093 Bacteria 5511
162 Ga0105240_10067342 3300009093 Bacteria 4439
163 Ga0111539_10021247 3300009094 Bacteria 7992
164 Ga0111539_10033888 3300009094 Bacteria 6196
165 Ga0111539_10156165 3300009094 Bacteria 2670
166 Ga0111539_10318846 3300009094 Bacteria 1809
167 Ga0111539_10713389 3300009094 Bacteria 1167
168 Ga0105245_10006794 3300009098 Bacteria 10033
169 Ga0105247_10265417 3300009101 Bacteria 1179
170 Ga0105243_10007504 3300009148 Bacteria 8380
171 Ga0105241_10002961 3300009174 Bacteria 12676
172 Ga0105242_10004894 3300009176 Bacteria 10369
173 Ga0105248_10000007 3300009177 Bacteria 471250
174 Ga0105248_10001330 3300009177 Bacteria 27498
175 Ga0105248_10005301 3300009177 Bacteria 14193
176 Ga0105248_10005481 3300009177 Bacteria 13935
177 Ga0105248_10296631 3300009177 Unclassified 1820
178 Ga0105237_10134145 3300009545 Bacteria 2471
179 Ga0105238_10085396 3300009551 Bacteria 3144
180 Ga0105249_10038236 3300009553 Bacteria 4353
181 Ga0105239_10025208 3300010375 Bacteria 6548
182 Ga0105239_10040990 3300010375 Bacteria 5074
183 Ga0105239_10109775 3300010375 Bacteria 3057
184 Ga0105239_10182308 3300010375 Unclassified 2349
185 Ga0105246_10006621 3300011119 Bacteria 7082
186 Ga0105246_10025354 3300011119 Bacteria 3864
187 Ga0157313_1004972 3300012503 Bacteria 940
188 Ga0157373_10050278 3300013100 Bacteria 2969
189 Ga0157371_10018413 3300013102 Bacteria 5164
190 Ga0157374_10005394 3300013296 Bacteria 10745
191 Ga0157374_10436085 3300013296 Bacteria 1310
192 Ga0157374_10642287 3300013296 Bacteria 1073
193 Ga0157378_10157019 3300013297 Bacteria 2124
194 Ga0157378_10225036 3300013297 Bacteria 1785
195 Ga0157372_10005559 3300013307 Bacteria 13400
196 Ga0157372_10479459 3300013307 Bacteria 1450
197 Ga0157375_10004143 3300013308 Bacteria 12581
198 Ga0157375_10154705 3300013308 Bacteria 2431
199 Ga0163163_10004364 3300014325 Bacteria 12051
200 Ga0163163_10056553 3300014325 Bacteria 3877
201 Ga0163163_10129414 3300014325 Bacteria 2564
202 Ga0157380_10004080 3300014326 Bacteria 10082
203 Ga0157377_10002281 3300014745 Bacteria 8431
204 Ga0157379_10003623 3300014968 Bacteria 13109
205 Ga0157379_10125007 3300014968 Bacteria 2314
206 Ga0157379_10468430 3300014968 Bacteria 1165
207 Ga0157376_10008998 3300014969 Bacteria 7232
208 Ga0157376_10073653 3300014969 Bacteria 2909
209 Ga0157376_10528568 3300014969 Bacteria 1164
210 Ga0163161_10004907 3300017792 Bacteria 9309
211 Ga0163161_10411567 3300017792 Unclassified 1086
212 Ga0213876_10000525 3300021384 Bacteria 29265
213 Ga0207666_1000084 3300025271 Bacteria 15613
214 Ga0207673_1000790 3300025290 Bacteria 3412
215 Ga0209758_1000158 3300025297 Bacteria 156129
216 Ga0209758_1059823 3300025297 Bacteria 1265
217 Ga0207697_10003123 3300025315 Bacteria 8279
218 Ga0207697_10097105 3300025315 Bacteria 1253
219 Ga0207653_10001329 3300025885 Bacteria 8032
220 Ga0207682_10001421 3300025893 Bacteria 11062
221 Ga0207642_10003465 3300025899 Bacteria 4981
222 Ga0207710_10157002 3300025900 Bacteria 1106
223 Ga0207688_10000346 3300025901 Bacteria 21494
224 Ga0207688_10313151 3300025901 Bacteria 962
225 Ga0207680_10183895 3300025903 Bacteria 1415
226 Ga0207647_10015607 3300025904 Bacteria 5202
227 Ga0207647_10071622 3300025904 Bacteria 2091
228 Ga0207645_10002258 3300025907 Bacteria 15323
229 Ga0207645_10014759 3300025907 Bacteria 5217
230 Ga0207643_10000870 3300025908 Bacteria 18192
231 Ga0207654_10128062 3300025911 Bacteria 1603
232 Ga0207654_10176047 3300025911 Bacteria 1393
233 Ga0207707_10009781 3300025912 Bacteria 8317
234 Ga0207707_10381846 3300025912 Bacteria 1211
235 Ga0207695_10000018 3300025913 Bacteria 766611
236 Ga0207671_10064791 3300025914 Bacteria 2717
237 Ga0207663_10053937 3300025916 Bacteria 2515
238 Ga0207660_10004540 3300025917 Bacteria 9053
239 Ga0207662_10000677 3300025918 Bacteria 15501
240 Ga0207657_10002107 3300025919 Bacteria 21516
241 Ga0207649_10106243 3300025920 Bacteria 1867
242 Ga0207652_10074024 3300025921 Bacteria 2965
243 Ga0207681_10033153 3300025923 Bacteria 3384
244 Ga0207694_10069989 3300025924 Bacteria 2741
245 Ga0207694_10255218 3300025924 Bacteria 1436
246 Ga0207650_10088533 3300025925 Bacteria 2361
247 Ga0207650_10310837 3300025925 Bacteria 1289
248 Ga0207659_10040617 3300025926 Bacteria 3254
249 Ga0207659_10100482 3300025926 Bacteria 2180
250 Ga0207700_10000031 3300025928 Bacteria 130086
251 Ga0207644_10049486 3300025931 Bacteria 3009
252 Ga0207644_10057490 3300025931 Bacteria 2809
253 Ga0207644_10407010 3300025931 Bacteria 1113
254 Ga0207690_10005379 3300025932 Bacteria 7545
255 Ga0207690_10324145 3300025932 Bacteria 1212
256 Ga0207706_10005074 3300025933 Bacteria 12298
257 Ga0207706_10121723 3300025933 Bacteria 2294
258 Ga0207709_10019030 3300025935 Bacteria 3854
259 Ga0207670_10008616 3300025936 Bacteria 5767
260 Ga0207669_10019671 3300025937 Bacteria 3522
261 Ga0207704_10048255 3300025938 Bacteria 2551
262 Ga0207691_10003147 3300025940 Bacteria 16133
263 Ga0207691_10024020 3300025940 Bacteria 5734
264 Ga0207691_10039040 3300025940 Unclassified 4393
265 Ga0207691_10087841 3300025940 Bacteria 2789
266 Ga0207711_10000014 3300025941 Bacteria 506753
267 Ga0207711_10000966 3300025941 Bacteria 27506
268 Ga0207711_10034862 3300025941 Bacteria 4262
269 Ga0207711_10074885 3300025941 Bacteria 2945
270 Ga0207689_10002387 3300025942 Bacteria 17532
271 Ga0207661_10323646 3300025944 Bacteria 1386
272 Ga0207679_10001868 3300025945 Bacteria 13091
273 Ga0207679_10912155 3300025945 Bacteria 804
274 Ga0207667_10027970 3300025949 Bacteria 6128
275 Ga0207651_10019584 3300025960 Bacteria 4060
276 Ga0207712_10004060 3300025961 Bacteria 9243
277 Ga0207668_10003969 3300025972 Bacteria 8715
278 Ga0207668_10035585 3300025972 Bacteria 3317
279 Ga0207668_10081280 3300025972 Bacteria 2350
280 Ga0207668_10201876 3300025972 Bacteria 1584
281 Ga0207640_10082710 3300025981 Bacteria 2199
282 Ga0207658_10132543 3300025986 Bacteria 2004
283 Ga0207658_10225286 3300025986 Bacteria 1579
284 Ga0207703_10166246 3300026035 Bacteria 1936
285 Ga0207703_10726576 3300026035 Unclassified 945
286 Ga0207639_10006216 3300026041 Bacteria 8111
287 Ga0207678_10002254 3300026067 Bacteria 17463
288 Ga0207708_10001067 3300026075 Bacteria 20564
289 Ga0207702_10079299 3300026078 Bacteria 2845
290 Ga0207641_10115954 3300026088 Bacteria 2382
291 Ga0207641_10637496 3300026088 Unclassified 1046
292 Ga0207648_10004636 3300026089 Bacteria 14075
293 Ga0207648_10058695 3300026089 Bacteria 3356
294 Ga0207676_10029874 3300026095 Bacteria 4084
295 Ga0207676_11117764 3300026095 Unclassified 779
296 Ga0207674_10003170 3300026116 Bacteria 20247
297 Ga0207675_100002589 3300026118 Bacteria 17916
298 Ga0207675_100249448 3300026118 Bacteria 1718
299 Ga0207683_10004673 3300026121 Bacteria 11803
300 Ga0207683_10008075 3300026121 Bacteria 9000
301 Ga0207698_10010196 3300026142 Bacteria 6023
302 Ga0207698_10075194 3300026142 Bacteria 2698
303 Ga0207698_10451480 3300026142 Bacteria 1241
304 Ga0207698_11030949 3300026142 Bacteria 834
305 Ga0207698_11270542 3300026142 Bacteria 751
306 Ga0209974_10001225 3300027876 Bacteria 9184
307 Ga0207428_10016866 3300027907 Bacteria 6276
308 Ga0207428_10177910 3300027907 Bacteria 1608
309 Ga0268266_10148199 3300028379 Bacteria 2112
310 Ga0268266_10570928 3300028379 Bacteria 1085
311 Ga0268265_10020216 3300028380 Bacteria 4644
312 Ga0268264_10034054 3300028381 Bacteria 4188
313 Ga0265338_10051178 3300028800 Bacteria 3722
314 Ga0265320_10000962 3300031240 Bacteria 21416
315 Ga0265325_10017251 3300031241 Bacteria 4014
316 Ga0265329_10051811 3300031242 Bacteria 1306
317 Ga0265340_10027710 3300031247 Bacteria 2854
318 Ga0265339_10224589 3300031249 Bacteria 917
319 Ga0265316_10023602 3300031344 Bacteria 5164
320 Ga0265316_10462328 3300031344 Bacteria 909
321 Ga0265313_10042458 3300031595 Bacteria 2233
322 Ga0265313_10074418 3300031595 Bacteria 1557
323 Ga0265313_10095587 3300031595 Bacteria 1326
324 Ga0265314_10005842 3300031711 Bacteria 11019
325 Ga0265314_10008207 3300031711 Bacteria 8975
326 Ga0265342_10022418 3300031712 Bacteria 4014
327 Ga0265342_10291269 3300031712 Bacteria 862
328 Ga0307516_10141405 3300031730 Bacteria 2176
329 Ga0307412_10222454 3300031911 Bacteria 1448
330 Ga0307409_100053687 3300031995 Bacteria 3098
331 Ga0307411_10142543 3300032005 Bacteria 1769
332 Ga0307510_10332313 3300033180 Unclassified 974
333 Ga0373930_0002599 3300034816 Bacteria 2806
334 Ga0373948_0017011 3300034817 Bacteria 1351
335 Ga0373938_0002301 3300034957 Bacteria 3072
336 Ga0373928_0007251 3300035084 Bacteria 2137
337 Ga0373929_0002125 3300035085 Bacteria 3686
338 Ga0373929_0027123 3300035085 Bacteria 1201
339 Ga0373949_0002842 3300035090 Bacteria 4296
340 Ga0373951_0005920 3300035091 Bacteria 2822
341 Ga0373951_0081226 3300035091 Bacteria 839
342 Ga0373952_0002641 3300035092 Bacteria 3234
343 Ga0373932_0004638 3300035112 Bacteria 3248
344 Ga0373941_0003337 3300035115 Bacteria 3628
345 Ga0373961_0064965 3300035241 Bacteria 1116
346 Ga0373931_0002564 3300035691 Bacteria 8087
347 Ga0373931_0030689 3300035691 Bacteria 2769
348 Ga0373935_0164132 3300035692 Bacteria 1516
349 Ga0373927_0021835 3300035695 Bacteria 4195
350 Ga0373947_0035544 3300035725 Bacteria 2950
351 Ga0373937_0174053 3300036401 Bacteria 2020
352 Ga0436365_0616688 3300039437 Bacteria 20979
353 Ga0439465_0021070 3300041413 Bacteria 2044
354 Ga0451835_0318508 3300041492 Bacteria 767
355 Ga0451853_1083161 3300041512 Bacteria 892
356 Ga0495592_0426850 3300046454 Bacteria 835
357 Ga0495590_0097587 3300046457 Bacteria 1043
358 Ga0495638_0002040 3300046460 Bacteria 17189
359 Ga0495638_0058463 3300046460 Bacteria 2389
360 Ga0495585_0139729 3300046492 Unclassified 1269
361 Ga0495643_0075703 3300046522 Bacteria 1761
362 Ga0495621_0067124 3300046539 Bacteria 1314
363 Ga0495645_0016195 3300046543 Bacteria 5316
364 Ga0495658_0042758 3300046683 Bacteria 2531
365 Ga0495581_0309343 3300047315 Bacteria 923
366 Ga0496100_0003283 3300048903 Bacteria 8408
367 Ga0496101_0067972 3300048904 Bacteria 2603
368 Ga0496101_0650189 3300048904 Bacteria 833
369 Ga0496102_0268137 3300048905 Bacteria 1609
370 Ga0496102_0793614 3300048905 Bacteria 869
371 Ga0496103_0023646 3300048906 Bacteria 3706
372 Ga0496104_0034377 3300048907 Bacteria 4727
373 Ga0496104_1052703 3300048907 Bacteria 717
374 Ga0496105_0183143 3300048908 Bacteria 1714
375 Ga0496106_0190710 3300048909 Bacteria 1629
376 Ga0496107_0014216 3300048910 Bacteria 5573
377 Ga0496108_0014556 3300048911 Bacteria 6422
378 Ga0496108_0614781 3300048911 Bacteria 946
379 Ga0496109_0004625 3300048912 Bacteria 11489
380 Ga0496109_0006399 3300048912 Bacteria 9914
381 Ga0496109_0251990 3300048912 Bacteria 1663
382 Ga0496110_0757301 3300048913 Bacteria 874
383 Ga0496111_0018298 3300048914 Bacteria 4852
384 Ga0496112_0003199 3300048915 Bacteria 13476
385 Ga0496112_0046060 3300048915 Bacteria 4276
386 Ga0496113_0003250 3300048916 Bacteria 9693
387 Ga0496114_0159114 3300048917 Bacteria 1963
388 Ga0496114_0166241 3300048917 Bacteria 1920
389 Ga0496115_0031788 3300048918 Bacteria 4161
390 Ga0496115_0246117 3300048918 Bacteria 1473
391 Ga0496115_0356563 3300048918 Bacteria 1192
392 Ga0496121_0035175 3300048924 Bacteria 4494
393 Ga0495682_0003617 3300049460 Bacteria 6819
394 Ga0501031_0177457 3300049568 Bacteria 1392
395 Ga0501031_0297028 3300049568 Bacteria 1047
396 Ga0501032_0218060 3300049569 Bacteria 1242
397 Ga0501033_0259303 3300049570 Bacteria 1231
398 Ga0501034_0024805 3300049571 Bacteria 6102
399 Ga0501034_0052553 3300049571 Bacteria 4104
400 Ga0501034_0296524 3300049571 Bacteria 1554
401 Ga0501036_0206015 3300049572 Bacteria 1653
402 Ga0501036_0259397 3300049572 Bacteria 1456
403 Ga0501037_0276328 3300049573 Bacteria 1171
404 Ga0501037_0471458 3300049573 Bacteria 854
405 Ga0501037_0597963 3300049573 Bacteria 741
406 Ga0501038_0260733 3300049574 Bacteria 1370
407 Ga0501042_0364194 3300049578 Bacteria 1046
408 Ga0501043_0027142 3300049579 Bacteria 4495
409 Ga0501043_0174465 3300049579 Bacteria 1676
410 Ga0501043_0318580 3300049579 Bacteria 1186
411 Ga0501043_0487680 3300049579 Bacteria 922
412 Ga0501046_0412785 3300049580 Bacteria 974
413 Ga0501047_0106369 3300049581 Bacteria 2686
414 Ga0501047_0226026 3300049581 Bacteria 1726
415 Ga0501047_0529643 3300049581 Bacteria 1003
416 Ga0501047_0560837 3300049581 Bacteria 966
417 Ga0501067_0187165 3300049583 Bacteria 1153
418 Ga0501068_0001062 3300049584 Bacteria 14538
419 Ga0501068_0224338 3300049584 Bacteria 1195
420 Ga0501068_0394525 3300049584 Bacteria 892
421 Ga0501069_0133059 3300049585 Bacteria 1425
422 Ga0501070_0028297 3300049586 Bacteria 4700
423 Ga0501070_0069871 3300049586 Bacteria 2908
424 Ga0501071_0177552 3300049587 Bacteria 1595
425 Ga0501071_0229924 3300049587 Bacteria 1397
426 Ga0501072_0004447 3300049588 Bacteria 10647
427 Ga0501072_0376828 3300049588 Bacteria 1126
428 Ga0501073_0000322 3300049589 Bacteria 32029
429 Ga0501073_0016917 3300049589 Bacteria 5282
430 Ga0501074_0570864 3300049590 Bacteria 801
431 Ga0501076_0416634 3300049592 Bacteria 1105
432 Ga0501079_0224121 3300049741 Bacteria 1469
433 Ga0501079_0274743 3300049741 Bacteria 1317
434 Ga0501080_0008962 3300049742 Bacteria 9101
435 Ga0501080_0013980 3300049742 Bacteria 7388
436 Ga0501083_0008613 3300049744 Bacteria 7197
437 Ga0501083_0027665 3300049744 Bacteria 3911
438 Ga0501083_0037689 3300049744 Bacteria 3291
439 Ga0501083_0037695 3300049744 Bacteria 3291
440 Ga0501083_0157316 3300049744 Bacteria 1487
441 Ga0501083_0543215 3300049744 Bacteria 756
442 Ga0501035_0313365 3300049822 Bacteria 1320
443 Ga0501035_0536633 3300049822 Bacteria 959
444 Ga0501035_0671691 3300049822 Bacteria 838
445 Ga0501044_0030154 3300049823 Bacteria 5717
446 Ga0501044_0145919 3300049823 Bacteria 2352
447 Ga0501044_0190189 3300049823 Bacteria 2016
448 Ga0501044_0243012 3300049823 Bacteria 1743
449 nmdc:mga00v17_77907_c1 3300050491 Bacteria 2065
450 nmdc:mga0yw44_60147_c1 3300050492 Bacteria 2326
451 nmdc:mga0k408_106949_c1 3300050493 Bacteria 1652
452 nmdc:mga06z11_126455_c1 3300050494 Bacteria 1431
453 nmdc:mga06z11_172172_c1 3300050494 Bacteria 1244
454 nmdc:mga07m45_182075_c1 3300050496 Bacteria 1222
455 nmdc:mga07m45_38285_c1 3300050496 Bacteria 2675
456 nmdc:mga06r32_52084_c1 3300050510 Bacteria 3919
457 nmdc:mga08y16_196080_c1 3300050511 Bacteria 2093
458 nmdc:mga08y16_242789_c1 3300050511 Bacteria 1862
459 nmdc:mga08y16_89246_c1 3300050511 Bacteria 3213
460 nmdc:mga0n895_15886_c1 3300050512 Bacteria 6886
461 nmdc:mga0n895_21640_c1 3300050512 Bacteria 6018
462 nmdc:mga0rr50_27982_c1 3300050513 Bacteria 3956
463 nmdc:mga0a205_13046_c1 3300050515 Bacteria 7716
464 Ga0500643_009483 3300053087 Bacteria 3716
465 Ga0500644_0001818 3300053088 Bacteria 5514
466 Ga0500651_0000483 3300053093 Bacteria 20822
467 Ga0500566_0036755 3300053094 Bacteria 2840
468 Ga0500641_0001124 3300053096 Bacteria 9502
469 Ga0500650_0058026 3300053098 Bacteria 1805
470 Ga0500562_024481 3300053108 Bacteria 1579
471 Ga0500595_000029 3300053119 Bacteria 122318
472 Ga0500595_032961 3300053119 Bacteria 1723
473 Ga0500642_0157288 3300053130 Bacteria 1066
474 Ga0500652_000029 3300053131 Bacteria 91212
475 Ga0500652_074950 3300053131 Bacteria 1405
476 Ga0500655_007365 3300053133 Bacteria 1981
477 Ga0500655_016365 3300053133 Bacteria 1365
478 Ga0500658_0069932 3300053134 Bacteria 1479
479 Ga0500577_0091119 3300053142 Bacteria 1232
480 Ga0500616_0000006 3300053153 Bacteria 944738
481 Ga0500619_015196 3300053154 Bacteria 2088
482 Ga0500636_0005930 3300053177 Bacteria 7001
483 Ga0500645_000290 3300053730 Bacteria 36019
484 Ga0501084_0000626 3300054114 Bacteria 26962
485 Ga0501084_0087364 3300054114 Bacteria 2618
486 Ga0501082_0042674 3300060353 Bacteria 3910
487 Ga0501082_0154777 3300060353 Bacteria 1992
488 Ga0501082_0196750 3300060353 Bacteria 1754
489 2508691887 2508501042 Bacteria 8719808
490 2511397426 2511231028 Bacteria 8046582
491 2513592583 2513237087 Bacteria 5817514
492 2513622421 2513237092 Bacteria 8341956
493 2513645529 2513237095 Bacteria 8976980
494 2513855538 2513237137 Bacteria 9558895
495 2513873063 2513237139 Bacteria 8737671
496 2514015637 2513237161 Bacteria 8871253
497 2515627205 2515154112 Bacteria 8294334
498 2517102748 2517093001 Bacteria 9002274
499 2617347074 2617270735 Bacteria 9163226
500 2644290097 2643221651 Bacteria 4798932
501 2793062674 2791355196 Bacteria 7323613
502 2805915038 2802429603 Bacteria 8777136
503 2818238576 2816332527 Bacteria 8933356
504 2824602437 2824600985 Bacteria 8488197
505 2824610448 2824609381 Bacteria 8672835
506 2824657400 2824653114 Bacteria 8493680
507 2824671963 2824671348 Bacteria 8369588
508 2824688562 2824687955 Bacteria 8360029
509 2824699872 2824696289 Bacteria 8335049
510 2824714292 2824704595 Bacteria 9667483
511 2824754276 2824753945 Bacteria 9787441
512 2824767775 2824763712 Bacteria 9792355
513 2824775329 2824773399 Bacteria 8360218
514 2838123428 2838122688 Bacteria 8803140
515 2841947799 2841941048 Bacteria 8688029
516 2841949530 2841949485 Bacteria 8680857
517 2841971963 2841966195 Bacteria 8673214
518 2841983748 2841983080 Bacteria 8395090
519 2842046949 2842045827 Bacteria 8006841
520 2847936518 2847930680 Bacteria 9342022
521 2847946865 2847939898 Bacteria 8606328
522 2849079032 2849076700 Bacteria 7039503
523 2874619451 2874612657 Bacteria 8252029
524 2874621151 2874620515 Bacteria 8290088
525 2879083221 2879083081 Bacteria 8587928
526 2881368555 2881364244 Bacteria 7710352
527 2881672600 2881665667 Bacteria 8175609
528 2885414153 2885409591 Bacteria 9235467
529 2888384394 2888378607 Bacteria 9652610
530 2888393524 2888388044 Bacteria 7304136
531 2888424823 2888419890 Bacteria 7857137
532 2904673373 2904666416 Bacteria 8226587
533 2904714999 2904711408 Bacteria 9771557
534 2906639273 2906635258 Bacteria 8601019
535 2906646620 2906643746 Bacteria 8722424
536 2906662472 2906660503 Bacteria 8595048
537 2908742363 2908739725 Bacteria 8628932
538 2935650976 2935648319 Bacteria 8801166
539 2935659157 2935656913 Bacteria 8965014
540 2935771766 2935769743 Bacteria 7878163
541 2935987428 2935984226 Bacteria 8302647
542 2936013572 2936011229 Bacteria 8801034
543 2936022301 2936019824 Bacteria 8804134
544 2936030747 2936028420 Bacteria 8965941
545 2936048560 2936046547 Bacteria 8903709
546 2936058774 2936055302 Bacteria 8785755
547 3005510610 3005506211 Bacteria 6943378
548 8006931546 8006926726 Bacteria 6749210
549 8016529325 8016522445 Bacteria 8156687
550 8016534540 8016530956 Bacteria 8155261
551 8016547757 8016539877 Bacteria 8155419
552 8016554378 8016548790 Bacteria 8155074
553 8016562746 8016557553 Bacteria 8154380
554 8016572881 8016566248 Bacteria 8158151
555 8016577040 8016575299 Bacteria 8154085
556 8016600530 8016595262 Bacteria 8149947
557 8019534301 8019530166 Bacteria 8155624
558 8019628500 8019619141 Bacteria 9218857
559 Ga0495672_0009373
560 JGI24032J14994_100495
561 JGI24752J21851_1020232
562 JGI24746J21847_1000861
563 JGI24747J21853_1002968
564 JGI24739J22299_10066316
565 JGI24737J22298_10002394
566 JGI24750J21931_1000859
567 JGI24738J21930_10001606
568 JGI24749J21850_1000589
569 JGI24035J26624_1001701
570 JGI24034J26672_10001847
571 JGI24742J22300_10000991
572 JGI24751J29686_10029296
573 JGI25406J46586_10000166
574 JGI25165J46597_1004351
575 JGI25160J50197_1000838
576 JGI25405J52794_10031955
577 Ga0065704_10255096
578 Ga0065712_10095860
579 Ga0065712_10200012
580 Ga0065715_10002503
581 Ga0070676_10003946
582 Ga0070676_10475929
583 Ga0070683_100003103
584 Ga0070683_100245619
585 Ga0070690_100001658
586 Ga0070670_100005908
587 Ga0070670_100144883
588 Ga0070670_100684204
589 Ga0070677_10002586
590 Ga0068869_100003321
591 Ga0068869_100208065
592 Ga0070666_10061316
593 Ga0070666_10347005
594 Ga0070680_100005234
595 Ga0070680_100464158
596 Ga0070682_100002520
597 Ga0068868_100009819
598 Ga0068868_100018015
599 Ga0070660_100001332
600 Ga0070689_100032582
601 Ga0070691_10002586
602 Ga0070687_100001160
603 Ga0070661_100002370
604 Ga0070692_10000841
605 Ga0070668_100006877
606 Ga0070669_100006963
607 Ga0070669_100613903
608 Ga0070675_100039738
609 Ga0070675_100077803
610 Ga0070675_100670601
611 Ga0070671_100005218
612 Ga0070671_100101128
613 Ga0070674_100006788
614 Ga0070673_100000418
615 Ga0070673_100011419
616 Ga0070688_100000906
617 Ga0070688_100041837
618 Ga0070659_100003550
619 Ga0070659_100068041
620 Ga0070659_100746125
621 Ga0070667_100007947
622 Ga0070667_100069961
623 Ga0070667_100138890
624 Ga0070703_10009495
625 Ga0070713_100000146
626 Ga0070713_100083941
627 Ga0070701_10000664
628 Ga0070701_10178248
629 Ga0070705_100003104
630 Ga0070700_100010501
631 Ga0070694_100002530
632 Ga0070708_100020015
633 Ga0070663_100002896
634 Ga0070678_100005419
635 Ga0070678_100057502
636 Ga0070678_100163247
637 Ga0070678_100378912
638 Ga0070681_10008649
639 Ga0070681_10483877
640 Ga0068867_100003064
641 Ga0068867_100253946
642 Ga0070679_100018279
643 Ga0070684_100001969
644 Ga0070697_100571351
645 Ga0068853_100004522
646 Ga0068853_100005756
647 Ga0070672_100006625
648 Ga0070672_100048783
649 Ga0070672_100183213
650 Ga0070686_100002237
651 Ga0070686_100239631
652 Ga0070695_100002841
653 Ga0070696_100003720
654 Ga0070696_100543017
655 Ga0070693_100001170
656 Ga0070665_100027334
657 Ga0070665_100031750
658 Ga0070665_100600575
659 Ga0068855_100010841
660 Ga0070664_100039822
661 Ga0070664_100965351
662 Ga0068857_100002282
663 Ga0068854_100011480
664 Ga0068854_100371757
665 Ga0068856_100002597
666 Ga0068856_100087023
667 Ga0070702_100011694
668 Ga0068852_100006066
669 Ga0068852_100010433
670 Ga0068852_100090962
671 Ga0068852_100471115
672 Ga0068852_100492648
673 Ga0068859_100005044
674 Ga0068859_100335169
675 Ga0068864_100003691
676 Ga0068864_100085589
677 Ga0068866_10000899
678 Ga0068851_10017089
679 Ga0068870_10000555
680 Ga0068863_100045734
681 Ga0068863_100105926
682 Ga0068858_100011919
683 Ga0068858_100013722
684 Ga0068858_100930323
685 Ga0068860_100016500
686 Ga0068860_100269920
687 Ga0068860_100283302
688 Ga0068862_100003011
689 Ga0068862_100500464
690 Ga0081455_10000673
691 Ga0081540_1113215
692 Ga0081539_10000351
693 Ga0081539_10000933
694 Ga0070717_10430089
695 Ga0075364_10006017
696 Ga0075362_10003298
697 Ga0075367_10184091
698 Ga0075366_10126879
699 Ga0097621_100012307
700 Ga0097621_100098401
701 Ga0097621_100101560
702 Ga0097621_100139775
703 Ga0075370_10013698
704 Ga0075370_10041199
705 Ga0068871_100040551
706 Ga0068871_100103573
707 Ga0075431_100056384
708 Ga0075433_10005076
709 Ga0075433_10197395
710 Ga0075434_100014176
711 Ga0075434_100145575
712 Ga0068865_100026222
713 Ga0097620_100005044
714 Ga0097620_100335154
715 Ga0075435_100013698
716 Ga0075435_100524925
717 Ga0105250_10039026
718 Ga0105240_10004929
719 Ga0105240_10046314
720 Ga0105240_10067342
721 Ga0111539_10021247
722 Ga0111539_10033888
723 Ga0111539_10156165
724 Ga0111539_10318846
725 Ga0111539_10713389
726 Ga0105245_10006794
727 Ga0105247_10265417
728 Ga0105243_10007504
729 Ga0105241_10002961
730 Ga0105242_10004894
731 Ga0105248_10000007
732 Ga0105248_10001330
733 Ga0105248_10005301
734 Ga0105248_10005481
735 Ga0105248_10296631
736 Ga0105237_10134145
737 Ga0105238_10085396
738 Ga0105249_10038236
739 Ga0105239_10025208
740 Ga0105239_10040990
741 Ga0105239_10109775
742 Ga0105239_10182308
743 Ga0105246_10006621
744 Ga0105246_10025354
745 Ga0157313_1004972
746 Ga0157373_10050278
747 Ga0157371_10018413
748 Ga0157374_10005394
749 Ga0157374_10436085
750 Ga0157374_10642287
751 Ga0157378_10157019
752 Ga0157378_10225036
753 Ga0157372_10005559
754 Ga0157372_10479459
755 Ga0157375_10004143
756 Ga0157375_10154705
757 Ga0163163_10004364
758 Ga0163163_10056553
759 Ga0163163_10129414
760 Ga0157380_10004080
761 Ga0157377_10002281
762 Ga0157379_10003623
763 Ga0157379_10125007
764 Ga0157379_10468430
765 Ga0157376_10008998
766 Ga0157376_10073653
767 Ga0157376_10528568
768 Ga0163161_10004907
769 Ga0163161_10411567
770 Ga0213876_10000525
771 Ga0207666_1000084
772 Ga0207673_1000790
773 Ga0209758_1000158
774 Ga0209758_1059823
775 Ga0207697_10003123
776 Ga0207697_10097105
777 Ga0207653_10001329
778 Ga0207682_10001421
779 Ga0207642_10003465
780 Ga0207710_10157002
781 Ga0207688_10000346
782 Ga0207688_10313151
783 Ga0207680_10183895
784 Ga0207647_10015607
785 Ga0207647_10071622
786 Ga0207645_10002258
787 Ga0207645_10014759
788 Ga0207643_10000870
789 Ga0207654_10128062
790 Ga0207654_10176047
791 Ga0207707_10009781
792 Ga0207707_10381846
793 Ga0207695_10000018
794 Ga0207671_10064791
795 Ga0207663_10053937
796 Ga0207660_10004540
797 Ga0207662_10000677
798 Ga0207657_10002107
799 Ga0207649_10106243
800 Ga0207652_10074024
801 Ga0207681_10033153
802 Ga0207694_10069989
803 Ga0207694_10255218
804 Ga0207650_10088533
805 Ga0207650_10310837
806 Ga0207659_10040617
807 Ga0207659_10100482
808 Ga0207700_10000031
809 Ga0207644_10049486
810 Ga0207644_10057490
811 Ga0207644_10407010
812 Ga0207690_10005379
813 Ga0207690_10324145
814 Ga0207706_10005074
815 Ga0207706_10121723
816 Ga0207709_10019030
817 Ga0207670_10008616
818 Ga0207669_10019671
819 Ga0207704_10048255
820 Ga0207691_10003147
821 Ga0207691_10024020
822 Ga0207691_10039040
823 Ga0207691_10087841
824 Ga0207711_10000014
825 Ga0207711_10000966
826 Ga0207711_10034862
827 Ga0207711_10074885
828 Ga0207689_10002387
829 Ga0207661_10323646
830 Ga0207679_10001868
831 Ga0207679_10912155
832 Ga0207667_10027970
833 Ga0207651_10019584
834 Ga0207712_10004060
835 Ga0207668_10003969
836 Ga0207668_10035585
837 Ga0207668_10081280
838 Ga0207668_10201876
839 Ga0207640_10082710
840 Ga0207658_10132543
841 Ga0207658_10225286
842 Ga0207703_10166246
843 Ga0207703_10726576
844 Ga0207639_10006216
845 Ga0207678_10002254
846 Ga0207708_10001067
847 Ga0207702_10079299
848 Ga0207641_10115954
849 Ga0207641_10637496
850 Ga0207648_10004636
851 Ga0207648_10058695
852 Ga0207676_10029874
853 Ga0207676_11117764
854 Ga0207674_10003170
855 Ga0207675_100002589
856 Ga0207675_100249448
857 Ga0207683_10004673
858 Ga0207683_10008075
859 Ga0207698_10010196
860 Ga0207698_10075194
861 Ga0207698_10451480
862 Ga0207698_11030949
863 Ga0207698_11270542
864 Ga0209974_10001225
865 Ga0207428_10016866
866 Ga0207428_10177910
867 Ga0268266_10148199
868 Ga0268266_10570928
869 Ga0268265_10020216
870 Ga0268264_10034054
871 Ga0265338_10051178
872 Ga0265320_10000962
873 Ga0265325_10017251
874 Ga0265329_10051811
875 Ga0265340_10027710
876 Ga0265339_10224589
877 Ga0265316_10023602
878 Ga0265316_10462328
879 Ga0265313_10042458
880 Ga0265313_10074418
881 Ga0265313_10095587
882 Ga0265314_10005842
883 Ga0265314_10008207
884 Ga0265342_10022418
885 Ga0265342_10291269
886 Ga0307516_10141405
887 Ga0307412_10222454
888 Ga0307409_100053687
889 Ga0307411_10142543
890 Ga0307510_10332313
891 Ga0373930_0002599
892 Ga0373948_0017011
893 Ga0373938_0002301
894 Ga0373928_0007251
895 Ga0373929_0002125
896 Ga0373929_0027123
897 Ga0373949_0002842
898 Ga0373951_0005920
899 Ga0373951_0081226
900 Ga0373952_0002641
901 Ga0373932_0004638
902 Ga0373941_0003337
903 Ga0373961_0064965
904 Ga0373931_0002564
905 Ga0373931_0030689
906 Ga0373935_0164132
907 Ga0373927_0021835
908 Ga0373947_0035544
909 Ga0373937_0174053
910 Ga0436365_0616688
911 Ga0439465_0021070
912 Ga0451835_0318508
913 Ga0451853_1083161
914 Ga0495592_0426850
915 Ga0495590_0097587
916 Ga0495638_0002040
917 Ga0495638_0058463
918 Ga0495585_0139729
919 Ga0495643_0075703
920 Ga0495621_0067124
921 Ga0495645_0016195
922 Ga0495658_0042758
923 Ga0495581_0309343
924 Ga0496100_0003283
925 Ga0496101_0067972
926 Ga0496101_0650189
927 Ga0496102_0268137
928 Ga0496102_0793614
929 Ga0496103_0023646
930 Ga0496104_0034377
931 Ga0496104_1052703
932 Ga0496105_0183143
933 Ga0496106_0190710
934 Ga0496107_0014216
935 Ga0496108_0014556
936 Ga0496108_0614781
937 Ga0496109_0004625
938 Ga0496109_0006399
939 Ga0496109_0251990
940 Ga0496110_0757301
941 Ga0496111_0018298
942 Ga0496112_0003199
943 Ga0496112_0046060
944 Ga0496113_0003250
945 Ga0496114_0159114
946 Ga0496114_0166241
947 Ga0496115_0031788
948 Ga0496115_0246117
949 Ga0496115_0356563
950 Ga0496121_0035175
951 Ga0495682_0003617
952 Ga0501031_0177457
953 Ga0501031_0297028
954 Ga0501032_0218060
955 Ga0501033_0259303
956 Ga0501034_0024805
957 Ga0501034_0052553
958 Ga0501034_0296524
959 Ga0501036_0206015
960 Ga0501036_0259397
961 Ga0501037_0276328
962 Ga0501037_0471458
963 Ga0501037_0597963
964 Ga0501038_0260733
965 Ga0501042_0364194
966 Ga0501043_0027142
967 Ga0501043_0174465
968 Ga0501043_0318580
969 Ga0501043_0487680
970 Ga0501046_0412785
971 Ga0501047_0106369
972 Ga0501047_0226026
973 Ga0501047_0529643
974 Ga0501047_0560837
975 Ga0501067_0187165
976 Ga0501068_0001062
977 Ga0501068_0224338
978 Ga0501068_0394525
979 Ga0501069_0133059
980 Ga0501070_0028297
981 Ga0501070_0069871
982 Ga0501071_0177552
983 Ga0501071_0229924
984 Ga0501072_0004447
985 Ga0501072_0376828
986 Ga0501073_0000322
987 Ga0501073_0016917
988 Ga0501074_0570864
989 Ga0501076_0416634
990 Ga0501079_0224121
991 Ga0501079_0274743
992 Ga0501080_0008962
993 Ga0501080_0013980
994 Ga0501083_0008613
995 Ga0501083_0027665
996 Ga0501083_0037689
997 Ga0501083_0037695
998 Ga0501083_0157316
999 Ga0501083_0543215
1000 Ga0501035_0313365
1001 Ga0501035_0536633
1002 Ga0501035_0671691
1003 Ga0501044_0030154
1004 Ga0501044_0145919
1005 Ga0501044_0190189
1006 Ga0501044_0243012
1007 nmdc:mga00v17_77907_c1
1008 nmdc:mga0yw44_60147_c1
1009 nmdc:mga0k408_106949_c1
1010 nmdc:mga06z11_126455_c1
1011 nmdc:mga06z11_172172_c1
1012 nmdc:mga07m45_182075_c1
1013 nmdc:mga07m45_38285_c1
1014 nmdc:mga06r32_52084_c1
1015 nmdc:mga08y16_196080_c1
1016 nmdc:mga08y16_242789_c1
1017 nmdc:mga08y16_89246_c1
1018 nmdc:mga0n895_15886_c1
1019 nmdc:mga0n895_21640_c1
1020 nmdc:mga0rr50_27982_c1
1021 nmdc:mga0a205_13046_c1
1022 Ga0500643_009483
1023 Ga0500644_0001818
1024 Ga0500651_0000483
1025 Ga0500566_0036755
1026 Ga0500641_0001124
1027 Ga0500650_0058026
1028 Ga0500562_024481
1029 Ga0500595_000029
1030 Ga0500595_032961
1031 Ga0500642_0157288
1032 Ga0500652_000029
1033 Ga0500652_074950
1034 Ga0500655_007365
1035 Ga0500655_016365
1036 Ga0500658_0069932
1037 Ga0500577_0091119
1038 Ga0500616_0000006
1039 Ga0500619_015196
1040 Ga0500636_0005930
1041 Ga0500645_000290
1042 Ga0501084_0000626
1043 Ga0501084_0087364
1044 Ga0501082_0042674
1045 Ga0501082_0154777
1046 Ga0501082_0196750
1047 2508691887
1048 2511397426
1049 2513592583
1050 2513622421
1051 2513645529
1052 2513855538
1053 2513873063
1054 2514015637
1055 2515627205
1056 2517102748
1057 2617347074
1058 2644290097
1059 2793062674
1060 2805915038
1061 2818238576
1062 2824602437
1063 2824610448
1064 2824657400
1065 2824671963
1066 2824688562
1067 2824699872
1068 2824714292
1069 2824754276
1070 2824767775
1071 2824775329
1072 2838123428
1073 2841947799
1074 2841949530
1075 2841971963
1076 2841983748
1077 2842046949
1078 2847936518
1079 2847946865
1080 2849079032
1081 2874619451
1082 2874621151
1083 2879083221
1084 2881368555
1085 2881672600
1086 2885414153
1087 2888384394
1088 2888393524
1089 2888424823
1090 2904673373
1091 2904714999
1092 2906639273
1093 2906646620
1094 2906662472
1095 2908742363
1096 2935650976
1097 2935659157
1098 2935771766
1099 2935987428
1100 2936013572
1101 2936022301
1102 2936030747
1103 2936048560
1104 2936058774
1105 3005510610
1106 8006931546
1107 8016529325
1108 8016534540
1109 8016547757
1110 8016554378
1111 8016562746
1112 8016572881
1113 8016577040
1114 8016600530
1115 8019534301
1116 8019628500

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

214

255

0.98

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

112

207

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9755 2 226
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9595 1 226
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9526 1 226
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9404 1 226
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9387 2 226
ID Description Score Start End Superfamily
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9592 2 178 2.60.120.620
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9525 180 226 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9492 180 226 4.10.860.20
af_A0A2R8QTR6_26_127_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9385 183 220 1.20.1280.290
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9333 180 226 4.10.860.20
ID Description Score Start End GO Terms
AF-A0A377TSW3-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.9946 111 189 GO:0006879
GO:0006974
GO:0016706
AF-A0A1H8NHS7-F1-model_v4 PKHD-type hydroxylase 0.9925 1 199 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A399IX52-F1-model_v4 Fe2+-dependent dioxygenase 0.992 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A2X3F8N6-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.9908 111 176 GO:0006879
GO:0006974
GO:0016706
AF-G6XFC2-F1-model_v4 Putative hydroxylase 0.9905 1 226 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418

Map